data_8IM5 # _entry.id 8IM5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8IM5 pdb_00008im5 10.2210/pdb8im5/pdb WWPDB D_1300031494 ? ? BMRB 12026 ? 10.13018/BMR12026 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-08-30 2 'Structure model' 1 1 2023-09-06 3 'Structure model' 1 2 2023-09-27 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_last' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8IM5 _pdbx_database_status.recvd_initial_deposition_date 2023-03-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 27606 unspecified BMRB . 12026 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email morimoto@moleng.kyoto-u.ac.jp _pdbx_contact_author.name_first Daichi _pdbx_contact_author.name_last Morimoto _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7672-2136 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Walinda, E.' 1 0000-0003-1882-6401 'Morimoto, D.' 2 0000-0002-7672-2136 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 299 _citation.language ? _citation.page_first 105165 _citation.page_last 105165 _citation.title 'Solution structure of the HOIL-1L NZF domain reveals a conformational switch regulating linear ubiquitin affinity.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2023.105165 _citation.pdbx_database_id_PubMed 37595872 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Walinda, E.' 1 ? primary 'Sugase, K.' 2 ? primary 'Ishii, N.' 3 ? primary 'Shirakawa, M.' 4 ? primary 'Iwai, K.' 5 ? primary 'Morimoto, D.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RanBP-type and C3HC4-type zinc finger-containing protein 1' 7434.277 1 2.3.2.31 ? ? ZN 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Heme-oxidized IRP2 ubiquitin ligase 1 homolog,HOIL-1,RING-type E3 ubiquitin transferase HOIL-1,UbcM4-interacting protein 28,Ubiquitin-conjugating enzyme 7-interacting protein 3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPLGSPEPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQ _entity_poly.pdbx_seq_one_letter_code_can GPLGSPEPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 PRO n 1 7 GLU n 1 8 PRO n 1 9 VAL n 1 10 GLY n 1 11 TRP n 1 12 GLN n 1 13 CYS n 1 14 PRO n 1 15 GLY n 1 16 CYS n 1 17 THR n 1 18 PHE n 1 19 ILE n 1 20 ASN n 1 21 LYS n 1 22 PRO n 1 23 THR n 1 24 ARG n 1 25 PRO n 1 26 GLY n 1 27 CYS n 1 28 GLU n 1 29 MET n 1 30 CYS n 1 31 CYS n 1 32 ARG n 1 33 ALA n 1 34 ARG n 1 35 PRO n 1 36 GLU n 1 37 THR n 1 38 TYR n 1 39 GLN n 1 40 ILE n 1 41 PRO n 1 42 ALA n 1 43 SER n 1 44 TYR n 1 45 GLN n 1 46 PRO n 1 47 ASP n 1 48 GLU n 1 49 GLU n 1 50 GLU n 1 51 ARG n 1 52 ALA n 1 53 ARG n 1 54 LEU n 1 55 ALA n 1 56 GLY n 1 57 GLU n 1 58 GLU n 1 59 GLU n 1 60 ALA n 1 61 LEU n 1 62 ARG n 1 63 GLN n 1 64 TYR n 1 65 GLN n 1 66 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 66 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Rbck1, Rbck, Ubce7ip3, Uip28' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLN 66 66 66 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 13 ZN CYS A . C 2 ZN 1 102 150 ZN ZN A . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8IM5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8IM5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8IM5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 8IM5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 8IM5 _struct.title 'Solution structure of the mouse HOIL1-L NZF domain in the free form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8IM5 _struct_keywords.text 'Ubiquitin-binding, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HOIL1_MOUSE _struct_ref.pdbx_db_accession Q9WUB0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQ _struct_ref.pdbx_align_begin 192 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8IM5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WUB0 _struct_ref_seq.db_align_beg 192 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 250 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8IM5 GLY A 1 ? UNP Q9WUB0 ? ? 'expression tag' 1 1 1 8IM5 PRO A 2 ? UNP Q9WUB0 ? ? 'expression tag' 2 2 1 8IM5 LEU A 3 ? UNP Q9WUB0 ? ? 'expression tag' 3 3 1 8IM5 GLY A 4 ? UNP Q9WUB0 ? ? 'expression tag' 4 4 1 8IM5 SER A 5 ? UNP Q9WUB0 ? ? 'expression tag' 5 5 1 8IM5 PRO A 6 ? UNP Q9WUB0 ? ? 'expression tag' 6 6 1 8IM5 GLU A 7 ? UNP Q9WUB0 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 47 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 61 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 47 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 61 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 13 A ZN 101 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 13 A ZN 102 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc3 metalc ? ? A CYS 16 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 16 A ZN 102 1_555 ? ? ? ? ? ? ? 2.484 ? ? metalc4 metalc ? ? A CYS 27 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 27 A ZN 102 1_555 ? ? ? ? ? ? ? 2.547 ? ? metalc5 metalc ? ? A CYS 30 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 30 A ZN 102 1_555 ? ? ? ? ? ? ? 2.493 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 16 ? A CYS 16 ? 1_555 100.3 ? 2 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 27 ? A CYS 27 ? 1_555 105.2 ? 3 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 27 ? A CYS 27 ? 1_555 110.3 ? 4 SG ? A CYS 13 ? A CYS 13 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 30 ? A CYS 30 ? 1_555 102.7 ? 5 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 30 ? A CYS 30 ? 1_555 90.1 ? 6 SG ? A CYS 27 ? A CYS 27 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 30 ? A CYS 30 ? 1_555 141.5 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.73 78.10 2 1 GLU A 7 ? ? -119.08 75.28 3 1 CYS A 16 ? ? -177.12 141.15 4 1 ILE A 19 ? ? 58.17 98.49 5 1 PRO A 25 ? ? -69.76 64.12 6 1 MET A 29 ? ? -134.75 -45.47 7 1 GLN A 45 ? ? 64.50 82.63 8 1 ASP A 47 ? ? -52.84 172.88 9 1 LEU A 61 ? ? -90.25 -64.36 10 1 TYR A 64 ? ? -88.58 -72.95 11 1 GLN A 65 ? ? -60.35 -76.01 12 2 SER A 5 ? ? -163.54 93.81 13 2 GLU A 7 ? ? -115.93 69.87 14 2 CYS A 16 ? ? -177.08 139.97 15 2 ILE A 19 ? ? 58.52 100.31 16 2 PRO A 25 ? ? -69.76 63.93 17 2 MET A 29 ? ? -134.25 -45.47 18 2 GLN A 45 ? ? 65.33 82.82 19 3 SER A 5 ? ? 63.59 160.67 20 3 GLU A 7 ? ? -113.46 74.47 21 3 CYS A 16 ? ? -177.78 138.39 22 3 ILE A 19 ? ? 61.88 100.47 23 3 PRO A 25 ? ? -69.71 62.91 24 3 MET A 29 ? ? -130.52 -44.50 25 3 TYR A 44 ? ? -56.94 -72.27 26 3 GLN A 45 ? ? 65.62 83.59 27 3 ASP A 47 ? ? -55.00 170.49 28 3 LEU A 61 ? ? -90.50 -64.42 29 3 TYR A 64 ? ? -81.95 -73.84 30 4 CYS A 16 ? ? -176.51 140.69 31 4 ILE A 19 ? ? 59.15 101.61 32 4 PRO A 25 ? ? -69.78 64.58 33 4 MET A 29 ? ? -134.28 -44.81 34 4 GLN A 45 ? ? 64.85 83.26 35 4 LEU A 61 ? ? -94.81 -68.93 36 5 PRO A 2 ? ? -69.79 77.44 37 5 SER A 5 ? ? 55.71 87.42 38 5 GLU A 7 ? ? -113.85 73.50 39 5 CYS A 16 ? ? -175.91 140.90 40 5 ILE A 19 ? ? 60.09 101.12 41 5 PRO A 25 ? ? -69.81 64.47 42 5 MET A 29 ? ? -133.47 -43.24 43 5 TYR A 44 ? ? -54.22 -70.79 44 5 GLN A 45 ? ? 64.79 83.46 45 5 LEU A 61 ? ? -90.34 -68.91 46 5 TYR A 64 ? ? -78.30 -74.21 47 6 LEU A 3 ? ? -142.57 -76.02 48 6 SER A 5 ? ? 178.75 161.83 49 6 GLU A 7 ? ? -115.99 69.88 50 6 CYS A 16 ? ? -178.08 137.36 51 6 ILE A 19 ? ? 60.62 100.97 52 6 PRO A 25 ? ? -69.79 64.57 53 6 ASP A 47 ? ? -47.97 157.91 54 6 LEU A 61 ? ? -95.91 -62.02 55 6 GLN A 65 ? ? -144.40 -78.56 56 7 PRO A 2 ? ? -69.77 78.52 57 7 SER A 5 ? ? 55.40 74.47 58 7 GLU A 7 ? ? -117.07 74.37 59 7 CYS A 16 ? ? -177.44 147.15 60 7 PHE A 18 ? ? -111.62 64.99 61 7 LYS A 21 ? ? -48.43 155.03 62 7 PRO A 25 ? ? -69.79 64.20 63 7 CYS A 27 ? ? -56.14 177.18 64 7 PRO A 41 ? ? -69.79 -175.85 65 7 GLN A 45 ? ? 60.27 102.59 66 7 ASP A 47 ? ? -54.00 175.85 67 7 LEU A 61 ? ? -90.39 -63.42 68 7 GLN A 65 ? ? -148.16 -75.76 69 8 CYS A 16 ? ? -177.23 143.16 70 8 ILE A 19 ? ? 60.49 101.60 71 8 PRO A 25 ? ? -69.71 65.27 72 8 MET A 29 ? ? -134.47 -39.80 73 8 CYS A 31 ? ? 81.29 30.46 74 8 TYR A 44 ? ? -53.04 -71.46 75 8 GLN A 45 ? ? 65.50 82.38 76 8 LEU A 61 ? ? -90.94 -66.92 77 8 TYR A 64 ? ? -78.06 -74.32 78 9 SER A 5 ? ? -179.69 -61.25 79 9 CYS A 16 ? ? -178.35 138.21 80 9 ILE A 19 ? ? 60.89 100.61 81 9 PRO A 25 ? ? -69.75 63.91 82 9 MET A 29 ? ? -130.29 -45.53 83 9 TYR A 44 ? ? -55.27 -71.34 84 9 GLN A 45 ? ? 65.59 84.09 85 9 LEU A 61 ? ? -96.82 -61.92 86 10 PRO A 2 ? ? -69.73 88.29 87 10 LEU A 3 ? ? -106.45 51.76 88 10 ILE A 19 ? ? 62.20 104.40 89 10 PRO A 25 ? ? -69.82 64.40 # _pdbx_entry_details.entry_id 8IM5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_nmr_ensemble.entry_id 8IM5 _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8IM5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] HOIL-1L NZF domain, 20 mM HEPES pH 7.0, 1 mM TCEP, 50 mM sodium chloride, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 15N_13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'NMR sample for structure determination 13C- and 15N-NOESY measurements in isotropic liquid' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'HOIL-1L NZF domain' 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'HEPES pH 7.0' 20 ? mM 'natural abundance' 1 TCEP 1 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 mbar 1013.2 7.0 70 ;Buffer conditions for structure determination 13C- and 15N-NOESY measurements in isotropic liquid as described before in Ishii, Naoki, et al. "NMR resonance assignments of the NZF domain of mouse HOIL-1L free and bound to linear di-ubiquitin." Biomolecular NMR Assignments 13.1 (2019): 149-153. ; ? mM conditions_1 0.05 pH ? 0.2 K 2 298 mbar 1013.2 7.0 70 ;PEG bicelle nematic phase was obtained by mixing Pentaethylene glycol monododecyl ether (C12E5 PEG, Sigma Aldrich) with NMR buffer (as defined in condition_1) and then stepwise adding small aliquots (1 microliterl) of hexanol (Sigma Aldrich) according to the detailed protocol given on: http://www.nmr2.buffalo.edu/nesg.wiki/Alignment_Media_Preparation ; ? mM anisotropic_1 0.05 pH ? 0.2 K 3 298 mbar 1013.2 7.0 40 'Pf1 phage from ASLA biotech was mixed with condition_1 to achieve a final concentration of Pf1 phage of 10 mg/ml.' ? mM anisotropic_2 0.05 pH ? 0.2 K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 2 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 2 1 'HSQC-DSSE (IPAP)' 1 anisotropic 5 3 1 'HSQC-DSSE (IPAP)' 1 anisotropic 6 1 1 'HSQC-DSSE (IPAP)' 1 isotropic # _pdbx_nmr_refine.entry_id 8IM5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.ordinal 1 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CYANA _pdbx_nmr_software.version 3.98.13 _pdbx_nmr_software.authors 'Peter Guentert' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TRP N N N N 297 TRP CA C N S 298 TRP C C N N 299 TRP O O N N 300 TRP CB C N N 301 TRP CG C Y N 302 TRP CD1 C Y N 303 TRP CD2 C Y N 304 TRP NE1 N Y N 305 TRP CE2 C Y N 306 TRP CE3 C Y N 307 TRP CZ2 C Y N 308 TRP CZ3 C Y N 309 TRP CH2 C Y N 310 TRP OXT O N N 311 TRP H H N N 312 TRP H2 H N N 313 TRP HA H N N 314 TRP HB2 H N N 315 TRP HB3 H N N 316 TRP HD1 H N N 317 TRP HE1 H N N 318 TRP HE3 H N N 319 TRP HZ2 H N N 320 TRP HZ3 H N N 321 TRP HH2 H N N 322 TRP HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 ZN ZN ZN N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 20K15756 1 'Japan Society for the Promotion of Science (JSPS)' Japan 22K06161 2 'Japan Society for the Promotion of Science (JSPS)' Japan 18K14665 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details '5-mm 15N/13C/1H z-gradient triple resonance cryogenic probe' # _atom_sites.entry_id 8IM5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_