data_8J3N # _entry.id 8J3N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8J3N pdb_00008j3n 10.2210/pdb8j3n/pdb WWPDB D_1300037130 ? ? BMRB 51902 ? 10.13018/BMR51902 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-17 2 'Structure model' 1 1 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8J3N _pdbx_database_status.recvd_initial_deposition_date 2023-04-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51902 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email atia.tulwahab@iccs.edu _pdbx_contact_author.name_first Atia-tul _pdbx_contact_author.name_last Wahab _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2730-5547 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wahab, A.' 1 0000-0002-2730-5547 'Ashraf, F.' 2 0009-0005-2355-8351 'Choudhary, M.I.' 3 0000-0001-5356-3585 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution NMR structure of purS subunit of phosphoribosylformylglycinamidine synthase enzyme from Staphylococcus aureus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wahab, A.' 1 0000-0002-2730-5547 primary 'Ashraf, F.' 2 0009-0005-2355-8351 primary 'Choudhary, M.I.' 3 0000-0001-5356-3585 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Phosphoribosylformylglycinamidine synthase subunit PurS' _entity.formula_weight 10060.316 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.3.5.3 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;FGAM synthase,Formylglycinamide ribonucleotide amidotransferase subunit III,FGAR amidotransferase III,FGAR-AT III,Phosphoribosylformylglycinamidine synthase subunit III ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AGMKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYK VLDDEKENA ; _entity_poly.pdbx_seq_one_letter_code_can ;AGMKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYK VLDDEKENA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLY n 1 3 MET n 1 4 LYS n 1 5 THR n 1 6 ILE n 1 7 GLU n 1 8 LEU n 1 9 HIS n 1 10 ILE n 1 11 THR n 1 12 LEU n 1 13 GLN n 1 14 PRO n 1 15 GLN n 1 16 VAL n 1 17 LEU n 1 18 ASP n 1 19 THR n 1 20 GLN n 1 21 GLY n 1 22 GLN n 1 23 THR n 1 24 LEU n 1 25 THR n 1 26 ARG n 1 27 ALA n 1 28 VAL n 1 29 HIS n 1 30 ASP n 1 31 LEU n 1 32 GLY n 1 33 TYR n 1 34 ALA n 1 35 GLN n 1 36 VAL n 1 37 ASN n 1 38 ASP n 1 39 ILE n 1 40 ARG n 1 41 VAL n 1 42 GLY n 1 43 LYS n 1 44 VAL n 1 45 LEU n 1 46 TYR n 1 47 MET n 1 48 THR n 1 49 VAL n 1 50 ASP n 1 51 GLU n 1 52 VAL n 1 53 SER n 1 54 ASP n 1 55 GLU n 1 56 LYS n 1 57 VAL n 1 58 HIS n 1 59 ASN n 1 60 ILE n 1 61 ILE n 1 62 THR n 1 63 THR n 1 64 LEU n 1 65 SER n 1 66 GLU n 1 67 LYS n 1 68 LEU n 1 69 PHE n 1 70 ALA n 1 71 ASN n 1 72 THR n 1 73 VAL n 1 74 ILE n 1 75 GLU n 1 76 GLU n 1 77 TYR n 1 78 SER n 1 79 TYR n 1 80 LYS n 1 81 VAL n 1 82 LEU n 1 83 ASP n 1 84 ASP n 1 85 GLU n 1 86 LYS n 1 87 GLU n 1 88 ASN n 1 89 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 89 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'purS, SAV1067' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ATCC _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus Mu50' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158878 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700699 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pSpeedET _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ALA 89 89 89 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8J3N _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8J3N _struct.title 'Solution NMR structure of purS subunit of phosphoribosylformylglycinamidine synthase enzyme from Staphylococcus aureus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8J3N _struct_keywords.text 'Phosphoribosylformylglycinamidine synthase, subunit PurS, Staphylococcus aureus, LYASE' _struct_keywords.pdbx_keywords LYASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H3JUS1_STAAM _struct_ref.pdbx_db_accession A0A0H3JUS1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVL DDEKENA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8J3N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0H3JUS1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8J3N ALA A 1 ? UNP A0A0H3JUS1 ? ? 'expression tag' 1 1 1 8J3N GLY A 2 ? UNP A0A0H3JUS1 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 23 ? GLY A 32 ? THR A 23 GLY A 32 1 ? 10 HELX_P HELX_P2 AA2 THR A 63 ? LEU A 68 ? THR A 63 LEU A 68 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 12 ? ? -39.50 154.50 2 1 PRO A 14 ? ? -69.75 -98.46 3 1 TYR A 33 ? ? -115.17 56.20 4 1 VAL A 44 ? ? 172.15 115.71 5 1 SER A 53 ? ? -49.15 165.13 6 1 HIS A 58 ? ? -69.91 -114.38 7 1 ASN A 59 ? ? -130.45 -93.12 8 1 THR A 62 ? ? -54.11 -95.63 9 1 LEU A 68 ? ? -140.91 -54.47 10 1 ILE A 74 ? ? -156.33 43.55 11 1 VAL A 81 ? ? -49.95 90.20 12 1 ASP A 83 ? ? -17.00 -93.93 13 1 GLU A 85 ? ? 144.54 74.79 14 1 ASN A 88 ? ? -103.64 -92.65 15 2 LEU A 12 ? ? -39.19 153.13 16 2 PRO A 14 ? ? -69.77 -96.53 17 2 TYR A 33 ? ? -116.73 53.62 18 2 VAL A 44 ? ? 173.11 116.44 19 2 SER A 53 ? ? -46.18 161.25 20 2 VAL A 57 ? ? -27.65 -66.87 21 2 HIS A 58 ? ? -87.65 -106.26 22 2 ASN A 59 ? ? -128.93 -90.62 23 2 THR A 62 ? ? -55.90 -96.91 24 2 LEU A 68 ? ? -140.31 -52.39 25 2 ILE A 74 ? ? -153.40 44.14 26 2 VAL A 81 ? ? -50.16 88.52 27 2 ASP A 83 ? ? -9.80 -97.07 28 2 GLU A 85 ? ? 144.11 71.16 29 2 ASN A 88 ? ? -107.34 -92.96 30 3 LEU A 12 ? ? -40.73 156.42 31 3 PRO A 14 ? ? -69.78 -97.68 32 3 TYR A 33 ? ? -115.69 56.80 33 3 VAL A 44 ? ? 171.76 116.72 34 3 VAL A 52 ? ? -131.80 -39.43 35 3 SER A 53 ? ? -48.45 150.11 36 3 HIS A 58 ? ? -74.83 -110.03 37 3 ASN A 59 ? ? -129.63 -95.15 38 3 THR A 62 ? ? -54.55 -97.66 39 3 LEU A 68 ? ? -140.48 -52.74 40 3 ILE A 74 ? ? -163.01 44.51 41 3 VAL A 81 ? ? -49.55 89.43 42 3 ASP A 83 ? ? -11.96 -95.30 43 3 GLU A 85 ? ? 144.78 73.53 44 3 ASN A 88 ? ? -101.86 -89.47 45 4 LEU A 12 ? ? -38.83 153.23 46 4 PRO A 14 ? ? -69.73 -100.87 47 4 GLN A 22 ? ? -100.01 -162.57 48 4 TYR A 33 ? ? -116.51 53.99 49 4 VAL A 44 ? ? 172.52 115.74 50 4 SER A 53 ? ? -49.54 151.09 51 4 HIS A 58 ? ? -71.91 -110.32 52 4 ASN A 59 ? ? -127.87 -95.68 53 4 THR A 62 ? ? -54.49 -95.00 54 4 SER A 65 ? ? -54.37 -70.21 55 4 LEU A 68 ? ? -141.78 -50.77 56 4 ILE A 74 ? ? -154.86 46.05 57 4 VAL A 81 ? ? -48.95 87.89 58 4 ASP A 83 ? ? -1.21 -98.28 59 4 GLU A 85 ? ? 144.65 79.09 60 4 LYS A 86 ? ? -151.23 74.96 61 4 ASN A 88 ? ? -102.04 -93.32 62 5 LEU A 12 ? ? -40.71 155.33 63 5 PRO A 14 ? ? -69.75 -99.80 64 5 VAL A 44 ? ? 173.05 116.16 65 5 VAL A 52 ? ? -132.45 -40.24 66 5 SER A 53 ? ? -48.45 154.59 67 5 HIS A 58 ? ? -73.11 -110.67 68 5 ASN A 59 ? ? -129.84 -94.68 69 5 THR A 62 ? ? -53.12 -95.71 70 5 LEU A 68 ? ? -138.66 -55.77 71 5 ILE A 74 ? ? -164.28 43.04 72 5 VAL A 81 ? ? -50.08 88.79 73 5 ASP A 83 ? ? -10.48 -97.51 74 5 GLU A 85 ? ? 144.50 72.91 75 5 LYS A 86 ? ? -150.01 75.73 76 5 ASN A 88 ? ? -99.91 -91.39 77 6 THR A 5 ? ? -68.20 87.68 78 6 LEU A 12 ? ? -40.73 154.56 79 6 PRO A 14 ? ? -69.83 -99.10 80 6 TYR A 33 ? ? -116.24 56.05 81 6 VAL A 44 ? ? 172.79 118.49 82 6 VAL A 52 ? ? -142.50 -35.89 83 6 SER A 53 ? ? -47.41 161.52 84 6 VAL A 57 ? ? -27.06 -66.75 85 6 HIS A 58 ? ? -86.52 -106.24 86 6 ASN A 59 ? ? -126.88 -92.52 87 6 THR A 62 ? ? -53.51 -95.90 88 6 LEU A 68 ? ? -141.11 -53.91 89 6 ILE A 74 ? ? -166.94 43.14 90 6 VAL A 81 ? ? -49.25 87.89 91 6 ASP A 83 ? ? -8.90 -96.93 92 6 GLU A 85 ? ? 145.98 73.76 93 6 LYS A 86 ? ? -150.24 75.70 94 6 ASN A 88 ? ? -104.59 -88.54 95 7 LEU A 12 ? ? -39.83 153.22 96 7 PRO A 14 ? ? -69.72 -98.10 97 7 TYR A 33 ? ? -117.36 54.51 98 7 VAL A 44 ? ? 172.30 117.23 99 7 VAL A 52 ? ? -140.25 -38.61 100 7 SER A 53 ? ? -47.27 158.61 101 7 VAL A 57 ? ? -27.85 -58.93 102 7 HIS A 58 ? ? -85.03 -107.23 103 7 ASN A 59 ? ? -129.56 -92.13 104 7 THR A 62 ? ? -52.95 -95.50 105 7 LEU A 68 ? ? -140.83 -53.29 106 7 ILE A 74 ? ? -155.23 46.95 107 7 VAL A 81 ? ? -49.36 88.80 108 7 ASP A 83 ? ? -10.44 -95.94 109 7 GLU A 85 ? ? 145.27 73.10 110 7 ASN A 88 ? ? -103.14 -91.11 111 8 LEU A 12 ? ? -38.53 151.88 112 8 PRO A 14 ? ? -69.72 -100.07 113 8 VAL A 44 ? ? 172.58 115.80 114 8 VAL A 52 ? ? -135.88 -32.86 115 8 SER A 53 ? ? -48.04 153.58 116 8 HIS A 58 ? ? -78.01 -111.16 117 8 ASN A 59 ? ? -136.38 -92.89 118 8 THR A 62 ? ? -53.72 -98.74 119 8 LEU A 68 ? ? -140.67 -53.70 120 8 ILE A 74 ? ? -166.02 42.72 121 8 VAL A 81 ? ? -49.89 89.58 122 8 ASP A 83 ? ? -17.84 -93.47 123 8 GLU A 85 ? ? 144.03 74.96 124 8 LYS A 86 ? ? -150.33 77.37 125 8 ASN A 88 ? ? -100.68 -92.11 126 9 LEU A 12 ? ? -39.47 154.19 127 9 PRO A 14 ? ? -69.73 -97.33 128 9 TYR A 33 ? ? -115.65 55.59 129 9 VAL A 44 ? ? 171.70 115.84 130 9 VAL A 52 ? ? -138.24 -36.03 131 9 SER A 53 ? ? -48.54 161.22 132 9 VAL A 57 ? ? -28.36 -65.47 133 9 HIS A 58 ? ? -86.43 -108.56 134 9 ASN A 59 ? ? -128.14 -91.71 135 9 THR A 62 ? ? -55.62 -96.34 136 9 LEU A 68 ? ? -140.74 -53.85 137 9 ILE A 74 ? ? -163.55 43.11 138 9 VAL A 81 ? ? -49.10 88.43 139 9 ASP A 83 ? ? -9.79 -97.45 140 9 GLU A 85 ? ? 146.88 74.89 141 9 LYS A 86 ? ? -150.14 71.64 142 9 GLU A 87 ? ? -69.12 -179.09 143 9 ASN A 88 ? ? -105.08 -100.85 144 10 LEU A 12 ? ? -39.08 153.35 145 10 PRO A 14 ? ? -69.75 -101.95 146 10 GLN A 22 ? ? -99.74 -159.55 147 10 TYR A 33 ? ? -115.22 53.60 148 10 VAL A 44 ? ? 172.91 115.64 149 10 VAL A 52 ? ? -134.92 -38.29 150 10 SER A 53 ? ? -48.35 150.61 151 10 HIS A 58 ? ? -75.17 -109.68 152 10 ASN A 59 ? ? -130.22 -93.77 153 10 THR A 62 ? ? -54.02 -97.05 154 10 LEU A 68 ? ? -141.09 -53.27 155 10 ILE A 74 ? ? -163.39 43.91 156 10 VAL A 81 ? ? -49.59 89.06 157 10 ASP A 83 ? ? -10.85 -96.30 158 10 GLU A 85 ? ? 145.34 72.30 159 10 ASN A 88 ? ? -100.98 -78.60 160 11 LEU A 12 ? ? -37.63 148.45 161 11 PRO A 14 ? ? -69.84 -99.76 162 11 VAL A 44 ? ? 172.24 115.79 163 11 VAL A 52 ? ? -132.22 -35.93 164 11 SER A 53 ? ? -48.77 155.85 165 11 HIS A 58 ? ? -75.10 -97.67 166 11 ASN A 59 ? ? -135.98 -94.25 167 11 THR A 62 ? ? -51.89 -94.73 168 11 LEU A 68 ? ? -140.38 -52.48 169 11 ILE A 74 ? ? -155.46 47.66 170 11 VAL A 81 ? ? -49.56 87.79 171 11 ASP A 83 ? ? -9.52 -97.40 172 11 GLU A 85 ? ? 145.48 70.80 173 11 ASN A 88 ? ? -97.01 -91.90 174 12 LEU A 12 ? ? -38.89 152.61 175 12 PRO A 14 ? ? -69.77 -97.30 176 12 VAL A 44 ? ? 173.14 116.28 177 12 VAL A 52 ? ? -130.55 -40.91 178 12 SER A 53 ? ? -48.37 158.04 179 12 HIS A 58 ? ? -73.33 -110.57 180 12 ASN A 59 ? ? -128.95 -94.94 181 12 THR A 62 ? ? -53.40 -95.91 182 12 LEU A 68 ? ? -138.82 -54.52 183 12 ILE A 74 ? ? -162.54 44.51 184 12 VAL A 81 ? ? -50.60 89.48 185 12 ASP A 83 ? ? -14.94 -94.75 186 12 GLU A 85 ? ? 143.44 77.01 187 12 LYS A 86 ? ? -150.73 76.73 188 12 ASN A 88 ? ? -102.59 -88.83 189 13 LEU A 12 ? ? -39.34 153.16 190 13 PRO A 14 ? ? -69.82 -100.48 191 13 TYR A 33 ? ? -115.57 57.55 192 13 VAL A 44 ? ? 171.90 115.73 193 13 VAL A 52 ? ? -133.03 -37.47 194 13 SER A 53 ? ? -48.55 165.01 195 13 HIS A 58 ? ? -74.88 -109.82 196 13 ASN A 59 ? ? -129.45 -94.82 197 13 THR A 62 ? ? -52.46 -94.00 198 13 SER A 65 ? ? -51.13 -71.33 199 13 LEU A 68 ? ? -139.11 -46.73 200 13 ILE A 74 ? ? -153.81 -23.26 201 13 VAL A 81 ? ? -49.90 86.70 202 13 ASP A 83 ? ? 7.74 -107.29 203 13 GLU A 85 ? ? 159.10 65.03 204 13 ASN A 88 ? ? -97.48 -106.72 205 14 LEU A 12 ? ? -39.79 155.45 206 14 PRO A 14 ? ? -69.76 -98.99 207 14 TYR A 33 ? ? -115.24 57.65 208 14 VAL A 44 ? ? 172.40 115.70 209 14 VAL A 52 ? ? -140.37 -35.95 210 14 SER A 53 ? ? -49.19 166.69 211 14 VAL A 57 ? ? -27.36 -65.51 212 14 HIS A 58 ? ? -87.64 -107.05 213 14 ASN A 59 ? ? -127.11 -92.00 214 14 THR A 62 ? ? -54.31 -96.17 215 14 LEU A 68 ? ? -140.93 -52.60 216 14 ILE A 74 ? ? -154.51 46.00 217 14 VAL A 81 ? ? -50.02 88.17 218 14 ASP A 83 ? ? -6.01 -99.12 219 14 GLU A 85 ? ? 144.77 73.56 220 14 LYS A 86 ? ? -150.67 74.31 221 14 ASN A 88 ? ? -98.33 -80.98 222 15 LEU A 12 ? ? -38.68 151.23 223 15 PRO A 14 ? ? -69.75 -99.83 224 15 TYR A 33 ? ? -106.70 50.35 225 15 VAL A 44 ? ? 170.99 115.87 226 15 VAL A 52 ? ? -143.58 -36.35 227 15 SER A 53 ? ? -46.33 158.01 228 15 VAL A 57 ? ? -26.35 -56.84 229 15 HIS A 58 ? ? -83.15 -102.40 230 15 ASN A 59 ? ? -129.83 -95.55 231 15 THR A 62 ? ? -52.52 -96.65 232 15 LEU A 68 ? ? -139.47 -54.69 233 15 ILE A 74 ? ? -164.00 45.86 234 15 VAL A 81 ? ? -49.68 88.58 235 15 ASP A 83 ? ? -13.85 -94.61 236 15 GLU A 85 ? ? 144.71 72.59 237 15 LYS A 86 ? ? -150.03 79.20 238 15 ASN A 88 ? ? -98.81 -91.63 239 16 LEU A 12 ? ? -40.54 155.20 240 16 PRO A 14 ? ? -69.79 -99.17 241 16 VAL A 44 ? ? 172.97 116.13 242 16 VAL A 52 ? ? -145.85 -31.48 243 16 SER A 53 ? ? -45.36 160.87 244 16 VAL A 57 ? ? -28.20 -66.11 245 16 HIS A 58 ? ? -85.71 -104.56 246 16 ASN A 59 ? ? -131.73 -91.69 247 16 THR A 62 ? ? -53.78 -95.60 248 16 LEU A 68 ? ? -139.84 -54.28 249 16 ILE A 74 ? ? -164.10 44.49 250 16 VAL A 81 ? ? -49.84 89.04 251 16 ASP A 83 ? ? -9.99 -96.63 252 16 GLU A 85 ? ? 145.35 74.48 253 16 LYS A 86 ? ? -150.98 76.38 254 16 ASN A 88 ? ? -102.91 -85.61 255 17 LEU A 12 ? ? -37.47 149.15 256 17 PRO A 14 ? ? -69.81 -97.36 257 17 TYR A 33 ? ? -108.91 48.69 258 17 VAL A 44 ? ? 172.43 115.34 259 17 SER A 53 ? ? -47.55 162.75 260 17 HIS A 58 ? ? -76.63 -95.99 261 17 ASN A 59 ? ? -138.43 -93.54 262 17 THR A 62 ? ? -50.15 -94.44 263 17 SER A 65 ? ? -50.45 -70.95 264 17 LEU A 68 ? ? -138.82 -47.18 265 17 ILE A 74 ? ? -162.70 43.39 266 17 VAL A 81 ? ? -49.98 86.14 267 17 ASP A 83 ? ? 3.98 -105.26 268 17 GLU A 85 ? ? 156.49 63.71 269 17 ASN A 88 ? ? -96.27 -96.93 270 18 LEU A 12 ? ? -39.06 153.62 271 18 PRO A 14 ? ? -69.70 -99.34 272 18 TYR A 33 ? ? -116.19 57.44 273 18 VAL A 44 ? ? 172.39 115.88 274 18 SER A 53 ? ? -49.59 152.90 275 18 HIS A 58 ? ? -72.82 -111.06 276 18 ASN A 59 ? ? -127.32 -97.05 277 18 THR A 62 ? ? -53.00 -96.14 278 18 LEU A 68 ? ? -139.50 -54.00 279 18 ILE A 74 ? ? -164.22 46.50 280 18 VAL A 81 ? ? -48.51 87.29 281 18 ASP A 83 ? ? -3.33 -96.16 282 18 GLU A 85 ? ? 145.72 76.22 283 18 LYS A 86 ? ? -151.10 77.84 284 18 ASN A 88 ? ? -100.04 -90.34 # _pdbx_nmr_ensemble.entry_id 8J3N _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8J3N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.2 mM 15N,13C Uniformly labeled Subunit PurS of phosphoribosylformylglycinamidine synthase, 20 mM sodium phosphate, 20 mM sodium chloride, 1 mM DTT, 0.03 % sodium azide, 0.15 mM DSS, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 15N,13C _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '1.2 mM protein in 20 mM sodium phosphate buffer pH 6.0, 20 mM sodium chloride, 1 mM DTT.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Subunit PurS of phosphoribosylformylglycinamidine synthase' 1.2 ? mM '15N,13C Uniformly labeled' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 'sodium chloride' 20 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 'sodium azide' 0.03 ? % 'natural abundance' 1 DSS 0.15 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details '1.2 mM protein in 20 mM sodium phosphate buffer pH 6.0, 20 mM sodium chloride, 1 mM DTT, NaN3 0.03%, DSS 0.15 mM' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label '15N,13C Uniformly Labeled' _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 7 1 1 '3D HNHA' 1 isotropic 8 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 9 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 8J3N _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' CARA 1.8.4.2 'Keller and Wuthrich' 8 'chemical shift assignment' Sparky 3.114 'T. D. Goddard and D. G. Kneller' 2 'peak picking' Sparky 3.114 'T. D. Goddard and D. G. Kneller' 3 collection TopSpin 3.5pl7 'Bruker Biospin' 9 processing TopSpin 3.5pl7 'Bruker Biospin' 5 'structure calculation' CYANA 3.98.15 'Guntert, Mumenthaler and Wuthrich' 4 'data analysis' TALOS-N 4.12 'Yang Shen, and Ad Bax' 6 'data analysis' MOLMOL ? 'Koradi, Billeter and Wuthrich' 7 'data analysis' PyMOL ? 'Schrodinger, and DeLano' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8J3N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_