data_8J3Q # _entry.id 8J3Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8J3Q pdb_00008j3q 10.2210/pdb8j3q/pdb WWPDB D_1300035903 ? ? BMRB 36559 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB wildtype 8HWU unspecified BMRB 'Solution structure of LL-TILmut1' 36559 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8J3Q _pdbx_database_status.recvd_initial_deposition_date 2023-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rami, M.J.' 1 0000-0002-5845-1600 'Sarma, S.P.' 2 0000-0001-7619-8904 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 2952 _citation.page_last 2969 _citation.title ;Structural, Functional, and Mutational Studies of a Potent Subtilisin Inhibitor from Budgett's Frog, Lepidobatrachus laevis. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.3c00252 _citation.pdbx_database_id_PubMed 37796763 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rami, M.' 1 ? primary 'Shafique, M.' 2 ? primary 'Sarma, S.P.' 3 0000-0001-7619-8904 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description LL-TIL_mut1 _entity.formula_weight 6458.609 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMIRCPKDKIYKFCGSPCPPSCKDLTPNCTRECKKGCFCRDGTVDNNHGKCVKKENC _entity_poly.pdbx_seq_one_letter_code_can GSMIRCPKDKIYKFCGSPCPPSCKDLTPNCTRECKKGCFCRDGTVDNNHGKCVKKENC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 ILE n 1 5 ARG n 1 6 CYS n 1 7 PRO n 1 8 LYS n 1 9 ASP n 1 10 LYS n 1 11 ILE n 1 12 TYR n 1 13 LYS n 1 14 PHE n 1 15 CYS n 1 16 GLY n 1 17 SER n 1 18 PRO n 1 19 CYS n 1 20 PRO n 1 21 PRO n 1 22 SER n 1 23 CYS n 1 24 LYS n 1 25 ASP n 1 26 LEU n 1 27 THR n 1 28 PRO n 1 29 ASN n 1 30 CYS n 1 31 THR n 1 32 ARG n 1 33 GLU n 1 34 CYS n 1 35 LYS n 1 36 LYS n 1 37 GLY n 1 38 CYS n 1 39 PHE n 1 40 CYS n 1 41 ARG n 1 42 ASP n 1 43 GLY n 1 44 THR n 1 45 VAL n 1 46 ASP n 1 47 ASN n 1 48 ASN n 1 49 HIS n 1 50 GLY n 1 51 LYS n 1 52 CYS n 1 53 VAL n 1 54 LYS n 1 55 LYS n 1 56 GLU n 1 57 ASN n 1 58 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 58 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lepidobatrachus laevis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8376 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8J3Q _struct_ref.pdbx_db_accession 8J3Q _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8J3Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8J3Q _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 58 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 58 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D H(CCO)NH' 1 isotropic 14 1 1 '3D C(CO)NH' 1 isotropic 13 1 1 '3D HNHA' 1 isotropic 11 1 1 '3D 1H-15N NOESY' 1 isotropic 10 1 1 '3D 1H-13C NOESY' 1 isotropic 9 1 1 '3D H-BOND HNCO' 1 isotropic 8 1 1 '3D HNHB' 1 isotropic 7 1 1 '3D HN(CO)HB' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '600 uM [U-13C; U-15N] LL-TIL_mut1, 20 mM sodium chloride, 20 mM potassium phosphate, 0.01 % sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 15N_13C_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model VARIAN _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Agilent _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8J3Q _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 8J3Q _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8J3Q _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8J3Q _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8J3Q _struct.title 'Solution structure of LL-TILmut1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8J3Q _struct_keywords.text 'Inhibitor, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 56 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 56 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 58 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 6 A CYS 38 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 15 A CYS 34 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 19 A CYS 30 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf4 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 23 A CYS 58 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf5 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 40 A CYS 52 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 10 ? LYS A 13 ? LYS A 10 LYS A 13 AA1 2 GLY A 37 ? CYS A 40 ? GLY A 37 CYS A 40 AA2 1 THR A 44 ? ASP A 46 ? THR A 44 ASP A 46 AA2 2 CYS A 52 ? LYS A 54 ? CYS A 52 LYS A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 11 ? N ILE A 11 O PHE A 39 ? O PHE A 39 AA2 1 2 N VAL A 45 ? N VAL A 45 O VAL A 53 ? O VAL A 53 # _atom_sites.entry_id 8J3Q _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 CYS 58 58 58 CYS CYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email sidd@iisc.ac.in _pdbx_contact_author.name_first Siddhartha _pdbx_contact_author.name_last Sarma _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7619-8904 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 LL-TIL_mut1 600 ? uM '[U-13C; U-15N]' 1 'sodium chloride' 20 ? mM 'natural abundance' 1 'potassium phosphate' 20 ? mM 'natural abundance' 1 'sodium azide' 0.01 ? % 'natural abundance' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 9 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HZ2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 10 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 27 ? ? -154.48 85.16 2 3 THR A 31 ? ? -95.75 30.41 3 4 MET A 3 ? ? 69.02 -68.56 4 4 PRO A 7 ? ? -45.49 151.62 5 5 THR A 31 ? ? -85.71 34.92 6 5 ARG A 32 ? ? -48.78 153.93 7 6 SER A 2 ? ? 60.26 -155.23 8 6 MET A 3 ? ? 72.34 158.19 9 6 THR A 31 ? ? -89.46 31.05 10 6 CYS A 40 ? ? -55.74 171.34 11 7 THR A 31 ? ? -93.40 31.20 12 8 MET A 3 ? ? -169.93 -69.43 13 8 THR A 31 ? ? -80.48 31.67 14 9 SER A 2 ? ? 64.77 102.01 15 9 THR A 31 ? ? -95.50 30.11 16 9 CYS A 40 ? ? -65.89 -180.00 17 11 THR A 31 ? ? -93.56 30.93 18 12 THR A 31 ? ? -82.80 30.69 19 13 SER A 2 ? ? 64.65 -179.87 20 13 THR A 31 ? ? -81.99 32.03 21 14 CYS A 40 ? ? -65.84 -179.04 22 15 THR A 31 ? ? -86.67 32.08 23 15 CYS A 40 ? ? -62.87 -176.63 24 16 THR A 31 ? ? -80.67 31.16 25 17 THR A 31 ? ? -91.12 31.51 26 18 MET A 3 ? ? 59.06 83.09 27 18 THR A 31 ? ? -87.81 31.07 28 18 ASN A 48 ? ? -75.58 32.81 29 19 SER A 2 ? ? 69.73 116.65 30 19 THR A 27 ? ? -152.98 84.30 31 19 THR A 31 ? ? -78.37 31.23 32 20 MET A 3 ? ? -126.36 -51.96 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 LYS N N N N 169 LYS CA C N S 170 LYS C C N N 171 LYS O O N N 172 LYS CB C N N 173 LYS CG C N N 174 LYS CD C N N 175 LYS CE C N N 176 LYS NZ N N N 177 LYS OXT O N N 178 LYS H H N N 179 LYS H2 H N N 180 LYS HA H N N 181 LYS HB2 H N N 182 LYS HB3 H N N 183 LYS HG2 H N N 184 LYS HG3 H N N 185 LYS HD2 H N N 186 LYS HD3 H N N 187 LYS HE2 H N N 188 LYS HE3 H N N 189 LYS HZ1 H N N 190 LYS HZ2 H N N 191 LYS HZ3 H N N 192 LYS HXT H N N 193 MET N N N N 194 MET CA C N S 195 MET C C N N 196 MET O O N N 197 MET CB C N N 198 MET CG C N N 199 MET SD S N N 200 MET CE C N N 201 MET OXT O N N 202 MET H H N N 203 MET H2 H N N 204 MET HA H N N 205 MET HB2 H N N 206 MET HB3 H N N 207 MET HG2 H N N 208 MET HG3 H N N 209 MET HE1 H N N 210 MET HE2 H N N 211 MET HE3 H N N 212 MET HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TYR N N N N 285 TYR CA C N S 286 TYR C C N N 287 TYR O O N N 288 TYR CB C N N 289 TYR CG C Y N 290 TYR CD1 C Y N 291 TYR CD2 C Y N 292 TYR CE1 C Y N 293 TYR CE2 C Y N 294 TYR CZ C Y N 295 TYR OH O N N 296 TYR OXT O N N 297 TYR H H N N 298 TYR H2 H N N 299 TYR HA H N N 300 TYR HB2 H N N 301 TYR HB3 H N N 302 TYR HD1 H N N 303 TYR HD2 H N N 304 TYR HE1 H N N 305 TYR HE2 H N N 306 TYR HH H N N 307 TYR HXT H N N 308 VAL N N N N 309 VAL CA C N S 310 VAL C C N N 311 VAL O O N N 312 VAL CB C N N 313 VAL CG1 C N N 314 VAL CG2 C N N 315 VAL OXT O N N 316 VAL H H N N 317 VAL H2 H N N 318 VAL HA H N N 319 VAL HB H N N 320 VAL HG11 H N N 321 VAL HG12 H N N 322 VAL HG13 H N N 323 VAL HG21 H N N 324 VAL HG22 H N N 325 VAL HG23 H N N 326 VAL HXT H N N 327 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LEU N CA sing N N 140 LEU N H sing N N 141 LEU N H2 sing N N 142 LEU CA C sing N N 143 LEU CA CB sing N N 144 LEU CA HA sing N N 145 LEU C O doub N N 146 LEU C OXT sing N N 147 LEU CB CG sing N N 148 LEU CB HB2 sing N N 149 LEU CB HB3 sing N N 150 LEU CG CD1 sing N N 151 LEU CG CD2 sing N N 152 LEU CG HG sing N N 153 LEU CD1 HD11 sing N N 154 LEU CD1 HD12 sing N N 155 LEU CD1 HD13 sing N N 156 LEU CD2 HD21 sing N N 157 LEU CD2 HD22 sing N N 158 LEU CD2 HD23 sing N N 159 LEU OXT HXT sing N N 160 LYS N CA sing N N 161 LYS N H sing N N 162 LYS N H2 sing N N 163 LYS CA C sing N N 164 LYS CA CB sing N N 165 LYS CA HA sing N N 166 LYS C O doub N N 167 LYS C OXT sing N N 168 LYS CB CG sing N N 169 LYS CB HB2 sing N N 170 LYS CB HB3 sing N N 171 LYS CG CD sing N N 172 LYS CG HG2 sing N N 173 LYS CG HG3 sing N N 174 LYS CD CE sing N N 175 LYS CD HD2 sing N N 176 LYS CD HD3 sing N N 177 LYS CE NZ sing N N 178 LYS CE HE2 sing N N 179 LYS CE HE3 sing N N 180 LYS NZ HZ1 sing N N 181 LYS NZ HZ2 sing N N 182 LYS NZ HZ3 sing N N 183 LYS OXT HXT sing N N 184 MET N CA sing N N 185 MET N H sing N N 186 MET N H2 sing N N 187 MET CA C sing N N 188 MET CA CB sing N N 189 MET CA HA sing N N 190 MET C O doub N N 191 MET C OXT sing N N 192 MET CB CG sing N N 193 MET CB HB2 sing N N 194 MET CB HB3 sing N N 195 MET CG SD sing N N 196 MET CG HG2 sing N N 197 MET CG HG3 sing N N 198 MET SD CE sing N N 199 MET CE HE1 sing N N 200 MET CE HE2 sing N N 201 MET CE HE3 sing N N 202 MET OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 SER N CA sing N N 244 SER N H sing N N 245 SER N H2 sing N N 246 SER CA C sing N N 247 SER CA CB sing N N 248 SER CA HA sing N N 249 SER C O doub N N 250 SER C OXT sing N N 251 SER CB OG sing N N 252 SER CB HB2 sing N N 253 SER CB HB3 sing N N 254 SER OG HG sing N N 255 SER OXT HXT sing N N 256 THR N CA sing N N 257 THR N H sing N N 258 THR N H2 sing N N 259 THR CA C sing N N 260 THR CA CB sing N N 261 THR CA HA sing N N 262 THR C O doub N N 263 THR C OXT sing N N 264 THR CB OG1 sing N N 265 THR CB CG2 sing N N 266 THR CB HB sing N N 267 THR OG1 HG1 sing N N 268 THR CG2 HG21 sing N N 269 THR CG2 HG22 sing N N 270 THR CG2 HG23 sing N N 271 THR OXT HXT sing N N 272 TYR N CA sing N N 273 TYR N H sing N N 274 TYR N H2 sing N N 275 TYR CA C sing N N 276 TYR CA CB sing N N 277 TYR CA HA sing N N 278 TYR C O doub N N 279 TYR C OXT sing N N 280 TYR CB CG sing N N 281 TYR CB HB2 sing N N 282 TYR CB HB3 sing N N 283 TYR CG CD1 doub Y N 284 TYR CG CD2 sing Y N 285 TYR CD1 CE1 sing Y N 286 TYR CD1 HD1 sing N N 287 TYR CD2 CE2 doub Y N 288 TYR CD2 HD2 sing N N 289 TYR CE1 CZ doub Y N 290 TYR CE1 HE1 sing N N 291 TYR CE2 CZ sing Y N 292 TYR CE2 HE2 sing N N 293 TYR CZ OH sing N N 294 TYR OH HH sing N N 295 TYR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # _pdbx_audit_support.funding_organization 'Department of Science & Technology (DST, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #