data_8J81 # _entry.id 8J81 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8J81 pdb_00008j81 10.2210/pdb8j81/pdb WWPDB D_1300037122 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8J81 _pdbx_database_status.recvd_initial_deposition_date 2023-04-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 jmorimoto@chembio.t.u-tokyo.ac.jp Jumpei Morimoto ? 'principal investigator/group leader' 0000-0002-8393-9616 4 ssando@chembio.t.u-tokyo.ac.jp Shinsuke Sando ? 'principal investigator/group leader' 0000-0003-0275-7237 5 yamamoto@riken.jp Masaki Yamamoto ? 'principal investigator/group leader' 0000-0002-1311-1768 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yokomine, M.' 1 0000-0003-4128-9077 'Fukuda, Y.' 2 0000-0001-8127-4385 'Ago, H.' 3 0000-0002-9040-488X 'Matsuura, H.' 4 0000-0002-8778-7955 'Ueno, G.' 5 0000-0003-0648-3632 'Nagatoishi, S.' 6 0000-0002-0794-3963 'Yamamoto, M.' 7 0000-0002-1311-1768 'Tsumoto, K.' 8 0000-0001-7643-5164 'Jumpei, M.' 9 0000-0002-8393-9616 'Sando, S.' 10 0000-0003-0275-7237 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A structural and physicochemical study of how a peptoid binds to a protein' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yokomine, M.' 1 0000-0003-4128-9077 primary 'Jumpei, M.' 2 0000-0002-8393-9616 primary 'Fukuda, Y.' 3 0000-0001-8127-4385 primary 'Ueda, T.' 4 0000-0001-9677-0912 primary 'Takeuchi, K.' 5 0000-0002-6227-4627 primary 'Suzuki, K.' 6 ? primary 'Maeda, S.' 7 ? primary 'Ago, H.' 8 0000-0002-9040-488X primary 'Matsuura, H.' 9 0000-0002-8778-7955 primary 'Ueno, G.' 10 0000-0003-0648-3632 primary 'Yamamoto, M.' 11 0000-0002-1311-1768 primary 'Senoo, A.' 12 ? primary 'Nagatoishi, S.' 13 0000-0002-0794-3963 primary 'Tsumoto, K.' 14 0000-0001-7643-5164 primary 'Sando, S.' 15 0000-0003-0275-7237 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase Mdm2' 11510.455 1 2.3.2.27 ? ? ? 2 non-polymer syn ;(2S)-2-[[(2S)-2-[(6-chloranyl-1H-indol-3-yl)methyl-[(2S)-2-[[(2S)-2-[ethanoyl-(phenylmethyl)amino]propanoyl]-methyl-amino]propanoyl]amino]propanoyl]-methyl-amino]-N-(3,3-dimethylbutyl)-N-[(2S)-1-oxidanylidene-1-piperazin-1-yl-propan-2-yl]propanamide ; 849.501 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 7 ? ? ? ? 4 water nat water 18.015 82 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Double minute 2 protein,Hdm2,Oncoprotein Mdm2,RING-type E3 ubiquitin transferase Mdm2,p53-binding protein Mdm2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVVVN ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVVVN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2S)-2-[[(2S)-2-[(6-chloranyl-1H-indol-3-yl)methyl-[(2S)-2-[[(2S)-2-[ethanoyl-(phenylmethyl)amino]propanoyl]-methyl-amino]propanoyl]amino]propanoyl]-methyl-amino]-N-(3,3-dimethylbutyl)-N-[(2S)-1-oxidanylidene-1-piperazin-1-yl-propan-2-yl]propanamide ; UAC 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLN n 1 8 ILE n 1 9 PRO n 1 10 ALA n 1 11 SER n 1 12 GLU n 1 13 GLN n 1 14 GLU n 1 15 THR n 1 16 LEU n 1 17 VAL n 1 18 ARG n 1 19 PRO n 1 20 LYS n 1 21 PRO n 1 22 LEU n 1 23 LEU n 1 24 LEU n 1 25 LYS n 1 26 LEU n 1 27 LEU n 1 28 LYS n 1 29 SER n 1 30 VAL n 1 31 GLY n 1 32 ALA n 1 33 GLN n 1 34 LYS n 1 35 ASP n 1 36 THR n 1 37 TYR n 1 38 THR n 1 39 MET n 1 40 LYS n 1 41 GLU n 1 42 VAL n 1 43 LEU n 1 44 PHE n 1 45 TYR n 1 46 LEU n 1 47 GLY n 1 48 GLN n 1 49 TYR n 1 50 ILE n 1 51 MET n 1 52 THR n 1 53 LYS n 1 54 ARG n 1 55 LEU n 1 56 TYR n 1 57 ASP n 1 58 GLU n 1 59 LYS n 1 60 GLN n 1 61 GLN n 1 62 HIS n 1 63 ILE n 1 64 VAL n 1 65 TYR n 1 66 CYS n 1 67 SER n 1 68 ASN n 1 69 ASP n 1 70 LEU n 1 71 LEU n 1 72 GLY n 1 73 ASP n 1 74 LEU n 1 75 PHE n 1 76 GLY n 1 77 VAL n 1 78 PRO n 1 79 SER n 1 80 PHE n 1 81 SER n 1 82 VAL n 1 83 LYS n 1 84 GLU n 1 85 HIS n 1 86 ARG n 1 87 LYS n 1 88 ILE n 1 89 TYR n 1 90 THR n 1 91 MET n 1 92 ILE n 1 93 TYR n 1 94 ARG n 1 95 ASN n 1 96 LEU n 1 97 VAL n 1 98 VAL n 1 99 VAL n 1 100 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 100 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MDM2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UAC non-polymer . ;(2S)-2-[[(2S)-2-[(6-chloranyl-1H-indol-3-yl)methyl-[(2S)-2-[[(2S)-2-[ethanoyl-(phenylmethyl)amino]propanoyl]-methyl-amino]propanoyl]amino]propanoyl]-methyl-amino]-N-(3,3-dimethylbutyl)-N-[(2S)-1-oxidanylidene-1-piperazin-1-yl-propan-2-yl]propanamide ; ? 'C45 H65 Cl N8 O6' 849.501 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 12 ? ? ? A . n A 1 2 PRO 2 13 ? ? ? A . n A 1 3 LEU 3 14 ? ? ? A . n A 1 4 GLY 4 15 ? ? ? A . n A 1 5 SER 5 16 ? ? ? A . n A 1 6 SER 6 17 ? ? ? A . n A 1 7 GLN 7 18 ? ? ? A . n A 1 8 ILE 8 19 ? ? ? A . n A 1 9 PRO 9 20 ? ? ? A . n A 1 10 ALA 10 21 ? ? ? A . n A 1 11 SER 11 22 ? ? ? A . n A 1 12 GLU 12 23 ? ? ? A . n A 1 13 GLN 13 24 ? ? ? A . n A 1 14 GLU 14 25 25 GLU GLU A . n A 1 15 THR 15 26 26 THR THR A . n A 1 16 LEU 16 27 27 LEU LEU A . n A 1 17 VAL 17 28 28 VAL VAL A . n A 1 18 ARG 18 29 29 ARG ARG A . n A 1 19 PRO 19 30 30 PRO PRO A . n A 1 20 LYS 20 31 31 LYS LYS A . n A 1 21 PRO 21 32 32 PRO PRO A . n A 1 22 LEU 22 33 33 LEU LEU A . n A 1 23 LEU 23 34 34 LEU LEU A . n A 1 24 LEU 24 35 35 LEU LEU A . n A 1 25 LYS 25 36 36 LYS LYS A . n A 1 26 LEU 26 37 37 LEU LEU A . n A 1 27 LEU 27 38 38 LEU LEU A . n A 1 28 LYS 28 39 39 LYS LYS A . n A 1 29 SER 29 40 40 SER SER A . n A 1 30 VAL 30 41 41 VAL VAL A . n A 1 31 GLY 31 42 42 GLY GLY A . n A 1 32 ALA 32 43 43 ALA ALA A . n A 1 33 GLN 33 44 44 GLN GLN A . n A 1 34 LYS 34 45 45 LYS LYS A . n A 1 35 ASP 35 46 46 ASP ASP A . n A 1 36 THR 36 47 47 THR THR A . n A 1 37 TYR 37 48 48 TYR TYR A . n A 1 38 THR 38 49 49 THR THR A . n A 1 39 MET 39 50 50 MET MET A . n A 1 40 LYS 40 51 51 LYS LYS A . n A 1 41 GLU 41 52 52 GLU GLU A . n A 1 42 VAL 42 53 53 VAL VAL A . n A 1 43 LEU 43 54 54 LEU LEU A . n A 1 44 PHE 44 55 55 PHE PHE A . n A 1 45 TYR 45 56 56 TYR TYR A . n A 1 46 LEU 46 57 57 LEU LEU A . n A 1 47 GLY 47 58 58 GLY GLY A . n A 1 48 GLN 48 59 59 GLN GLN A . n A 1 49 TYR 49 60 60 TYR TYR A . n A 1 50 ILE 50 61 61 ILE ILE A . n A 1 51 MET 51 62 62 MET MET A . n A 1 52 THR 52 63 63 THR THR A . n A 1 53 LYS 53 64 64 LYS LYS A . n A 1 54 ARG 54 65 65 ARG ARG A . n A 1 55 LEU 55 66 66 LEU LEU A . n A 1 56 TYR 56 67 67 TYR TYR A . n A 1 57 ASP 57 68 68 ASP ASP A . n A 1 58 GLU 58 69 69 GLU GLU A . n A 1 59 LYS 59 70 70 LYS LYS A . n A 1 60 GLN 60 71 71 GLN GLN A . n A 1 61 GLN 61 72 72 GLN GLN A . n A 1 62 HIS 62 73 73 HIS HIS A . n A 1 63 ILE 63 74 74 ILE ILE A . n A 1 64 VAL 64 75 75 VAL VAL A . n A 1 65 TYR 65 76 76 TYR TYR A . n A 1 66 CYS 66 77 77 CYS CYS A . n A 1 67 SER 67 78 78 SER SER A . n A 1 68 ASN 68 79 79 ASN ASN A . n A 1 69 ASP 69 80 80 ASP ASP A . n A 1 70 LEU 70 81 81 LEU LEU A . n A 1 71 LEU 71 82 82 LEU LEU A . n A 1 72 GLY 72 83 83 GLY GLY A . n A 1 73 ASP 73 84 84 ASP ASP A . n A 1 74 LEU 74 85 85 LEU LEU A . n A 1 75 PHE 75 86 86 PHE PHE A . n A 1 76 GLY 76 87 87 GLY GLY A . n A 1 77 VAL 77 88 88 VAL VAL A . n A 1 78 PRO 78 89 89 PRO PRO A . n A 1 79 SER 79 90 90 SER SER A . n A 1 80 PHE 80 91 91 PHE PHE A . n A 1 81 SER 81 92 92 SER SER A . n A 1 82 VAL 82 93 93 VAL VAL A . n A 1 83 LYS 83 94 94 LYS LYS A . n A 1 84 GLU 84 95 95 GLU GLU A . n A 1 85 HIS 85 96 96 HIS HIS A . n A 1 86 ARG 86 97 97 ARG ARG A . n A 1 87 LYS 87 98 98 LYS LYS A . n A 1 88 ILE 88 99 99 ILE ILE A . n A 1 89 TYR 89 100 100 TYR TYR A . n A 1 90 THR 90 101 101 THR THR A . n A 1 91 MET 91 102 102 MET MET A . n A 1 92 ILE 92 103 103 ILE ILE A . n A 1 93 TYR 93 104 104 TYR TYR A . n A 1 94 ARG 94 105 105 ARG ARG A . n A 1 95 ASN 95 106 106 ASN ASN A . n A 1 96 LEU 96 107 107 LEU LEU A . n A 1 97 VAL 97 108 108 VAL VAL A . n A 1 98 VAL 98 109 109 VAL VAL A . n A 1 99 VAL 99 110 110 VAL VAL A . n A 1 100 ASN 100 111 111 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UAC 1 201 201 UAC U99 A . C 3 CL 1 202 202 CL CL A . D 3 CL 1 203 204 CL CL A . E 3 CL 1 204 205 CL CL A . F 3 CL 1 205 206 CL CL A . G 3 CL 1 206 207 CL CL A . H 3 CL 1 207 208 CL CL A . I 3 CL 1 208 209 CL CL A . J 4 HOH 1 301 115 HOH HOH A . J 4 HOH 2 302 94 HOH HOH A . J 4 HOH 3 303 57 HOH HOH A . J 4 HOH 4 304 23 HOH HOH A . J 4 HOH 5 305 25 HOH HOH A . J 4 HOH 6 306 38 HOH HOH A . J 4 HOH 7 307 40 HOH HOH A . J 4 HOH 8 308 76 HOH HOH A . J 4 HOH 9 309 44 HOH HOH A . J 4 HOH 10 310 17 HOH HOH A . J 4 HOH 11 311 96 HOH HOH A . J 4 HOH 12 312 12 HOH HOH A . J 4 HOH 13 313 28 HOH HOH A . J 4 HOH 14 314 30 HOH HOH A . J 4 HOH 15 315 58 HOH HOH A . J 4 HOH 16 316 20 HOH HOH A . J 4 HOH 17 317 69 HOH HOH A . J 4 HOH 18 318 35 HOH HOH A . J 4 HOH 19 319 65 HOH HOH A . J 4 HOH 20 320 21 HOH HOH A . J 4 HOH 21 321 5 HOH HOH A . J 4 HOH 22 322 29 HOH HOH A . J 4 HOH 23 323 33 HOH HOH A . J 4 HOH 24 324 51 HOH HOH A . J 4 HOH 25 325 53 HOH HOH A . J 4 HOH 26 326 19 HOH HOH A . J 4 HOH 27 327 16 HOH HOH A . J 4 HOH 28 328 13 HOH HOH A . J 4 HOH 29 329 36 HOH HOH A . J 4 HOH 30 330 15 HOH HOH A . J 4 HOH 31 331 14 HOH HOH A . J 4 HOH 32 332 22 HOH HOH A . J 4 HOH 33 333 111 HOH HOH A . J 4 HOH 34 334 11 HOH HOH A . J 4 HOH 35 335 52 HOH HOH A . J 4 HOH 36 336 32 HOH HOH A . J 4 HOH 37 337 8 HOH HOH A . J 4 HOH 38 338 1 HOH HOH A . J 4 HOH 39 339 86 HOH HOH A . J 4 HOH 40 340 9 HOH HOH A . J 4 HOH 41 341 2 HOH HOH A . J 4 HOH 42 342 26 HOH HOH A . J 4 HOH 43 343 42 HOH HOH A . J 4 HOH 44 344 100 HOH HOH A . J 4 HOH 45 345 50 HOH HOH A . J 4 HOH 46 346 66 HOH HOH A . J 4 HOH 47 347 55 HOH HOH A . J 4 HOH 48 348 18 HOH HOH A . J 4 HOH 49 349 68 HOH HOH A . J 4 HOH 50 350 62 HOH HOH A . J 4 HOH 51 351 78 HOH HOH A . J 4 HOH 52 352 31 HOH HOH A . J 4 HOH 53 353 10 HOH HOH A . J 4 HOH 54 354 6 HOH HOH A . J 4 HOH 55 355 3 HOH HOH A . J 4 HOH 56 356 4 HOH HOH A . J 4 HOH 57 357 74 HOH HOH A . J 4 HOH 58 358 91 HOH HOH A . J 4 HOH 59 359 64 HOH HOH A . J 4 HOH 60 360 48 HOH HOH A . J 4 HOH 61 361 85 HOH HOH A . J 4 HOH 62 362 73 HOH HOH A . J 4 HOH 63 363 24 HOH HOH A . J 4 HOH 64 364 90 HOH HOH A . J 4 HOH 65 365 77 HOH HOH A . J 4 HOH 66 366 41 HOH HOH A . J 4 HOH 67 367 75 HOH HOH A . J 4 HOH 68 368 7 HOH HOH A . J 4 HOH 69 369 89 HOH HOH A . J 4 HOH 70 370 72 HOH HOH A . J 4 HOH 71 371 67 HOH HOH A . J 4 HOH 72 372 49 HOH HOH A . J 4 HOH 73 373 61 HOH HOH A . J 4 HOH 74 374 45 HOH HOH A . J 4 HOH 75 375 27 HOH HOH A . J 4 HOH 76 376 34 HOH HOH A . J 4 HOH 77 377 112 HOH HOH A . J 4 HOH 78 378 59 HOH HOH A . J 4 HOH 79 379 80 HOH HOH A . J 4 HOH 80 380 93 HOH HOH A . J 4 HOH 81 381 63 HOH HOH A . J 4 HOH 82 382 99 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 65 ? NE ? A ARG 54 NE 2 1 Y 1 A ARG 65 ? CZ ? A ARG 54 CZ 3 1 Y 1 A ARG 65 ? NH1 ? A ARG 54 NH1 4 1 Y 1 A ARG 65 ? NH2 ? A ARG 54 NH2 5 1 Y 1 A GLU 69 ? CG ? A GLU 58 CG 6 1 Y 1 A GLU 69 ? CD ? A GLU 58 CD 7 1 Y 1 A GLU 69 ? OE1 ? A GLU 58 OE1 8 1 Y 1 A GLU 69 ? OE2 ? A GLU 58 OE2 9 1 N 1 A UAC 201 ? N54 ? B UAC 1 N54 10 1 N 1 A UAC 201 ? C55 ? B UAC 1 C55 11 1 N 1 A UAC 201 ? C56 ? B UAC 1 C56 12 1 N 1 A UAC 201 ? N57 ? B UAC 1 N57 13 1 N 1 A UAC 201 ? C58 ? B UAC 1 C58 14 1 N 1 A UAC 201 ? C59 ? B UAC 1 C59 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8J81 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.521 _cell.length_a_esd ? _cell.length_b 45.815 _cell.length_b_esd ? _cell.length_c 63.790 _cell.length_c_esd ? _cell.volume 115501.658 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8J81 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8J81 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.97 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1M Sodium Acetate trihydrate pH4.5, 3.0 M Sodium Chrolide. Peptoid dissolved in DMSO was included. The final DMSO concentration was 2.4% ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-01-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 17.70 _reflns.entry_id 8J81 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.29 _reflns.d_resolution_low 37.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 54705 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.01 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.66 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.066 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.29 _reflns_shell.d_res_low 1.37 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 7938 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.86 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.504 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.1 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 19.95 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8J81 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.35 _refine.ls_d_res_low 37.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 49049 _refine.ls_number_reflns_R_free 3372 _refine.ls_number_reflns_R_work 45677 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.83 _refine.ls_percent_reflns_R_free 6.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1706 _refine.ls_R_factor_R_free 0.1896 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1692 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.2507 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1495 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.35 _refine_hist.d_res_low 37.21 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 856 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 713 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 61 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0054 ? 876 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8972 ? 1202 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0703 ? 133 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0072 ? 150 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 25.8861 ? 356 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.35 1.37 . . 137 1827 96.89 . . . . 0.3504 . . . . . . . . . . . 0.3642 'X-RAY DIFFRACTION' 1.37 1.39 . . 141 1893 99.51 . . . . 0.2955 . . . . . . . . . . . 0.2684 'X-RAY DIFFRACTION' 1.39 1.41 . . 139 1933 99.95 . . . . 0.2619 . . . . . . . . . . . 0.2779 'X-RAY DIFFRACTION' 1.41 1.43 . . 135 1892 100.00 . . . . 0.2272 . . . . . . . . . . . 0.2266 'X-RAY DIFFRACTION' 1.43 1.46 . . 142 1891 100.00 . . . . 0.1967 . . . . . . . . . . . 0.2303 'X-RAY DIFFRACTION' 1.46 1.49 . . 138 1923 100.00 . . . . 0.1917 . . . . . . . . . . . 0.1930 'X-RAY DIFFRACTION' 1.49 1.51 . . 147 1935 100.00 . . . . 0.1881 . . . . . . . . . . . 0.2207 'X-RAY DIFFRACTION' 1.51 1.55 . . 136 1866 99.95 . . . . 0.1933 . . . . . . . . . . . 0.2227 'X-RAY DIFFRACTION' 1.55 1.58 . . 144 1915 100.00 . . . . 0.1823 . . . . . . . . . . . 0.2032 'X-RAY DIFFRACTION' 1.58 1.62 . . 139 1884 100.00 . . . . 0.1815 . . . . . . . . . . . 0.2249 'X-RAY DIFFRACTION' 1.62 1.66 . . 142 1923 100.00 . . . . 0.1693 . . . . . . . . . . . 0.1549 'X-RAY DIFFRACTION' 1.66 1.70 . . 138 1912 100.00 . . . . 0.1676 . . . . . . . . . . . 0.1570 'X-RAY DIFFRACTION' 1.70 1.75 . . 139 1905 99.90 . . . . 0.1528 . . . . . . . . . . . 0.1875 'X-RAY DIFFRACTION' 1.75 1.81 . . 140 1905 99.85 . . . . 0.1630 . . . . . . . . . . . 0.1929 'X-RAY DIFFRACTION' 1.81 1.87 . . 143 1928 100.00 . . . . 0.1689 . . . . . . . . . . . 0.1818 'X-RAY DIFFRACTION' 1.87 1.95 . . 136 1889 100.00 . . . . 0.1673 . . . . . . . . . . . 0.1895 'X-RAY DIFFRACTION' 1.95 2.04 . . 140 1921 100.00 . . . . 0.1596 . . . . . . . . . . . 0.1562 'X-RAY DIFFRACTION' 2.04 2.14 . . 139 1909 100.00 . . . . 0.1599 . . . . . . . . . . . 0.1812 'X-RAY DIFFRACTION' 2.14 2.28 . . 142 1907 100.00 . . . . 0.1577 . . . . . . . . . . . 0.1821 'X-RAY DIFFRACTION' 2.28 2.45 . . 141 1907 100.00 . . . . 0.1689 . . . . . . . . . . . 0.2102 'X-RAY DIFFRACTION' 2.45 2.70 . . 144 1905 100.00 . . . . 0.1813 . . . . . . . . . . . 0.1735 'X-RAY DIFFRACTION' 2.70 3.09 . . 144 1894 100.00 . . . . 0.1738 . . . . . . . . . . . 0.1808 'X-RAY DIFFRACTION' 3.09 3.89 . . 144 1894 99.85 . . . . 0.1523 . . . . . . . . . . . 0.1818 'X-RAY DIFFRACTION' 3.89 37.21 . . 142 1919 99.90 . . . . 0.1553 . . . . . . . . . . . 0.1940 # _struct.entry_id 8J81 _struct.title 'MDM2 bound with a peptoid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8J81 _struct_keywords.text 'Inhibitor, Complex, Peptoid, p53-binding protein, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MDM2_HUMAN _struct_ref.pdbx_db_accession Q00987 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEH RKIYTMIYRNLVVVN ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8J81 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00987 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 17 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8J81 GLY A 1 ? UNP Q00987 ? ? 'expression tag' 12 1 1 8J81 PRO A 2 ? UNP Q00987 ? ? 'expression tag' 13 2 1 8J81 LEU A 3 ? UNP Q00987 ? ? 'expression tag' 14 3 1 8J81 GLY A 4 ? UNP Q00987 ? ? 'expression tag' 15 4 1 8J81 SER A 5 ? UNP Q00987 ? ? 'expression tag' 16 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 140 ? 1 MORE -11 ? 1 'SSA (A^2)' 5490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'isothermal titration calorimetry' ? 2 1 'surface plasmon resonance' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 20 ? VAL A 30 ? LYS A 31 VAL A 41 1 ? 11 HELX_P HELX_P2 AA2 MET A 39 ? LYS A 53 ? MET A 50 LYS A 64 1 ? 15 HELX_P HELX_P3 AA3 ASP A 69 ? GLY A 76 ? ASP A 80 GLY A 87 1 ? 8 HELX_P HELX_P4 AA4 GLU A 84 ? ARG A 94 ? GLU A 95 ARG A 105 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 37 ? THR A 38 ? TYR A 48 THR A 49 AA1 2 LEU A 16 ? PRO A 19 ? LEU A 27 PRO A 30 AA1 3 LEU A 96 ? VAL A 99 ? LEU A 107 VAL A 110 AA2 1 TYR A 56 ? ASP A 57 ? TYR A 67 ASP A 68 AA2 2 GLN A 60 ? TYR A 65 ? GLN A 71 TYR A 76 AA2 3 SER A 79 ? SER A 81 ? SER A 90 SER A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 37 ? O TYR A 48 N VAL A 17 ? N VAL A 28 AA1 2 3 N ARG A 18 ? N ARG A 29 O VAL A 97 ? O VAL A 108 AA2 1 2 N ASP A 57 ? N ASP A 68 O ILE A 63 ? O ILE A 74 AA2 2 3 N VAL A 64 ? N VAL A 75 O PHE A 80 ? O PHE A 91 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 71 ? ? -160.30 89.21 2 1 CYS A 77 ? ? -141.07 19.52 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_entry_details.entry_id 8J81 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 12 ? A GLY 1 2 1 Y 1 A PRO 13 ? A PRO 2 3 1 Y 1 A LEU 14 ? A LEU 3 4 1 Y 1 A GLY 15 ? A GLY 4 5 1 Y 1 A SER 16 ? A SER 5 6 1 Y 1 A SER 17 ? A SER 6 7 1 Y 1 A GLN 18 ? A GLN 7 8 1 Y 1 A ILE 19 ? A ILE 8 9 1 Y 1 A PRO 20 ? A PRO 9 10 1 Y 1 A ALA 21 ? A ALA 10 11 1 Y 1 A SER 22 ? A SER 11 12 1 Y 1 A GLU 23 ? A GLU 12 13 1 Y 1 A GLN 24 ? A GLN 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 UAC C10 C N N 346 UAC C11 C N S 347 UAC C13 C N N 348 UAC C14 C N S 349 UAC C16 C N N 350 UAC C17 C N N 351 UAC C19 C N N 352 UAC C20 C Y N 353 UAC C21 C Y N 354 UAC C22 C Y N 355 UAC C23 C Y N 356 UAC C1 C N N 357 UAC C2 C N S 358 UAC C4 C N N 359 UAC C5 C N S 360 UAC C7 C N N 361 UAC C8 C N S 362 UAC C24 C Y N 363 UAC C25 C Y N 364 UAC C26 C N N 365 UAC C28 C N N 366 UAC C29 C N N 367 UAC C31 C N N 368 UAC C32 C Y N 369 UAC C33 C Y N 370 UAC C35 C Y N 371 UAC C36 C Y N 372 UAC C37 C Y N 373 UAC C38 C Y N 374 UAC C39 C Y N 375 UAC C41 C Y N 376 UAC C42 C N N 377 UAC C44 C N N 378 UAC C45 C N N 379 UAC C47 C N N 380 UAC C48 C N N 381 UAC C49 C N N 382 UAC C50 C N N 383 UAC C51 C N N 384 UAC C52 C N N 385 UAC C53 C N N 386 UAC N3 N N N 387 UAC N6 N N N 388 UAC N9 N N N 389 UAC N12 N N N 390 UAC N15 N N N 391 UAC N34 N Y N 392 UAC O18 O N N 393 UAC O27 O N N 394 UAC O30 O N N 395 UAC O43 O N N 396 UAC O46 O N N 397 UAC O60 O N N 398 UAC CL4 CL N N 399 UAC H1 H N N 400 UAC H2 H N N 401 UAC H3 H N N 402 UAC H4 H N N 403 UAC H5 H N N 404 UAC H6 H N N 405 UAC H7 H N N 406 UAC H8 H N N 407 UAC H9 H N N 408 UAC H10 H N N 409 UAC H11 H N N 410 UAC H12 H N N 411 UAC H13 H N N 412 UAC H14 H N N 413 UAC H15 H N N 414 UAC H16 H N N 415 UAC H17 H N N 416 UAC H18 H N N 417 UAC H19 H N N 418 UAC H20 H N N 419 UAC H21 H N N 420 UAC H22 H N N 421 UAC H23 H N N 422 UAC H24 H N N 423 UAC H25 H N N 424 UAC H26 H N N 425 UAC H27 H N N 426 UAC H28 H N N 427 UAC H29 H N N 428 UAC H30 H N N 429 UAC H31 H N N 430 UAC H32 H N N 431 UAC H33 H N N 432 UAC H34 H N N 433 UAC H35 H N N 434 UAC H36 H N N 435 UAC H37 H N N 436 UAC H38 H N N 437 UAC H39 H N N 438 UAC H40 H N N 439 UAC H41 H N N 440 UAC H42 H N N 441 UAC H43 H N N 442 UAC H44 H N N 443 UAC H45 H N N 444 UAC H46 H N N 445 UAC H47 H N N 446 UAC H48 H N N 447 UAC H49 H N N 448 UAC H50 H N N 449 UAC H51 H N N 450 UAC H52 H N N 451 UAC H53 H N N 452 UAC H54 H N N 453 UAC H55 H N N 454 UAC H57 H N N 455 UAC N54 N N N 456 UAC C55 C N N 457 UAC C56 C N N 458 UAC N57 N N N 459 UAC C58 C N N 460 UAC C59 C N N 461 UAC H56 H N N 462 UAC H58 H N N 463 UAC H59 H N N 464 UAC H60 H N N 465 UAC H61 H N N 466 UAC H62 H N N 467 UAC H63 H N N 468 UAC H64 H N N 469 UAC H65 H N N 470 VAL N N N N 471 VAL CA C N S 472 VAL C C N N 473 VAL O O N N 474 VAL CB C N N 475 VAL CG1 C N N 476 VAL CG2 C N N 477 VAL OXT O N N 478 VAL H H N N 479 VAL H2 H N N 480 VAL HA H N N 481 VAL HB H N N 482 VAL HG11 H N N 483 VAL HG12 H N N 484 VAL HG13 H N N 485 VAL HG21 H N N 486 VAL HG22 H N N 487 VAL HG23 H N N 488 VAL HXT H N N 489 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 UAC C50 C49 sing N N 330 UAC CL4 C39 sing N N 331 UAC O60 C53 doub N N 332 UAC C49 C51 sing N N 333 UAC C49 C52 sing N N 334 UAC C49 C48 sing N N 335 UAC C47 C48 sing N N 336 UAC C47 N3 sing N N 337 UAC C1 C2 sing N N 338 UAC C41 C39 doub Y N 339 UAC C41 C35 sing Y N 340 UAC C53 C2 sing N N 341 UAC C39 C38 sing Y N 342 UAC C2 N3 sing N N 343 UAC N3 C4 sing N N 344 UAC C45 C5 sing N N 345 UAC C35 N34 sing Y N 346 UAC C35 C36 doub Y N 347 UAC N34 C33 sing Y N 348 UAC C38 C37 doub Y N 349 UAC C4 C5 sing N N 350 UAC C4 O46 doub N N 351 UAC C5 N6 sing N N 352 UAC C36 C37 sing Y N 353 UAC C36 C32 sing Y N 354 UAC C33 C32 doub Y N 355 UAC N6 C44 sing N N 356 UAC N6 C7 sing N N 357 UAC C32 C31 sing N N 358 UAC O43 C7 doub N N 359 UAC C7 C8 sing N N 360 UAC C31 N9 sing N N 361 UAC C23 C24 doub Y N 362 UAC C23 C22 sing Y N 363 UAC N9 C8 sing N N 364 UAC N9 C10 sing N N 365 UAC C29 C11 sing N N 366 UAC C8 C42 sing N N 367 UAC C24 C25 sing Y N 368 UAC C22 C21 doub Y N 369 UAC C11 C10 sing N N 370 UAC C11 N12 sing N N 371 UAC C10 O30 doub N N 372 UAC C25 C20 doub Y N 373 UAC C21 C20 sing Y N 374 UAC N12 C28 sing N N 375 UAC N12 C13 sing N N 376 UAC C20 C19 sing N N 377 UAC O27 C13 doub N N 378 UAC C13 C14 sing N N 379 UAC C19 N15 sing N N 380 UAC C14 N15 sing N N 381 UAC C14 C26 sing N N 382 UAC N15 C16 sing N N 383 UAC C16 C17 sing N N 384 UAC C16 O18 doub N N 385 UAC C11 H1 sing N N 386 UAC C14 H2 sing N N 387 UAC C17 H3 sing N N 388 UAC C17 H4 sing N N 389 UAC C17 H5 sing N N 390 UAC C19 H6 sing N N 391 UAC C19 H7 sing N N 392 UAC C21 H8 sing N N 393 UAC C22 H9 sing N N 394 UAC C23 H10 sing N N 395 UAC C1 H11 sing N N 396 UAC C1 H12 sing N N 397 UAC C1 H13 sing N N 398 UAC C2 H14 sing N N 399 UAC C5 H15 sing N N 400 UAC C8 H16 sing N N 401 UAC C24 H17 sing N N 402 UAC C25 H18 sing N N 403 UAC C26 H19 sing N N 404 UAC C26 H20 sing N N 405 UAC C26 H21 sing N N 406 UAC C28 H22 sing N N 407 UAC C28 H23 sing N N 408 UAC C28 H24 sing N N 409 UAC C29 H25 sing N N 410 UAC C29 H26 sing N N 411 UAC C29 H27 sing N N 412 UAC C31 H28 sing N N 413 UAC C31 H29 sing N N 414 UAC C33 H30 sing N N 415 UAC C37 H31 sing N N 416 UAC C38 H32 sing N N 417 UAC C41 H33 sing N N 418 UAC C42 H34 sing N N 419 UAC C42 H35 sing N N 420 UAC C42 H36 sing N N 421 UAC C44 H37 sing N N 422 UAC C44 H38 sing N N 423 UAC C44 H39 sing N N 424 UAC C45 H40 sing N N 425 UAC C45 H41 sing N N 426 UAC C45 H42 sing N N 427 UAC C47 H43 sing N N 428 UAC C47 H44 sing N N 429 UAC C48 H45 sing N N 430 UAC C48 H46 sing N N 431 UAC C50 H47 sing N N 432 UAC C50 H48 sing N N 433 UAC C50 H49 sing N N 434 UAC C51 H50 sing N N 435 UAC C51 H51 sing N N 436 UAC C51 H52 sing N N 437 UAC C52 H53 sing N N 438 UAC C52 H54 sing N N 439 UAC C52 H55 sing N N 440 UAC N34 H57 sing N N 441 UAC C53 N54 sing N N 442 UAC N54 C55 sing N N 443 UAC C55 C56 sing N N 444 UAC C56 N57 sing N N 445 UAC N57 C58 sing N N 446 UAC C58 C59 sing N N 447 UAC C59 N54 sing N N 448 UAC C55 H56 sing N N 449 UAC C55 H58 sing N N 450 UAC C56 H59 sing N N 451 UAC C56 H60 sing N N 452 UAC N57 H61 sing N N 453 UAC C58 H62 sing N N 454 UAC C58 H63 sing N N 455 UAC C59 H64 sing N N 456 UAC C59 H65 sing N N 457 VAL N CA sing N N 458 VAL N H sing N N 459 VAL N H2 sing N N 460 VAL CA C sing N N 461 VAL CA CB sing N N 462 VAL CA HA sing N N 463 VAL C O doub N N 464 VAL C OXT sing N N 465 VAL CB CG1 sing N N 466 VAL CB CG2 sing N N 467 VAL CB HB sing N N 468 VAL CG1 HG11 sing N N 469 VAL CG1 HG12 sing N N 470 VAL CG1 HG13 sing N N 471 VAL CG2 HG21 sing N N 472 VAL CG2 HG22 sing N N 473 VAL CG2 HG23 sing N N 474 VAL OXT HXT sing N N 475 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Agency for Medical Research and Development (AMED)' Japan JP21am0101070 1 'Japan Science and Technology' Japan JPMJCR21N5 2 'Japan Science and Technology' Japan JPMJPR21AF 3 'Japan Agency for Medical Research and Development (AMED)' Japan JP22ama121033 4 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id UAC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id UAC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5afg _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8J81 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025303 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021827 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015676 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_