data_8JLM # _entry.id 8JLM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JLM pdb_00008jlm 10.2210/pdb8jlm/pdb WWPDB D_1300038189 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-12-04 ? 2 'Structure model' 1 1 2025-12-17 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JLM _pdbx_database_status.recvd_initial_deposition_date 2023-06-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email scshin84@kist.re.kr _pdbx_contact_author.name_first Sangchul _pdbx_contact_author.name_last Shin _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0156-680X # _audit_author.name 'Shin, S.C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-0156-680X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'ACS Sens' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2379-3694 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 8395 _citation.page_last 8410 _citation.title ;Modulating Chromophore Flexibility in GEVIs through Threonine-Based Molecular Switches Reveals an Influence of Membrane Curvature on Protein Activity. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acssensors.5c01748 _citation.pdbx_database_id_PubMed 41123309 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Leong, L.M.' 1 0009-0005-2169-0084 primary 'Shin, S.C.' 2 ? primary 'Frankiv, N.' 3 ? primary 'Rhee, J.K.' 4 ? primary 'Kim, H.' 5 ? primary 'Seong, J.' 6 ? primary 'Woo, J.' 7 ? primary 'Han, K.' 8 ? primary 'Storace, D.A.' 9 ? primary 'Baker, B.J.' 10 0000-0003-4652-5585 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 26954.344 1 ? F64L,Q80R,S147D,N149Q,V163A,S175G,S202F,Q204E,A206T,F223D ? ? 2 water nat water 18.015 138 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(CRO)VQCFSRYPDHM KRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNDHQVYIMADKQK NGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLFTESTLSKDPNEKRDHMVLLEDVTAAGITHGMDELYK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNDHQVYIMADKQKNG IKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLFTESTLSKDPNEKRDHMVLLEDVTAAGITHGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LYS n 1 4 GLY n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 PHE n 1 9 THR n 1 10 GLY n 1 11 VAL n 1 12 VAL n 1 13 PRO n 1 14 ILE n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 VAL n 1 23 ASN n 1 24 GLY n 1 25 HIS n 1 26 LYS n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 SER n 1 31 GLY n 1 32 GLU n 1 33 GLY n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ALA n 1 38 THR n 1 39 TYR n 1 40 GLY n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 LEU n 1 45 LYS n 1 46 PHE n 1 47 ILE n 1 48 CYS n 1 49 THR n 1 50 THR n 1 51 GLY n 1 52 LYS n 1 53 LEU n 1 54 PRO n 1 55 VAL n 1 56 PRO n 1 57 TRP n 1 58 PRO n 1 59 THR n 1 60 LEU n 1 61 VAL n 1 62 THR n 1 63 THR n 1 64 LEU n 1 65 CRO n 1 66 VAL n 1 67 GLN n 1 68 CYS n 1 69 PHE n 1 70 SER n 1 71 ARG n 1 72 TYR n 1 73 PRO n 1 74 ASP n 1 75 HIS n 1 76 MET n 1 77 LYS n 1 78 ARG n 1 79 HIS n 1 80 ASP n 1 81 PHE n 1 82 PHE n 1 83 LYS n 1 84 SER n 1 85 ALA n 1 86 MET n 1 87 PRO n 1 88 GLU n 1 89 GLY n 1 90 TYR n 1 91 VAL n 1 92 GLN n 1 93 GLU n 1 94 ARG n 1 95 THR n 1 96 ILE n 1 97 PHE n 1 98 PHE n 1 99 LYS n 1 100 ASP n 1 101 ASP n 1 102 GLY n 1 103 ASN n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 ARG n 1 108 ALA n 1 109 GLU n 1 110 VAL n 1 111 LYS n 1 112 PHE n 1 113 GLU n 1 114 GLY n 1 115 ASP n 1 116 THR n 1 117 LEU n 1 118 VAL n 1 119 ASN n 1 120 ARG n 1 121 ILE n 1 122 GLU n 1 123 LEU n 1 124 LYS n 1 125 GLY n 1 126 ILE n 1 127 ASP n 1 128 PHE n 1 129 LYS n 1 130 GLU n 1 131 ASP n 1 132 GLY n 1 133 ASN n 1 134 ILE n 1 135 LEU n 1 136 GLY n 1 137 HIS n 1 138 LYS n 1 139 LEU n 1 140 GLU n 1 141 TYR n 1 142 ASN n 1 143 TYR n 1 144 ASN n 1 145 ASP n 1 146 HIS n 1 147 GLN n 1 148 VAL n 1 149 TYR n 1 150 ILE n 1 151 MET n 1 152 ALA n 1 153 ASP n 1 154 LYS n 1 155 GLN n 1 156 LYS n 1 157 ASN n 1 158 GLY n 1 159 ILE n 1 160 LYS n 1 161 ALA n 1 162 ASN n 1 163 PHE n 1 164 LYS n 1 165 ILE n 1 166 ARG n 1 167 HIS n 1 168 ASN n 1 169 ILE n 1 170 GLU n 1 171 ASP n 1 172 GLY n 1 173 GLY n 1 174 VAL n 1 175 GLN n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 HIS n 1 180 TYR n 1 181 GLN n 1 182 GLN n 1 183 ASN n 1 184 THR n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 ASP n 1 189 GLY n 1 190 PRO n 1 191 VAL n 1 192 LEU n 1 193 LEU n 1 194 PRO n 1 195 ASP n 1 196 ASN n 1 197 HIS n 1 198 TYR n 1 199 LEU n 1 200 PHE n 1 201 THR n 1 202 GLU n 1 203 SER n 1 204 THR n 1 205 LEU n 1 206 SER n 1 207 LYS n 1 208 ASP n 1 209 PRO n 1 210 ASN n 1 211 GLU n 1 212 LYS n 1 213 ARG n 1 214 ASP n 1 215 HIS n 1 216 MET n 1 217 VAL n 1 218 LEU n 1 219 LEU n 1 220 GLU n 1 221 ASP n 1 222 VAL n 1 223 THR n 1 224 ALA n 1 225 ALA n 1 226 GLY n 1 227 ILE n 1 228 THR n 1 229 HIS n 1 230 GLY n 1 231 MET n 1 232 ASP n 1 233 GLU n 1 234 LEU n 1 235 TYR n 1 236 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 236 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CRO 'L-peptide linking' n '{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5' 319.313 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 CRO 65 66 66 CRO CRO A . n A 1 66 VAL 66 68 68 VAL VAL A . n A 1 67 GLN 67 69 69 GLN GLN A . n A 1 68 CYS 68 70 70 CYS CYS A . n A 1 69 PHE 69 71 71 PHE PHE A . n A 1 70 SER 70 72 72 SER SER A . n A 1 71 ARG 71 73 73 ARG ARG A . n A 1 72 TYR 72 74 74 TYR TYR A . n A 1 73 PRO 73 75 75 PRO PRO A . n A 1 74 ASP 74 76 76 ASP ASP A . n A 1 75 HIS 75 77 77 HIS HIS A . n A 1 76 MET 76 78 78 MET MET A . n A 1 77 LYS 77 79 79 LYS LYS A . n A 1 78 ARG 78 80 80 ARG ARG A . n A 1 79 HIS 79 81 81 HIS HIS A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 PHE 81 83 83 PHE PHE A . n A 1 82 PHE 82 84 84 PHE PHE A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 SER 84 86 86 SER SER A . n A 1 85 ALA 85 87 87 ALA ALA A . n A 1 86 MET 86 88 88 MET MET A . n A 1 87 PRO 87 89 89 PRO PRO A . n A 1 88 GLU 88 90 90 GLU GLU A . n A 1 89 GLY 89 91 91 GLY GLY A . n A 1 90 TYR 90 92 92 TYR TYR A . n A 1 91 VAL 91 93 93 VAL VAL A . n A 1 92 GLN 92 94 94 GLN GLN A . n A 1 93 GLU 93 95 95 GLU GLU A . n A 1 94 ARG 94 96 96 ARG ARG A . n A 1 95 THR 95 97 97 THR THR A . n A 1 96 ILE 96 98 98 ILE ILE A . n A 1 97 PHE 97 99 99 PHE PHE A . n A 1 98 PHE 98 100 100 PHE PHE A . n A 1 99 LYS 99 101 101 LYS LYS A . n A 1 100 ASP 100 102 102 ASP ASP A . n A 1 101 ASP 101 103 103 ASP ASP A . n A 1 102 GLY 102 104 104 GLY GLY A . n A 1 103 ASN 103 105 105 ASN ASN A . n A 1 104 TYR 104 106 106 TYR TYR A . n A 1 105 LYS 105 107 107 LYS LYS A . n A 1 106 THR 106 108 108 THR THR A . n A 1 107 ARG 107 109 109 ARG ARG A . n A 1 108 ALA 108 110 110 ALA ALA A . n A 1 109 GLU 109 111 111 GLU GLU A . n A 1 110 VAL 110 112 112 VAL VAL A . n A 1 111 LYS 111 113 113 LYS LYS A . n A 1 112 PHE 112 114 114 PHE PHE A . n A 1 113 GLU 113 115 115 GLU GLU A . n A 1 114 GLY 114 116 116 GLY GLY A . n A 1 115 ASP 115 117 117 ASP ASP A . n A 1 116 THR 116 118 118 THR THR A . n A 1 117 LEU 117 119 119 LEU LEU A . n A 1 118 VAL 118 120 120 VAL VAL A . n A 1 119 ASN 119 121 121 ASN ASN A . n A 1 120 ARG 120 122 122 ARG ARG A . n A 1 121 ILE 121 123 123 ILE ILE A . n A 1 122 GLU 122 124 124 GLU GLU A . n A 1 123 LEU 123 125 125 LEU LEU A . n A 1 124 LYS 124 126 126 LYS LYS A . n A 1 125 GLY 125 127 127 GLY GLY A . n A 1 126 ILE 126 128 128 ILE ILE A . n A 1 127 ASP 127 129 129 ASP ASP A . n A 1 128 PHE 128 130 130 PHE PHE A . n A 1 129 LYS 129 131 131 LYS LYS A . n A 1 130 GLU 130 132 132 GLU GLU A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 ASN 133 135 135 ASN ASN A . n A 1 134 ILE 134 136 136 ILE ILE A . n A 1 135 LEU 135 137 137 LEU LEU A . n A 1 136 GLY 136 138 138 GLY GLY A . n A 1 137 HIS 137 139 139 HIS HIS A . n A 1 138 LYS 138 140 140 LYS LYS A . n A 1 139 LEU 139 141 141 LEU LEU A . n A 1 140 GLU 140 142 142 GLU GLU A . n A 1 141 TYR 141 143 143 TYR TYR A . n A 1 142 ASN 142 144 144 ASN ASN A . n A 1 143 TYR 143 145 145 TYR TYR A . n A 1 144 ASN 144 146 146 ASN ASN A . n A 1 145 ASP 145 147 147 ASP ASP A . n A 1 146 HIS 146 148 148 HIS HIS A . n A 1 147 GLN 147 149 149 GLN GLN A . n A 1 148 VAL 148 150 150 VAL VAL A . n A 1 149 TYR 149 151 151 TYR TYR A . n A 1 150 ILE 150 152 152 ILE ILE A . n A 1 151 MET 151 153 153 MET MET A . n A 1 152 ALA 152 154 154 ALA ALA A . n A 1 153 ASP 153 155 155 ASP ASP A . n A 1 154 LYS 154 156 156 LYS LYS A . n A 1 155 GLN 155 157 157 GLN GLN A . n A 1 156 LYS 156 158 158 LYS LYS A . n A 1 157 ASN 157 159 159 ASN ASN A . n A 1 158 GLY 158 160 160 GLY GLY A . n A 1 159 ILE 159 161 161 ILE ILE A . n A 1 160 LYS 160 162 162 LYS LYS A . n A 1 161 ALA 161 163 163 ALA ALA A . n A 1 162 ASN 162 164 164 ASN ASN A . n A 1 163 PHE 163 165 165 PHE PHE A . n A 1 164 LYS 164 166 166 LYS LYS A . n A 1 165 ILE 165 167 167 ILE ILE A . n A 1 166 ARG 166 168 168 ARG ARG A . n A 1 167 HIS 167 169 169 HIS HIS A . n A 1 168 ASN 168 170 170 ASN ASN A . n A 1 169 ILE 169 171 171 ILE ILE A . n A 1 170 GLU 170 172 172 GLU GLU A . n A 1 171 ASP 171 173 173 ASP ASP A . n A 1 172 GLY 172 174 174 GLY GLY A . n A 1 173 GLY 173 175 175 GLY GLY A . n A 1 174 VAL 174 176 176 VAL VAL A . n A 1 175 GLN 175 177 177 GLN GLN A . n A 1 176 LEU 176 178 178 LEU LEU A . n A 1 177 ALA 177 179 179 ALA ALA A . n A 1 178 ASP 178 180 180 ASP ASP A . n A 1 179 HIS 179 181 181 HIS HIS A . n A 1 180 TYR 180 182 182 TYR TYR A . n A 1 181 GLN 181 183 183 GLN GLN A . n A 1 182 GLN 182 184 184 GLN GLN A . n A 1 183 ASN 183 185 185 ASN ASN A . n A 1 184 THR 184 186 186 THR THR A . n A 1 185 PRO 185 187 187 PRO PRO A . n A 1 186 ILE 186 188 188 ILE ILE A . n A 1 187 GLY 187 189 189 GLY GLY A . n A 1 188 ASP 188 190 190 ASP ASP A . n A 1 189 GLY 189 191 191 GLY GLY A . n A 1 190 PRO 190 192 192 PRO PRO A . n A 1 191 VAL 191 193 193 VAL VAL A . n A 1 192 LEU 192 194 194 LEU LEU A . n A 1 193 LEU 193 195 195 LEU LEU A . n A 1 194 PRO 194 196 196 PRO PRO A . n A 1 195 ASP 195 197 197 ASP ASP A . n A 1 196 ASN 196 198 198 ASN ASN A . n A 1 197 HIS 197 199 199 HIS HIS A . n A 1 198 TYR 198 200 200 TYR TYR A . n A 1 199 LEU 199 201 201 LEU LEU A . n A 1 200 PHE 200 202 202 PHE PHE A . n A 1 201 THR 201 203 203 THR THR A . n A 1 202 GLU 202 204 204 GLU GLU A . n A 1 203 SER 203 205 205 SER SER A . n A 1 204 THR 204 206 206 THR THR A . n A 1 205 LEU 205 207 207 LEU LEU A . n A 1 206 SER 206 208 208 SER SER A . n A 1 207 LYS 207 209 209 LYS LYS A . n A 1 208 ASP 208 210 210 ASP ASP A . n A 1 209 PRO 209 211 211 PRO PRO A . n A 1 210 ASN 210 212 212 ASN ASN A . n A 1 211 GLU 211 213 213 GLU GLU A . n A 1 212 LYS 212 214 214 LYS LYS A . n A 1 213 ARG 213 215 215 ARG ARG A . n A 1 214 ASP 214 216 216 ASP ASP A . n A 1 215 HIS 215 217 217 HIS HIS A . n A 1 216 MET 216 218 218 MET MET A . n A 1 217 VAL 217 219 219 VAL VAL A . n A 1 218 LEU 218 220 220 LEU LEU A . n A 1 219 LEU 219 221 221 LEU LEU A . n A 1 220 GLU 220 222 222 GLU GLU A . n A 1 221 ASP 221 223 223 ASP ASP A . n A 1 222 VAL 222 224 224 VAL VAL A . n A 1 223 THR 223 225 225 THR THR A . n A 1 224 ALA 224 226 226 ALA ALA A . n A 1 225 ALA 225 227 227 ALA ALA A . n A 1 226 GLY 226 228 228 GLY GLY A . n A 1 227 ILE 227 229 229 ILE ILE A . n A 1 228 THR 228 230 ? ? ? A . n A 1 229 HIS 229 231 ? ? ? A . n A 1 230 GLY 230 232 ? ? ? A . n A 1 231 MET 231 233 ? ? ? A . n A 1 232 ASP 232 234 ? ? ? A . n A 1 233 GLU 233 235 ? ? ? A . n A 1 234 LEU 234 236 ? ? ? A . n A 1 235 TYR 235 237 ? ? ? A . n A 1 236 LYS 236 238 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CRO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CRO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 88 HOH HOH A . B 2 HOH 2 302 111 HOH HOH A . B 2 HOH 3 303 106 HOH HOH A . B 2 HOH 4 304 92 HOH HOH A . B 2 HOH 5 305 72 HOH HOH A . B 2 HOH 6 306 94 HOH HOH A . B 2 HOH 7 307 83 HOH HOH A . B 2 HOH 8 308 116 HOH HOH A . B 2 HOH 9 309 23 HOH HOH A . B 2 HOH 10 310 77 HOH HOH A . B 2 HOH 11 311 56 HOH HOH A . B 2 HOH 12 312 25 HOH HOH A . B 2 HOH 13 313 19 HOH HOH A . B 2 HOH 14 314 41 HOH HOH A . B 2 HOH 15 315 78 HOH HOH A . B 2 HOH 16 316 26 HOH HOH A . B 2 HOH 17 317 71 HOH HOH A . B 2 HOH 18 318 37 HOH HOH A . B 2 HOH 19 319 114 HOH HOH A . B 2 HOH 20 320 45 HOH HOH A . B 2 HOH 21 321 16 HOH HOH A . B 2 HOH 22 322 1 HOH HOH A . B 2 HOH 23 323 64 HOH HOH A . B 2 HOH 24 324 11 HOH HOH A . B 2 HOH 25 325 40 HOH HOH A . B 2 HOH 26 326 42 HOH HOH A . B 2 HOH 27 327 27 HOH HOH A . B 2 HOH 28 328 61 HOH HOH A . B 2 HOH 29 329 28 HOH HOH A . B 2 HOH 30 330 2 HOH HOH A . B 2 HOH 31 331 12 HOH HOH A . B 2 HOH 32 332 63 HOH HOH A . B 2 HOH 33 333 35 HOH HOH A . B 2 HOH 34 334 17 HOH HOH A . B 2 HOH 35 335 58 HOH HOH A . B 2 HOH 36 336 13 HOH HOH A . B 2 HOH 37 337 100 HOH HOH A . B 2 HOH 38 338 79 HOH HOH A . B 2 HOH 39 339 4 HOH HOH A . B 2 HOH 40 340 36 HOH HOH A . B 2 HOH 41 341 15 HOH HOH A . B 2 HOH 42 342 70 HOH HOH A . B 2 HOH 43 343 21 HOH HOH A . B 2 HOH 44 344 59 HOH HOH A . B 2 HOH 45 345 5 HOH HOH A . B 2 HOH 46 346 3 HOH HOH A . B 2 HOH 47 347 34 HOH HOH A . B 2 HOH 48 348 68 HOH HOH A . B 2 HOH 49 349 82 HOH HOH A . B 2 HOH 50 350 81 HOH HOH A . B 2 HOH 51 351 108 HOH HOH A . B 2 HOH 52 352 93 HOH HOH A . B 2 HOH 53 353 39 HOH HOH A . B 2 HOH 54 354 117 HOH HOH A . B 2 HOH 55 355 128 HOH HOH A . B 2 HOH 56 356 54 HOH HOH A . B 2 HOH 57 357 47 HOH HOH A . B 2 HOH 58 358 101 HOH HOH A . B 2 HOH 59 359 121 HOH HOH A . B 2 HOH 60 360 76 HOH HOH A . B 2 HOH 61 361 14 HOH HOH A . B 2 HOH 62 362 24 HOH HOH A . B 2 HOH 63 363 9 HOH HOH A . B 2 HOH 64 364 73 HOH HOH A . B 2 HOH 65 365 84 HOH HOH A . B 2 HOH 66 366 62 HOH HOH A . B 2 HOH 67 367 66 HOH HOH A . B 2 HOH 68 368 95 HOH HOH A . B 2 HOH 69 369 110 HOH HOH A . B 2 HOH 70 370 22 HOH HOH A . B 2 HOH 71 371 96 HOH HOH A . B 2 HOH 72 372 126 HOH HOH A . B 2 HOH 73 373 120 HOH HOH A . B 2 HOH 74 374 57 HOH HOH A . B 2 HOH 75 375 10 HOH HOH A . B 2 HOH 76 376 8 HOH HOH A . B 2 HOH 77 377 67 HOH HOH A . B 2 HOH 78 378 52 HOH HOH A . B 2 HOH 79 379 98 HOH HOH A . B 2 HOH 80 380 30 HOH HOH A . B 2 HOH 81 381 113 HOH HOH A . B 2 HOH 82 382 48 HOH HOH A . B 2 HOH 83 383 75 HOH HOH A . B 2 HOH 84 384 89 HOH HOH A . B 2 HOH 85 385 49 HOH HOH A . B 2 HOH 86 386 133 HOH HOH A . B 2 HOH 87 387 55 HOH HOH A . B 2 HOH 88 388 33 HOH HOH A . B 2 HOH 89 389 44 HOH HOH A . B 2 HOH 90 390 50 HOH HOH A . B 2 HOH 91 391 85 HOH HOH A . B 2 HOH 92 392 6 HOH HOH A . B 2 HOH 93 393 53 HOH HOH A . B 2 HOH 94 394 43 HOH HOH A . B 2 HOH 95 395 99 HOH HOH A . B 2 HOH 96 396 102 HOH HOH A . B 2 HOH 97 397 31 HOH HOH A . B 2 HOH 98 398 109 HOH HOH A . B 2 HOH 99 399 74 HOH HOH A . B 2 HOH 100 400 51 HOH HOH A . B 2 HOH 101 401 20 HOH HOH A . B 2 HOH 102 402 97 HOH HOH A . B 2 HOH 103 403 132 HOH HOH A . B 2 HOH 104 404 86 HOH HOH A . B 2 HOH 105 405 32 HOH HOH A . B 2 HOH 106 406 90 HOH HOH A . B 2 HOH 107 407 118 HOH HOH A . B 2 HOH 108 408 18 HOH HOH A . B 2 HOH 109 409 107 HOH HOH A . B 2 HOH 110 410 123 HOH HOH A . B 2 HOH 111 411 127 HOH HOH A . B 2 HOH 112 412 46 HOH HOH A . B 2 HOH 113 413 105 HOH HOH A . B 2 HOH 114 414 29 HOH HOH A . B 2 HOH 115 415 136 HOH HOH A . B 2 HOH 116 416 112 HOH HOH A . B 2 HOH 117 417 7 HOH HOH A . B 2 HOH 118 418 129 HOH HOH A . B 2 HOH 119 419 134 HOH HOH A . B 2 HOH 120 420 135 HOH HOH A . B 2 HOH 121 421 115 HOH HOH A . B 2 HOH 122 422 103 HOH HOH A . B 2 HOH 123 423 69 HOH HOH A . B 2 HOH 124 424 131 HOH HOH A . B 2 HOH 125 425 38 HOH HOH A . B 2 HOH 126 426 125 HOH HOH A . B 2 HOH 127 427 65 HOH HOH A . B 2 HOH 128 428 80 HOH HOH A . B 2 HOH 129 429 91 HOH HOH A . B 2 HOH 130 430 60 HOH HOH A . B 2 HOH 131 431 130 HOH HOH A . B 2 HOH 132 432 104 HOH HOH A . B 2 HOH 133 433 138 HOH HOH A . B 2 HOH 134 434 122 HOH HOH A . B 2 HOH 135 435 119 HOH HOH A . B 2 HOH 136 436 87 HOH HOH A . B 2 HOH 137 437 124 HOH HOH A . B 2 HOH 138 438 137 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id ILE _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 171 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id CD1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id ILE _pdbx_unobs_or_zero_occ_atoms.label_seq_id 169 _pdbx_unobs_or_zero_occ_atoms.label_atom_id CD1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8JLM _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.240 _cell.length_a_esd ? _cell.length_b 46.194 _cell.length_b_esd ? _cell.length_c 123.239 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JLM _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JLM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M acetate pH 4.5, 25% (w/v) PEG 1500, 30% (w/v) MPD' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-06-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8JLM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.85 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17624 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.290 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 129915 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.101 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.85 1.92 ? ? ? ? ? ? 1679 ? ? ? ? ? ? ? ? ? ? ? 4.0 0.703 ? ? 0.405 0.188 ? 1 1 0.451 0.788 ? 96.3 ? 0.356 ? ? ? ? ? ? ? ? ? 1.92 1.99 ? ? ? ? ? ? 1703 ? ? ? ? ? ? ? ? ? ? ? 4.8 0.802 ? ? 0.373 0.160 ? 2 1 0.641 0.884 ? 97.6 ? 0.334 ? ? ? ? ? ? ? ? ? 1.99 2.08 ? ? ? ? ? ? 1720 ? ? ? ? ? ? ? ? ? ? ? 5.5 0.958 ? ? 0.347 0.139 ? 3 1 0.805 0.944 ? 98.1 ? 0.315 ? ? ? ? ? ? ? ? ? 2.08 2.19 ? ? ? ? ? ? 1757 ? ? ? ? ? ? ? ? ? ? ? 6.0 1.073 ? ? 0.323 0.124 ? 4 1 0.855 0.960 ? 98.8 ? 0.296 ? ? ? ? ? ? ? ? ? 2.19 2.33 ? ? ? ? ? ? 1726 ? ? ? ? ? ? ? ? ? ? ? 6.7 1.169 ? ? 0.282 0.103 ? 5 1 0.912 0.977 ? 98.8 ? 0.262 ? ? ? ? ? ? ? ? ? 2.33 2.51 ? ? ? ? ? ? 1751 ? ? ? ? ? ? ? ? ? ? ? 7.2 1.288 ? ? 0.239 0.085 ? 6 1 0.951 0.987 ? 98.8 ? 0.222 ? ? ? ? ? ? ? ? ? 2.51 2.76 ? ? ? ? ? ? 1763 ? ? ? ? ? ? ? ? ? ? ? 8.0 1.359 ? ? 0.200 0.067 ? 7 1 0.973 0.993 ? 99.5 ? 0.188 ? ? ? ? ? ? ? ? ? 2.76 3.16 ? ? ? ? ? ? 1785 ? ? ? ? ? ? ? ? ? ? ? 9.1 1.454 ? ? 0.133 0.042 ? 8 1 0.992 0.998 ? 99.5 ? 0.126 ? ? ? ? ? ? ? ? ? 3.16 3.99 ? ? ? ? ? ? 1809 ? ? ? ? ? ? ? ? ? ? ? 10.6 1.525 ? ? 0.079 0.023 ? 9 1 0.998 0.999 ? 99.1 ? 0.075 ? ? ? ? ? ? ? ? ? 3.99 50.00 ? ? ? ? ? ? 1931 ? ? ? ? ? ? ? ? ? ? ? 11.1 1.527 ? ? 0.060 0.017 ? 10 1 0.999 1.000 ? 98.7 ? 0.057 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JLM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.85 _refine.ls_d_res_low 30.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17592 _refine.ls_number_reflns_R_free 1760 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.31 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1979 _refine.ls_R_factor_R_free 0.2406 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1930 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.48 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.77 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.23 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 30.81 _refine_hist.number_atoms_solvent 138 _refine_hist.number_atoms_total 1945 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1807 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1844 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.049 ? 2493 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.634 ? 242 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.065 ? 266 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 327 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.85 1.90 . . 121 1096 91.00 . . . . 0.2993 . . . . . . . . . . . 0.3584 'X-RAY DIFFRACTION' 1.90 1.96 . . 134 1196 97.00 . . . . 0.2789 . . . . . . . . . . . 0.3078 'X-RAY DIFFRACTION' 1.96 2.02 . . 130 1178 98.00 . . . . 0.2526 . . . . . . . . . . . 0.2823 'X-RAY DIFFRACTION' 2.02 2.09 . . 134 1204 98.00 . . . . 0.2271 . . . . . . . . . . . 0.2571 'X-RAY DIFFRACTION' 2.09 2.17 . . 133 1190 99.00 . . . . 0.2192 . . . . . . . . . . . 0.2743 'X-RAY DIFFRACTION' 2.17 2.27 . . 134 1203 99.00 . . . . 0.2039 . . . . . . . . . . . 0.2755 'X-RAY DIFFRACTION' 2.27 2.39 . . 136 1223 99.00 . . . . 0.2022 . . . . . . . . . . . 0.2736 'X-RAY DIFFRACTION' 2.39 2.54 . . 134 1221 99.00 . . . . 0.1828 . . . . . . . . . . . 0.2222 'X-RAY DIFFRACTION' 2.54 2.74 . . 138 1230 99.00 . . . . 0.1866 . . . . . . . . . . . 0.2376 'X-RAY DIFFRACTION' 2.74 3.01 . . 136 1230 99.00 . . . . 0.1833 . . . . . . . . . . . 0.2454 'X-RAY DIFFRACTION' 3.02 3.45 . . 138 1242 99.00 . . . . 0.1667 . . . . . . . . . . . 0.2280 'X-RAY DIFFRACTION' 3.45 4.34 . . 141 1264 99.00 . . . . 0.1548 . . . . . . . . . . . 0.1747 'X-RAY DIFFRACTION' 4.35 30.81 . . 151 1355 100.00 . . . . 0.1809 . . . . . . . . . . . 0.2364 # _struct.entry_id 8JLM _struct.title 'Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 4.5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JLM _struct_keywords.text 'bioimaging, Sensor. GFP, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JLM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 236 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8JLM LEU A 64 ? UNP P42212 PHE 64 'engineered mutation' 64 1 1 8JLM CRO A 65 ? UNP P42212 SER 65 chromophore 66 2 1 8JLM CRO A 65 ? UNP P42212 TYR 66 chromophore 66 3 1 8JLM CRO A 65 ? UNP P42212 GLY 67 chromophore 66 4 1 8JLM ARG A 78 ? UNP P42212 GLN 80 'engineered mutation' 80 5 1 8JLM ASP A 145 ? UNP P42212 SER 147 'engineered mutation' 147 6 1 8JLM GLN A 147 ? UNP P42212 ASN 149 'engineered mutation' 149 7 1 8JLM ALA A 161 ? UNP P42212 VAL 163 'engineered mutation' 163 8 1 8JLM GLY A 173 ? UNP P42212 SER 175 'engineered mutation' 175 9 1 8JLM PHE A 200 ? UNP P42212 SER 202 'engineered mutation' 202 10 1 8JLM GLU A 202 ? UNP P42212 GLN 204 'engineered mutation' 204 11 1 8JLM THR A 204 ? UNP P42212 ALA 206 'engineered mutation' 206 12 1 8JLM ASP A 221 ? UNP P42212 PHE 223 'engineered mutation' 223 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 4 ? THR A 9 ? GLY A 4 THR A 9 5 ? 6 HELX_P HELX_P2 AA2 PRO A 56 ? VAL A 61 ? PRO A 56 VAL A 61 5 ? 6 HELX_P HELX_P3 AA3 VAL A 66 ? SER A 70 ? VAL A 68 SER A 72 5 ? 5 HELX_P HELX_P4 AA4 PRO A 73 ? HIS A 79 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P5 AA5 ASP A 80 ? ALA A 85 ? ASP A 82 ALA A 87 1 ? 6 HELX_P HELX_P6 AA6 LYS A 154 ? ASN A 157 ? LYS A 156 ASN A 159 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 64 C ? ? ? 1_555 A CRO 65 N1 ? ? A LEU 64 A CRO 66 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale2 covale both ? A CRO 65 C3 ? ? ? 1_555 A VAL 66 N ? ? A CRO 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.228 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CRO _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 65 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CRO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 66 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id 'THR, TYR, GLY' _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CRO _pdbx_modification_feature.type None _pdbx_modification_feature.category Chromophore/chromophore-like # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.27 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 11 ? VAL A 22 ? VAL A 11 VAL A 22 AA1 2 HIS A 25 ? ASP A 36 ? HIS A 25 ASP A 36 AA1 3 LYS A 41 ? CYS A 48 ? LYS A 41 CYS A 48 AA1 4 HIS A 215 ? ALA A 225 ? HIS A 217 ALA A 227 AA1 5 HIS A 197 ? SER A 206 ? HIS A 199 SER A 208 AA1 6 VAL A 148 ? ASP A 153 ? VAL A 150 ASP A 155 AA1 7 GLY A 158 ? ASN A 168 ? GLY A 160 ASN A 170 AA1 8 VAL A 174 ? PRO A 185 ? VAL A 176 PRO A 187 AA1 9 TYR A 90 ? PHE A 98 ? TYR A 92 PHE A 100 AA1 10 ASN A 103 ? GLU A 113 ? ASN A 105 GLU A 115 AA1 11 THR A 116 ? ILE A 126 ? THR A 118 ILE A 128 AA1 12 VAL A 11 ? VAL A 22 ? VAL A 11 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 20 ? N GLY A 20 O PHE A 27 ? O PHE A 27 AA1 2 3 N SER A 30 ? N SER A 30 O ILE A 47 ? O ILE A 47 AA1 3 4 N LEU A 44 ? N LEU A 44 O LEU A 218 ? O LEU A 220 AA1 4 5 O THR A 223 ? O THR A 225 N PHE A 200 ? N PHE A 202 AA1 5 6 O HIS A 197 ? O HIS A 199 N ILE A 150 ? N ILE A 152 AA1 6 7 N MET A 151 ? N MET A 153 O LYS A 160 ? O LYS A 162 AA1 7 8 N HIS A 167 ? N HIS A 169 O GLN A 175 ? O GLN A 177 AA1 8 9 O THR A 184 ? O THR A 186 N VAL A 91 ? N VAL A 93 AA1 9 10 N ILE A 96 ? N ILE A 98 O TYR A 104 ? O TYR A 106 AA1 10 11 N LYS A 111 ? N LYS A 113 O VAL A 118 ? O VAL A 120 AA1 11 12 O GLY A 125 ? O GLY A 127 N ASP A 21 ? N ASP A 21 # _pdbx_entry_details.entry_id 8JLM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 77 ? ? -67.93 2.40 2 1 ASP A 103 ? ? -152.83 -159.22 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CRO 65 A CRO 66 ? SER chromophore 2 A CRO 65 A CRO 66 ? TYR chromophore 3 A CRO 65 A CRO 66 ? GLY chromophore # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A THR 230 ? A THR 228 4 1 Y 1 A HIS 231 ? A HIS 229 5 1 Y 1 A GLY 232 ? A GLY 230 6 1 Y 1 A MET 233 ? A MET 231 7 1 Y 1 A ASP 234 ? A ASP 232 8 1 Y 1 A GLU 235 ? A GLU 233 9 1 Y 1 A LEU 236 ? A LEU 234 10 1 Y 1 A TYR 237 ? A TYR 235 11 1 Y 1 A LYS 238 ? A LYS 236 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CRO N1 N N N 74 CRO CA1 C N R 75 CRO CB1 C N R 76 CRO CG1 C N N 77 CRO OG1 O N N 78 CRO C1 C N N 79 CRO N2 N N N 80 CRO N3 N N N 81 CRO C2 C N N 82 CRO O2 O N N 83 CRO CA2 C N N 84 CRO CA3 C N N 85 CRO C3 C N N 86 CRO O3 O N N 87 CRO CB2 C N N 88 CRO CG2 C Y N 89 CRO CD1 C Y N 90 CRO CD2 C Y N 91 CRO CE1 C Y N 92 CRO CE2 C Y N 93 CRO CZ C Y N 94 CRO OH O N N 95 CRO OXT O N N 96 CRO H H N N 97 CRO H2 H N N 98 CRO HA1 H N N 99 CRO HB1 H N N 100 CRO HG11 H N N 101 CRO HG12 H N N 102 CRO HG13 H N N 103 CRO HOG1 H N N 104 CRO HA31 H N N 105 CRO HA32 H N N 106 CRO HXT H N N 107 CRO HB2 H N N 108 CRO HD1 H N N 109 CRO HD2 H N N 110 CRO HE1 H N N 111 CRO HE2 H N N 112 CRO HOH H N N 113 CYS N N N N 114 CYS CA C N R 115 CYS C C N N 116 CYS O O N N 117 CYS CB C N N 118 CYS SG S N N 119 CYS OXT O N N 120 CYS H H N N 121 CYS H2 H N N 122 CYS HA H N N 123 CYS HB2 H N N 124 CYS HB3 H N N 125 CYS HG H N N 126 CYS HXT H N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 HOH O O N N 198 HOH H1 H N N 199 HOH H2 H N N 200 ILE N N N N 201 ILE CA C N S 202 ILE C C N N 203 ILE O O N N 204 ILE CB C N S 205 ILE CG1 C N N 206 ILE CG2 C N N 207 ILE CD1 C N N 208 ILE OXT O N N 209 ILE H H N N 210 ILE H2 H N N 211 ILE HA H N N 212 ILE HB H N N 213 ILE HG12 H N N 214 ILE HG13 H N N 215 ILE HG21 H N N 216 ILE HG22 H N N 217 ILE HG23 H N N 218 ILE HD11 H N N 219 ILE HD12 H N N 220 ILE HD13 H N N 221 ILE HXT H N N 222 LEU N N N N 223 LEU CA C N S 224 LEU C C N N 225 LEU O O N N 226 LEU CB C N N 227 LEU CG C N N 228 LEU CD1 C N N 229 LEU CD2 C N N 230 LEU OXT O N N 231 LEU H H N N 232 LEU H2 H N N 233 LEU HA H N N 234 LEU HB2 H N N 235 LEU HB3 H N N 236 LEU HG H N N 237 LEU HD11 H N N 238 LEU HD12 H N N 239 LEU HD13 H N N 240 LEU HD21 H N N 241 LEU HD22 H N N 242 LEU HD23 H N N 243 LEU HXT H N N 244 LYS N N N N 245 LYS CA C N S 246 LYS C C N N 247 LYS O O N N 248 LYS CB C N N 249 LYS CG C N N 250 LYS CD C N N 251 LYS CE C N N 252 LYS NZ N N N 253 LYS OXT O N N 254 LYS H H N N 255 LYS H2 H N N 256 LYS HA H N N 257 LYS HB2 H N N 258 LYS HB3 H N N 259 LYS HG2 H N N 260 LYS HG3 H N N 261 LYS HD2 H N N 262 LYS HD3 H N N 263 LYS HE2 H N N 264 LYS HE3 H N N 265 LYS HZ1 H N N 266 LYS HZ2 H N N 267 LYS HZ3 H N N 268 LYS HXT H N N 269 MET N N N N 270 MET CA C N S 271 MET C C N N 272 MET O O N N 273 MET CB C N N 274 MET CG C N N 275 MET SD S N N 276 MET CE C N N 277 MET OXT O N N 278 MET H H N N 279 MET H2 H N N 280 MET HA H N N 281 MET HB2 H N N 282 MET HB3 H N N 283 MET HG2 H N N 284 MET HG3 H N N 285 MET HE1 H N N 286 MET HE2 H N N 287 MET HE3 H N N 288 MET HXT H N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SER N N N N 330 SER CA C N S 331 SER C C N N 332 SER O O N N 333 SER CB C N N 334 SER OG O N N 335 SER OXT O N N 336 SER H H N N 337 SER H2 H N N 338 SER HA H N N 339 SER HB2 H N N 340 SER HB3 H N N 341 SER HG H N N 342 SER HXT H N N 343 THR N N N N 344 THR CA C N S 345 THR C C N N 346 THR O O N N 347 THR CB C N R 348 THR OG1 O N N 349 THR CG2 C N N 350 THR OXT O N N 351 THR H H N N 352 THR H2 H N N 353 THR HA H N N 354 THR HB H N N 355 THR HG1 H N N 356 THR HG21 H N N 357 THR HG22 H N N 358 THR HG23 H N N 359 THR HXT H N N 360 TRP N N N N 361 TRP CA C N S 362 TRP C C N N 363 TRP O O N N 364 TRP CB C N N 365 TRP CG C Y N 366 TRP CD1 C Y N 367 TRP CD2 C Y N 368 TRP NE1 N Y N 369 TRP CE2 C Y N 370 TRP CE3 C Y N 371 TRP CZ2 C Y N 372 TRP CZ3 C Y N 373 TRP CH2 C Y N 374 TRP OXT O N N 375 TRP H H N N 376 TRP H2 H N N 377 TRP HA H N N 378 TRP HB2 H N N 379 TRP HB3 H N N 380 TRP HD1 H N N 381 TRP HE1 H N N 382 TRP HE3 H N N 383 TRP HZ2 H N N 384 TRP HZ3 H N N 385 TRP HH2 H N N 386 TRP HXT H N N 387 TYR N N N N 388 TYR CA C N S 389 TYR C C N N 390 TYR O O N N 391 TYR CB C N N 392 TYR CG C Y N 393 TYR CD1 C Y N 394 TYR CD2 C Y N 395 TYR CE1 C Y N 396 TYR CE2 C Y N 397 TYR CZ C Y N 398 TYR OH O N N 399 TYR OXT O N N 400 TYR H H N N 401 TYR H2 H N N 402 TYR HA H N N 403 TYR HB2 H N N 404 TYR HB3 H N N 405 TYR HD1 H N N 406 TYR HD2 H N N 407 TYR HE1 H N N 408 TYR HE2 H N N 409 TYR HH H N N 410 TYR HXT H N N 411 VAL N N N N 412 VAL CA C N S 413 VAL C C N N 414 VAL O O N N 415 VAL CB C N N 416 VAL CG1 C N N 417 VAL CG2 C N N 418 VAL OXT O N N 419 VAL H H N N 420 VAL H2 H N N 421 VAL HA H N N 422 VAL HB H N N 423 VAL HG11 H N N 424 VAL HG12 H N N 425 VAL HG13 H N N 426 VAL HG21 H N N 427 VAL HG22 H N N 428 VAL HG23 H N N 429 VAL HXT H N N 430 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CRO CG1 CB1 sing N N 70 CRO OG1 CB1 sing N N 71 CRO CB1 CA1 sing N N 72 CRO N1 CA1 sing N N 73 CRO OH CZ sing N N 74 CRO CE1 CZ doub Y N 75 CRO CE1 CD1 sing Y N 76 CRO CA1 C1 sing N N 77 CRO CZ CE2 sing Y N 78 CRO CD1 CG2 doub Y N 79 CRO N2 C1 doub N N 80 CRO N2 CA2 sing N N 81 CRO C1 N3 sing N N 82 CRO CE2 CD2 doub Y N 83 CRO CG2 CD2 sing Y N 84 CRO CG2 CB2 sing N N 85 CRO N3 CA3 sing N N 86 CRO N3 C2 sing N N 87 CRO CA2 CB2 doub N Z 88 CRO CA2 C2 sing N N 89 CRO CA3 C3 sing N N 90 CRO OXT C3 sing N N 91 CRO C3 O3 doub N N 92 CRO C2 O2 doub N N 93 CRO N1 H sing N N 94 CRO N1 H2 sing N N 95 CRO CA1 HA1 sing N N 96 CRO CB1 HB1 sing N N 97 CRO CG1 HG11 sing N N 98 CRO CG1 HG12 sing N N 99 CRO CG1 HG13 sing N N 100 CRO OG1 HOG1 sing N N 101 CRO CA3 HA31 sing N N 102 CRO CA3 HA32 sing N N 103 CRO OXT HXT sing N N 104 CRO CB2 HB2 sing N N 105 CRO CD1 HD1 sing N N 106 CRO CD2 HD2 sing N N 107 CRO CE1 HE1 sing N N 108 CRO CE2 HE2 sing N N 109 CRO OH HOH sing N N 110 CYS N CA sing N N 111 CYS N H sing N N 112 CYS N H2 sing N N 113 CYS CA C sing N N 114 CYS CA CB sing N N 115 CYS CA HA sing N N 116 CYS C O doub N N 117 CYS C OXT sing N N 118 CYS CB SG sing N N 119 CYS CB HB2 sing N N 120 CYS CB HB3 sing N N 121 CYS SG HG sing N N 122 CYS OXT HXT sing N N 123 GLN N CA sing N N 124 GLN N H sing N N 125 GLN N H2 sing N N 126 GLN CA C sing N N 127 GLN CA CB sing N N 128 GLN CA HA sing N N 129 GLN C O doub N N 130 GLN C OXT sing N N 131 GLN CB CG sing N N 132 GLN CB HB2 sing N N 133 GLN CB HB3 sing N N 134 GLN CG CD sing N N 135 GLN CG HG2 sing N N 136 GLN CG HG3 sing N N 137 GLN CD OE1 doub N N 138 GLN CD NE2 sing N N 139 GLN NE2 HE21 sing N N 140 GLN NE2 HE22 sing N N 141 GLN OXT HXT sing N N 142 GLU N CA sing N N 143 GLU N H sing N N 144 GLU N H2 sing N N 145 GLU CA C sing N N 146 GLU CA CB sing N N 147 GLU CA HA sing N N 148 GLU C O doub N N 149 GLU C OXT sing N N 150 GLU CB CG sing N N 151 GLU CB HB2 sing N N 152 GLU CB HB3 sing N N 153 GLU CG CD sing N N 154 GLU CG HG2 sing N N 155 GLU CG HG3 sing N N 156 GLU CD OE1 doub N N 157 GLU CD OE2 sing N N 158 GLU OE2 HE2 sing N N 159 GLU OXT HXT sing N N 160 GLY N CA sing N N 161 GLY N H sing N N 162 GLY N H2 sing N N 163 GLY CA C sing N N 164 GLY CA HA2 sing N N 165 GLY CA HA3 sing N N 166 GLY C O doub N N 167 GLY C OXT sing N N 168 GLY OXT HXT sing N N 169 HIS N CA sing N N 170 HIS N H sing N N 171 HIS N H2 sing N N 172 HIS CA C sing N N 173 HIS CA CB sing N N 174 HIS CA HA sing N N 175 HIS C O doub N N 176 HIS C OXT sing N N 177 HIS CB CG sing N N 178 HIS CB HB2 sing N N 179 HIS CB HB3 sing N N 180 HIS CG ND1 sing Y N 181 HIS CG CD2 doub Y N 182 HIS ND1 CE1 doub Y N 183 HIS ND1 HD1 sing N N 184 HIS CD2 NE2 sing Y N 185 HIS CD2 HD2 sing N N 186 HIS CE1 NE2 sing Y N 187 HIS CE1 HE1 sing N N 188 HIS NE2 HE2 sing N N 189 HIS OXT HXT sing N N 190 HOH O H1 sing N N 191 HOH O H2 sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5WWK _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8JLM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.028377 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021648 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008114 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #