data_8JMX # _entry.id 8JMX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JMX pdb_00008jmx 10.2210/pdb8jmx/pdb WWPDB D_1300037755 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JMX _pdbx_database_status.recvd_initial_deposition_date 2023-06-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhu, C.J.' 1 ? 'Zhang, Z.M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem.Commun.(Camb.)' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1364-548X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 59 _citation.language ? _citation.page_first 10789 _citation.page_last 10792 _citation.title 'Multitarget inhibitors/probes that target LRRK2 and AURORA A kinases noncovalently and covalently.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d3cc03530a _citation.pdbx_database_id_PubMed 37594149 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Wang, X.' 2 ? primary 'Tang, G.' 3 ? primary 'Zhu, C.' 4 ? primary 'Xiang, M.' 5 ? primary 'Xiao, Q.' 6 ? primary 'Zhang, Z.M.' 7 ? primary 'Gao, L.' 8 ? primary 'Yao, S.Q.' 9 0000-0003-4715-769X # _cell.angle_alpha 90.0 _cell.angle_alpha_esd ? _cell.angle_beta 90.0 _cell.angle_beta_esd ? _cell.angle_gamma 120.0 _cell.angle_gamma_esd ? _cell.entry_id 8JMX _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.133 _cell.length_a_esd ? _cell.length_b 83.133 _cell.length_b_esd ? _cell.length_c 171.452 _cell.length_c_esd ? _cell.volume 1026171.84169 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JMX _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aurora kinase A' 30566.131 1 2.7.11.1 ? ? ? 2 non-polymer syn '5-(4-morpholin-4-yl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-2-oxidanyl-benzaldehyde' 324.334 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Aurora 2,Aurora/IPL1-related kinase 1,ARK-1,Aurora-related kinase 1,Breast tumor-amplified kinase,Ipl1- and aurora-related kinase 1,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase Ayk1,Serine/threonine-protein kinase aurora-A ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSK ; _entity_poly.pdbx_seq_one_letter_code_can ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 TRP n 1 3 ALA n 1 4 LEU n 1 5 GLU n 1 6 ASP n 1 7 PHE n 1 8 GLU n 1 9 ILE n 1 10 GLY n 1 11 ARG n 1 12 PRO n 1 13 LEU n 1 14 GLY n 1 15 LYS n 1 16 GLY n 1 17 LYS n 1 18 PHE n 1 19 GLY n 1 20 ASN n 1 21 VAL n 1 22 TYR n 1 23 LEU n 1 24 ALA n 1 25 ARG n 1 26 GLU n 1 27 LYS n 1 28 GLN n 1 29 SER n 1 30 LYS n 1 31 PHE n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 VAL n 1 38 LEU n 1 39 PHE n 1 40 LYS n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 GLU n 1 45 LYS n 1 46 ALA n 1 47 GLY n 1 48 VAL n 1 49 GLU n 1 50 HIS n 1 51 GLN n 1 52 LEU n 1 53 ARG n 1 54 ARG n 1 55 GLU n 1 56 VAL n 1 57 GLU n 1 58 ILE n 1 59 GLN n 1 60 SER n 1 61 HIS n 1 62 LEU n 1 63 ARG n 1 64 HIS n 1 65 PRO n 1 66 ASN n 1 67 ILE n 1 68 LEU n 1 69 ARG n 1 70 LEU n 1 71 TYR n 1 72 GLY n 1 73 TYR n 1 74 PHE n 1 75 HIS n 1 76 ASP n 1 77 ALA n 1 78 THR n 1 79 ARG n 1 80 VAL n 1 81 TYR n 1 82 LEU n 1 83 ILE n 1 84 LEU n 1 85 GLU n 1 86 TYR n 1 87 ALA n 1 88 PRO n 1 89 LEU n 1 90 GLY n 1 91 THR n 1 92 VAL n 1 93 TYR n 1 94 ARG n 1 95 GLU n 1 96 LEU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 SER n 1 101 LYS n 1 102 PHE n 1 103 ASP n 1 104 GLU n 1 105 GLN n 1 106 ARG n 1 107 THR n 1 108 ALA n 1 109 THR n 1 110 TYR n 1 111 ILE n 1 112 THR n 1 113 GLU n 1 114 LEU n 1 115 ALA n 1 116 ASN n 1 117 ALA n 1 118 LEU n 1 119 SER n 1 120 TYR n 1 121 CYS n 1 122 HIS n 1 123 SER n 1 124 LYS n 1 125 ARG n 1 126 VAL n 1 127 ILE n 1 128 HIS n 1 129 ARG n 1 130 ASP n 1 131 ILE n 1 132 LYS n 1 133 PRO n 1 134 GLU n 1 135 ASN n 1 136 LEU n 1 137 LEU n 1 138 LEU n 1 139 GLY n 1 140 SER n 1 141 ALA n 1 142 GLY n 1 143 GLU n 1 144 LEU n 1 145 LYS n 1 146 ILE n 1 147 ALA n 1 148 ASP n 1 149 PHE n 1 150 GLY n 1 151 TRP n 1 152 SER n 1 153 VAL n 1 154 HIS n 1 155 ALA n 1 156 PRO n 1 157 SER n 1 158 SER n 1 159 ARG n 1 160 ARG n 1 161 THR n 1 162 THR n 1 163 LEU n 1 164 CYS n 1 165 GLY n 1 166 THR n 1 167 LEU n 1 168 ASP n 1 169 TYR n 1 170 LEU n 1 171 PRO n 1 172 PRO n 1 173 GLU n 1 174 MET n 1 175 ILE n 1 176 GLU n 1 177 GLY n 1 178 ARG n 1 179 MET n 1 180 HIS n 1 181 ASP n 1 182 GLU n 1 183 LYS n 1 184 VAL n 1 185 ASP n 1 186 LEU n 1 187 TRP n 1 188 SER n 1 189 LEU n 1 190 GLY n 1 191 VAL n 1 192 LEU n 1 193 CYS n 1 194 TYR n 1 195 GLU n 1 196 PHE n 1 197 LEU n 1 198 VAL n 1 199 GLY n 1 200 LYS n 1 201 PRO n 1 202 PRO n 1 203 PHE n 1 204 GLU n 1 205 ALA n 1 206 ASN n 1 207 THR n 1 208 TYR n 1 209 GLN n 1 210 GLU n 1 211 THR n 1 212 TYR n 1 213 LYS n 1 214 ARG n 1 215 ILE n 1 216 SER n 1 217 ARG n 1 218 VAL n 1 219 GLU n 1 220 PHE n 1 221 THR n 1 222 PHE n 1 223 PRO n 1 224 ASP n 1 225 PHE n 1 226 VAL n 1 227 THR n 1 228 GLU n 1 229 GLY n 1 230 ALA n 1 231 ARG n 1 232 ASP n 1 233 LEU n 1 234 ILE n 1 235 SER n 1 236 ARG n 1 237 LEU n 1 238 LEU n 1 239 LYS n 1 240 HIS n 1 241 ASN n 1 242 PRO n 1 243 SER n 1 244 GLN n 1 245 ARG n 1 246 PRO n 1 247 MET n 1 248 LEU n 1 249 ARG n 1 250 GLU n 1 251 VAL n 1 252 LEU n 1 253 GLU n 1 254 HIS n 1 255 PRO n 1 256 TRP n 1 257 ILE n 1 258 THR n 1 259 ALA n 1 260 ASN n 1 261 SER n 1 262 SER n 1 263 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 263 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AURKA_HUMAN _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR TTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSK ; _struct_ref.pdbx_align_begin 127 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JMX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 127 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 389 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 127 _struct_ref_seq.pdbx_auth_seq_align_end 389 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 E47 non-polymer . '5-(4-morpholin-4-yl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-2-oxidanyl-benzaldehyde' ? 'C17 H16 N4 O3' 324.334 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JMX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris-HCl (pH 8.5), 0.2 M lithium sulfate and 25% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 94.7155242654 _reflns.entry_id 8JMX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.95 _reflns.d_resolution_low 44.77 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7925 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 24 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.18 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.95 _reflns_shell.d_res_low 3.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 7925 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.9 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 84.2022464107 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JMX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.95020177482 _refine.ls_d_res_low 44.7619867619 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7925 _refine.ls_number_reflns_R_free 793 _refine.ls_number_reflns_R_work 7132 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9873832955 _refine.ls_percent_reflns_R_free 10.0063091483 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23073303539 _refine.ls_R_factor_R_free 0.306254454324 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.222438457861 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38968714321 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.1800906938 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.351404133956 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.95020177482 _refine_hist.d_res_low 44.7619867619 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1956 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1956 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0105714500307 ? 2006 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.565850428 ? 2736 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0567331174225 ? 304 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00628765506636 ? 351 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.0873865665 ? 708 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.9503 3.135 . . 127 1143 100.0 . . . . 0.285404551251 . . . . . . . . . . . 0.338598787352 'X-RAY DIFFRACTION' 3.135 3.377 . . 127 1143 100.0 . . . . 0.260906507731 . . . . . . . . . . . 0.339864013554 'X-RAY DIFFRACTION' 3.377 3.7167 . . 131 1171 100.0 . . . . 0.247378564304 . . . . . . . . . . . 0.319270937033 'X-RAY DIFFRACTION' 3.7167 4.2541 . . 130 1172 99.9232540292 . . . . 0.21537569631 . . . . . . . . . . . 0.333114223962 'X-RAY DIFFRACTION' 4.2541 5.3583 . . 134 1204 100.0 . . . . 0.207277838682 . . . . . . . . . . . 0.272920799123 'X-RAY DIFFRACTION' 5.3583 44.75 . . 144 1299 100.0 . . . . 0.213452819489 . . . . . . . . . . . 0.299473989809 # _struct.entry_id 8JMX _struct.title 'The crystal structure of human aurka kinase domain in complex with AURKA-A2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JMX _struct_keywords.text 'kinase mitosis inhibitor, CYTOKINE' _struct_keywords.pdbx_keywords CYTOKINE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 3 ? GLU A 5 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 AA2 LEU A 52 ? HIS A 61 ? LEU A 178 HIS A 187 1 ? 10 HELX_P HELX_P3 AA3 THR A 91 ? SER A 100 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P4 AA4 ASP A 103 ? LYS A 124 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P5 AA5 LYS A 132 ? GLU A 134 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P6 AA6 PRO A 171 ? GLU A 176 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P7 AA7 LYS A 183 ? GLY A 199 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P8 AA8 THR A 207 ? ARG A 217 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P9 AA9 THR A 227 ? LEU A 238 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P10 AB1 ASN A 241 ? ARG A 245 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P11 AB2 MET A 247 ? HIS A 254 ? MET A 373 HIS A 380 1 ? 8 HELX_P HELX_P12 AB3 HIS A 254 ? SER A 261 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 36 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id E47 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C17 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 162 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id E47 _struct_conn.ptnr2_auth_seq_id 401 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.469 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 7 ? LYS A 15 ? PHE A 133 LYS A 141 AA1 2 ASN A 20 ? GLU A 26 ? ASN A 146 GLU A 152 AA1 3 ILE A 32 ? VAL A 37 ? ILE A 158 VAL A 163 AA1 4 VAL A 80 ? LEU A 84 ? VAL A 206 LEU A 210 AA1 5 LEU A 70 ? HIS A 75 ? LEU A 196 HIS A 201 AA2 1 LEU A 136 ? LEU A 138 ? LEU A 262 LEU A 264 AA2 2 LEU A 144 ? ILE A 146 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 10 ? N GLY A 136 O LEU A 23 ? O LEU A 149 AA1 2 3 N ASN A 20 ? N ASN A 146 O VAL A 37 ? O VAL A 163 AA1 3 4 N ALA A 34 ? N ALA A 160 O LEU A 84 ? O LEU A 210 AA1 4 5 O ILE A 83 ? O ILE A 209 N TYR A 71 ? N TYR A 197 AA2 1 2 N LEU A 137 ? N LEU A 263 O LYS A 145 ? O LYS A 271 # _atom_sites.entry_id 8JMX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012029 _atom_sites.fract_transf_matrix[1][2] 0.006945 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013890 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005833 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 4.90428 4.07044 12.99538 1.63651 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? ? ? ? ? ? ? ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 127 127 GLN GLN A . n A 1 2 TRP 2 128 128 TRP TRP A . n A 1 3 ALA 3 129 129 ALA ALA A . n A 1 4 LEU 4 130 130 LEU LEU A . n A 1 5 GLU 5 131 131 GLU GLU A . n A 1 6 ASP 6 132 132 ASP ASP A . n A 1 7 PHE 7 133 133 PHE PHE A . n A 1 8 GLU 8 134 134 GLU GLU A . n A 1 9 ILE 9 135 135 ILE ILE A . n A 1 10 GLY 10 136 136 GLY GLY A . n A 1 11 ARG 11 137 137 ARG ARG A . n A 1 12 PRO 12 138 138 PRO PRO A . n A 1 13 LEU 13 139 139 LEU LEU A . n A 1 14 GLY 14 140 140 GLY GLY A . n A 1 15 LYS 15 141 141 LYS LYS A . n A 1 16 GLY 16 142 142 GLY GLY A . n A 1 17 LYS 17 143 143 LYS LYS A . n A 1 18 PHE 18 144 144 PHE PHE A . n A 1 19 GLY 19 145 145 GLY GLY A . n A 1 20 ASN 20 146 146 ASN ASN A . n A 1 21 VAL 21 147 147 VAL VAL A . n A 1 22 TYR 22 148 148 TYR TYR A . n A 1 23 LEU 23 149 149 LEU LEU A . n A 1 24 ALA 24 150 150 ALA ALA A . n A 1 25 ARG 25 151 151 ARG ARG A . n A 1 26 GLU 26 152 152 GLU GLU A . n A 1 27 LYS 27 153 153 LYS LYS A . n A 1 28 GLN 28 154 154 GLN GLN A . n A 1 29 SER 29 155 155 SER SER A . n A 1 30 LYS 30 156 156 LYS LYS A . n A 1 31 PHE 31 157 157 PHE PHE A . n A 1 32 ILE 32 158 158 ILE ILE A . n A 1 33 LEU 33 159 159 LEU LEU A . n A 1 34 ALA 34 160 160 ALA ALA A . n A 1 35 LEU 35 161 161 LEU LEU A . n A 1 36 LYS 36 162 162 LYS LYS A . n A 1 37 VAL 37 163 163 VAL VAL A . n A 1 38 LEU 38 164 164 LEU LEU A . n A 1 39 PHE 39 165 165 PHE PHE A . n A 1 40 LYS 40 166 166 LYS LYS A . n A 1 41 ALA 41 167 167 ALA ALA A . n A 1 42 GLN 42 168 168 GLN GLN A . n A 1 43 LEU 43 169 169 LEU LEU A . n A 1 44 GLU 44 170 170 GLU GLU A . n A 1 45 LYS 45 171 171 LYS LYS A . n A 1 46 ALA 46 172 172 ALA ALA A . n A 1 47 GLY 47 173 173 GLY GLY A . n A 1 48 VAL 48 174 174 VAL VAL A . n A 1 49 GLU 49 175 175 GLU GLU A . n A 1 50 HIS 50 176 176 HIS HIS A . n A 1 51 GLN 51 177 177 GLN GLN A . n A 1 52 LEU 52 178 178 LEU LEU A . n A 1 53 ARG 53 179 179 ARG ARG A . n A 1 54 ARG 54 180 180 ARG ARG A . n A 1 55 GLU 55 181 181 GLU GLU A . n A 1 56 VAL 56 182 182 VAL VAL A . n A 1 57 GLU 57 183 183 GLU GLU A . n A 1 58 ILE 58 184 184 ILE ILE A . n A 1 59 GLN 59 185 185 GLN GLN A . n A 1 60 SER 60 186 186 SER SER A . n A 1 61 HIS 61 187 187 HIS HIS A . n A 1 62 LEU 62 188 188 LEU LEU A . n A 1 63 ARG 63 189 189 ARG ARG A . n A 1 64 HIS 64 190 190 HIS HIS A . n A 1 65 PRO 65 191 191 PRO PRO A . n A 1 66 ASN 66 192 192 ASN ASN A . n A 1 67 ILE 67 193 193 ILE ILE A . n A 1 68 LEU 68 194 194 LEU LEU A . n A 1 69 ARG 69 195 195 ARG ARG A . n A 1 70 LEU 70 196 196 LEU LEU A . n A 1 71 TYR 71 197 197 TYR TYR A . n A 1 72 GLY 72 198 198 GLY GLY A . n A 1 73 TYR 73 199 199 TYR TYR A . n A 1 74 PHE 74 200 200 PHE PHE A . n A 1 75 HIS 75 201 201 HIS HIS A . n A 1 76 ASP 76 202 202 ASP ASP A . n A 1 77 ALA 77 203 203 ALA ALA A . n A 1 78 THR 78 204 204 THR THR A . n A 1 79 ARG 79 205 205 ARG ARG A . n A 1 80 VAL 80 206 206 VAL VAL A . n A 1 81 TYR 81 207 207 TYR TYR A . n A 1 82 LEU 82 208 208 LEU LEU A . n A 1 83 ILE 83 209 209 ILE ILE A . n A 1 84 LEU 84 210 210 LEU LEU A . n A 1 85 GLU 85 211 211 GLU GLU A . n A 1 86 TYR 86 212 212 TYR TYR A . n A 1 87 ALA 87 213 213 ALA ALA A . n A 1 88 PRO 88 214 214 PRO PRO A . n A 1 89 LEU 89 215 215 LEU LEU A . n A 1 90 GLY 90 216 216 GLY GLY A . n A 1 91 THR 91 217 217 THR THR A . n A 1 92 VAL 92 218 218 VAL VAL A . n A 1 93 TYR 93 219 219 TYR TYR A . n A 1 94 ARG 94 220 220 ARG ARG A . n A 1 95 GLU 95 221 221 GLU GLU A . n A 1 96 LEU 96 222 222 LEU LEU A . n A 1 97 GLN 97 223 223 GLN GLN A . n A 1 98 LYS 98 224 224 LYS LYS A . n A 1 99 LEU 99 225 225 LEU LEU A . n A 1 100 SER 100 226 226 SER SER A . n A 1 101 LYS 101 227 227 LYS LYS A . n A 1 102 PHE 102 228 228 PHE PHE A . n A 1 103 ASP 103 229 229 ASP ASP A . n A 1 104 GLU 104 230 230 GLU GLU A . n A 1 105 GLN 105 231 231 GLN GLN A . n A 1 106 ARG 106 232 232 ARG ARG A . n A 1 107 THR 107 233 233 THR THR A . n A 1 108 ALA 108 234 234 ALA ALA A . n A 1 109 THR 109 235 235 THR THR A . n A 1 110 TYR 110 236 236 TYR TYR A . n A 1 111 ILE 111 237 237 ILE ILE A . n A 1 112 THR 112 238 238 THR THR A . n A 1 113 GLU 113 239 239 GLU GLU A . n A 1 114 LEU 114 240 240 LEU LEU A . n A 1 115 ALA 115 241 241 ALA ALA A . n A 1 116 ASN 116 242 242 ASN ASN A . n A 1 117 ALA 117 243 243 ALA ALA A . n A 1 118 LEU 118 244 244 LEU LEU A . n A 1 119 SER 119 245 245 SER SER A . n A 1 120 TYR 120 246 246 TYR TYR A . n A 1 121 CYS 121 247 247 CYS CYS A . n A 1 122 HIS 122 248 248 HIS HIS A . n A 1 123 SER 123 249 249 SER SER A . n A 1 124 LYS 124 250 250 LYS LYS A . n A 1 125 ARG 125 251 251 ARG ARG A . n A 1 126 VAL 126 252 252 VAL VAL A . n A 1 127 ILE 127 253 253 ILE ILE A . n A 1 128 HIS 128 254 254 HIS HIS A . n A 1 129 ARG 129 255 255 ARG ARG A . n A 1 130 ASP 130 256 256 ASP ASP A . n A 1 131 ILE 131 257 257 ILE ILE A . n A 1 132 LYS 132 258 258 LYS LYS A . n A 1 133 PRO 133 259 259 PRO PRO A . n A 1 134 GLU 134 260 260 GLU GLU A . n A 1 135 ASN 135 261 261 ASN ASN A . n A 1 136 LEU 136 262 262 LEU LEU A . n A 1 137 LEU 137 263 263 LEU LEU A . n A 1 138 LEU 138 264 264 LEU LEU A . n A 1 139 GLY 139 265 265 GLY GLY A . n A 1 140 SER 140 266 266 SER SER A . n A 1 141 ALA 141 267 267 ALA ALA A . n A 1 142 GLY 142 268 268 GLY GLY A . n A 1 143 GLU 143 269 269 GLU GLU A . n A 1 144 LEU 144 270 270 LEU LEU A . n A 1 145 LYS 145 271 271 LYS LYS A . n A 1 146 ILE 146 272 272 ILE ILE A . n A 1 147 ALA 147 273 273 ALA ALA A . n A 1 148 ASP 148 274 274 ASP ASP A . n A 1 149 PHE 149 275 275 PHE PHE A . n A 1 150 GLY 150 276 276 GLY GLY A . n A 1 151 TRP 151 277 ? ? ? A . n A 1 152 SER 152 278 ? ? ? A . n A 1 153 VAL 153 279 ? ? ? A . n A 1 154 HIS 154 280 ? ? ? A . n A 1 155 ALA 155 281 ? ? ? A . n A 1 156 PRO 156 282 ? ? ? A . n A 1 157 SER 157 283 ? ? ? A . n A 1 158 SER 158 284 ? ? ? A . n A 1 159 ARG 159 285 ? ? ? A . n A 1 160 ARG 160 286 ? ? ? A . n A 1 161 THR 161 287 ? ? ? A . n A 1 162 THR 162 288 ? ? ? A . n A 1 163 LEU 163 289 ? ? ? A . n A 1 164 CYS 164 290 290 CYS CYS A . n A 1 165 GLY 165 291 291 GLY GLY A . n A 1 166 THR 166 292 292 THR THR A . n A 1 167 LEU 167 293 293 LEU LEU A . n A 1 168 ASP 168 294 294 ASP ASP A . n A 1 169 TYR 169 295 295 TYR TYR A . n A 1 170 LEU 170 296 296 LEU LEU A . n A 1 171 PRO 171 297 297 PRO PRO A . n A 1 172 PRO 172 298 298 PRO PRO A . n A 1 173 GLU 173 299 299 GLU GLU A . n A 1 174 MET 174 300 300 MET MET A . n A 1 175 ILE 175 301 301 ILE ILE A . n A 1 176 GLU 176 302 302 GLU GLU A . n A 1 177 GLY 177 303 303 GLY GLY A . n A 1 178 ARG 178 304 304 ARG ARG A . n A 1 179 MET 179 305 305 MET MET A . n A 1 180 HIS 180 306 306 HIS HIS A . n A 1 181 ASP 181 307 307 ASP ASP A . n A 1 182 GLU 182 308 308 GLU GLU A . n A 1 183 LYS 183 309 309 LYS LYS A . n A 1 184 VAL 184 310 310 VAL VAL A . n A 1 185 ASP 185 311 311 ASP ASP A . n A 1 186 LEU 186 312 312 LEU LEU A . n A 1 187 TRP 187 313 313 TRP TRP A . n A 1 188 SER 188 314 314 SER SER A . n A 1 189 LEU 189 315 315 LEU LEU A . n A 1 190 GLY 190 316 316 GLY GLY A . n A 1 191 VAL 191 317 317 VAL VAL A . n A 1 192 LEU 192 318 318 LEU LEU A . n A 1 193 CYS 193 319 319 CYS CYS A . n A 1 194 TYR 194 320 320 TYR TYR A . n A 1 195 GLU 195 321 321 GLU GLU A . n A 1 196 PHE 196 322 322 PHE PHE A . n A 1 197 LEU 197 323 323 LEU LEU A . n A 1 198 VAL 198 324 324 VAL VAL A . n A 1 199 GLY 199 325 325 GLY GLY A . n A 1 200 LYS 200 326 326 LYS LYS A . n A 1 201 PRO 201 327 327 PRO PRO A . n A 1 202 PRO 202 328 328 PRO PRO A . n A 1 203 PHE 203 329 329 PHE PHE A . n A 1 204 GLU 204 330 330 GLU GLU A . n A 1 205 ALA 205 331 331 ALA ALA A . n A 1 206 ASN 206 332 332 ASN ASN A . n A 1 207 THR 207 333 333 THR THR A . n A 1 208 TYR 208 334 334 TYR TYR A . n A 1 209 GLN 209 335 335 GLN GLN A . n A 1 210 GLU 210 336 336 GLU GLU A . n A 1 211 THR 211 337 337 THR THR A . n A 1 212 TYR 212 338 338 TYR TYR A . n A 1 213 LYS 213 339 339 LYS LYS A . n A 1 214 ARG 214 340 340 ARG ARG A . n A 1 215 ILE 215 341 341 ILE ILE A . n A 1 216 SER 216 342 342 SER SER A . n A 1 217 ARG 217 343 343 ARG ARG A . n A 1 218 VAL 218 344 344 VAL VAL A . n A 1 219 GLU 219 345 345 GLU GLU A . n A 1 220 PHE 220 346 346 PHE PHE A . n A 1 221 THR 221 347 347 THR THR A . n A 1 222 PHE 222 348 348 PHE PHE A . n A 1 223 PRO 223 349 349 PRO PRO A . n A 1 224 ASP 224 350 350 ASP ASP A . n A 1 225 PHE 225 351 351 PHE PHE A . n A 1 226 VAL 226 352 352 VAL VAL A . n A 1 227 THR 227 353 353 THR THR A . n A 1 228 GLU 228 354 354 GLU GLU A . n A 1 229 GLY 229 355 355 GLY GLY A . n A 1 230 ALA 230 356 356 ALA ALA A . n A 1 231 ARG 231 357 357 ARG ARG A . n A 1 232 ASP 232 358 358 ASP ASP A . n A 1 233 LEU 233 359 359 LEU LEU A . n A 1 234 ILE 234 360 360 ILE ILE A . n A 1 235 SER 235 361 361 SER SER A . n A 1 236 ARG 236 362 362 ARG ARG A . n A 1 237 LEU 237 363 363 LEU LEU A . n A 1 238 LEU 238 364 364 LEU LEU A . n A 1 239 LYS 239 365 365 LYS LYS A . n A 1 240 HIS 240 366 366 HIS HIS A . n A 1 241 ASN 241 367 367 ASN ASN A . n A 1 242 PRO 242 368 368 PRO PRO A . n A 1 243 SER 243 369 369 SER SER A . n A 1 244 GLN 244 370 370 GLN GLN A . n A 1 245 ARG 245 371 371 ARG ARG A . n A 1 246 PRO 246 372 372 PRO PRO A . n A 1 247 MET 247 373 373 MET MET A . n A 1 248 LEU 248 374 374 LEU LEU A . n A 1 249 ARG 249 375 375 ARG ARG A . n A 1 250 GLU 250 376 376 GLU GLU A . n A 1 251 VAL 251 377 377 VAL VAL A . n A 1 252 LEU 252 378 378 LEU LEU A . n A 1 253 GLU 253 379 379 GLU GLU A . n A 1 254 HIS 254 380 380 HIS HIS A . n A 1 255 PRO 255 381 381 PRO PRO A . n A 1 256 TRP 256 382 382 TRP TRP A . n A 1 257 ILE 257 383 383 ILE ILE A . n A 1 258 THR 258 384 384 THR THR A . n A 1 259 ALA 259 385 385 ALA ALA A . n A 1 260 ASN 260 386 386 ASN ASN A . n A 1 261 SER 261 387 387 SER SER A . n A 1 262 SER 262 388 388 SER SER A . n A 1 263 LYS 263 389 389 LYS LYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email 13632107756@163.com _pdbx_contact_author.name_first Zhimin _pdbx_contact_author.name_last Zhang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5088-5869 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id E47 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 401 _pdbx_nonpoly_scheme.pdb_mon_id E47 _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692+SVN 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 8JMX _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 178 ? ? N A VAL 182 ? ? 2.00 2 1 OE1 A GLU 221 ? ? NH1 A ARG 232 ? ? 2.18 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A VAL 174 ? ? CB A VAL 174 ? ? CG2 A VAL 174 ? ? 95.28 110.90 -15.62 1.60 N 2 1 CA A LEU 178 ? ? CB A LEU 178 ? ? CG A LEU 178 ? ? 134.36 115.30 19.06 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 143 ? ? 63.95 -121.86 2 1 PHE A 165 ? ? 76.68 -15.01 3 1 LYS A 166 ? ? 61.99 -5.11 4 1 LYS A 171 ? ? 81.06 6.93 5 1 ALA A 172 ? ? -143.13 -24.76 6 1 VAL A 174 ? ? -93.46 51.87 7 1 HIS A 176 ? ? 66.76 -41.93 8 1 GLN A 177 ? ? 1.76 -51.25 9 1 LEU A 178 ? ? -143.11 -44.91 10 1 HIS A 187 ? ? -111.26 53.98 11 1 HIS A 190 ? ? -175.04 146.31 12 1 SER A 226 ? ? 67.82 -65.07 13 1 HIS A 254 ? ? -175.92 -143.93 14 1 ARG A 255 ? ? -146.96 -121.49 15 1 ASP A 256 ? ? 37.66 -123.90 16 1 LYS A 271 ? ? -165.52 115.08 17 1 ALA A 273 ? ? -66.97 -135.61 18 1 LEU A 293 ? ? 79.63 -40.21 19 1 ARG A 304 ? ? -64.60 -166.70 20 1 ASP A 307 ? ? -101.86 -148.35 21 1 VAL A 344 ? ? 30.70 69.67 22 1 LEU A 364 ? ? -103.17 72.01 23 1 SER A 369 ? ? -48.02 -2.70 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 177 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 178 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 141 ? CG ? A LYS 15 CG 2 1 Y 1 A LYS 141 ? CD ? A LYS 15 CD 3 1 Y 1 A LYS 141 ? CE ? A LYS 15 CE 4 1 Y 1 A LYS 141 ? NZ ? A LYS 15 NZ 5 1 Y 1 A LYS 143 ? CG ? A LYS 17 CG 6 1 Y 1 A LYS 143 ? CD ? A LYS 17 CD 7 1 Y 1 A LYS 143 ? CE ? A LYS 17 CE 8 1 Y 1 A LYS 143 ? NZ ? A LYS 17 NZ 9 1 Y 1 A PHE 144 ? CG ? A PHE 18 CG 10 1 Y 1 A PHE 144 ? CD1 ? A PHE 18 CD1 11 1 Y 1 A PHE 144 ? CD2 ? A PHE 18 CD2 12 1 Y 1 A PHE 144 ? CE1 ? A PHE 18 CE1 13 1 Y 1 A PHE 144 ? CE2 ? A PHE 18 CE2 14 1 Y 1 A PHE 144 ? CZ ? A PHE 18 CZ 15 1 Y 1 A GLN 154 ? CG ? A GLN 28 CG 16 1 Y 1 A GLN 154 ? CD ? A GLN 28 CD 17 1 Y 1 A GLN 154 ? OE1 ? A GLN 28 OE1 18 1 Y 1 A GLN 154 ? NE2 ? A GLN 28 NE2 19 1 Y 1 A PHE 165 ? CG ? A PHE 39 CG 20 1 Y 1 A PHE 165 ? CD1 ? A PHE 39 CD1 21 1 Y 1 A PHE 165 ? CD2 ? A PHE 39 CD2 22 1 Y 1 A PHE 165 ? CE1 ? A PHE 39 CE1 23 1 Y 1 A PHE 165 ? CE2 ? A PHE 39 CE2 24 1 Y 1 A PHE 165 ? CZ ? A PHE 39 CZ 25 1 Y 1 A LEU 169 ? CG ? A LEU 43 CG 26 1 Y 1 A LEU 169 ? CD1 ? A LEU 43 CD1 27 1 Y 1 A LEU 169 ? CD2 ? A LEU 43 CD2 28 1 Y 1 A GLU 170 ? CG ? A GLU 44 CG 29 1 Y 1 A GLU 170 ? CD ? A GLU 44 CD 30 1 Y 1 A GLU 170 ? OE1 ? A GLU 44 OE1 31 1 Y 1 A GLU 170 ? OE2 ? A GLU 44 OE2 32 1 Y 1 A LYS 171 ? CG ? A LYS 45 CG 33 1 Y 1 A LYS 171 ? CD ? A LYS 45 CD 34 1 Y 1 A LYS 171 ? CE ? A LYS 45 CE 35 1 Y 1 A LYS 171 ? NZ ? A LYS 45 NZ 36 1 Y 1 A HIS 176 ? CG ? A HIS 50 CG 37 1 Y 1 A HIS 176 ? ND1 ? A HIS 50 ND1 38 1 Y 1 A HIS 176 ? CD2 ? A HIS 50 CD2 39 1 Y 1 A HIS 176 ? CE1 ? A HIS 50 CE1 40 1 Y 1 A HIS 176 ? NE2 ? A HIS 50 NE2 41 1 Y 1 A ARG 180 ? CG ? A ARG 54 CG 42 1 Y 1 A ARG 180 ? CD ? A ARG 54 CD 43 1 Y 1 A ARG 180 ? NE ? A ARG 54 NE 44 1 Y 1 A ARG 180 ? CZ ? A ARG 54 CZ 45 1 Y 1 A ARG 180 ? NH1 ? A ARG 54 NH1 46 1 Y 1 A ARG 180 ? NH2 ? A ARG 54 NH2 47 1 Y 1 A GLU 181 ? CG ? A GLU 55 CG 48 1 Y 1 A GLU 181 ? CD ? A GLU 55 CD 49 1 Y 1 A GLU 181 ? OE1 ? A GLU 55 OE1 50 1 Y 1 A GLU 181 ? OE2 ? A GLU 55 OE2 51 1 Y 1 A GLU 183 ? CG ? A GLU 57 CG 52 1 Y 1 A GLU 183 ? CD ? A GLU 57 CD 53 1 Y 1 A GLU 183 ? OE1 ? A GLU 57 OE1 54 1 Y 1 A GLU 183 ? OE2 ? A GLU 57 OE2 55 1 Y 1 A ARG 195 ? CG ? A ARG 69 CG 56 1 Y 1 A ARG 195 ? CD ? A ARG 69 CD 57 1 Y 1 A ARG 195 ? NE ? A ARG 69 NE 58 1 Y 1 A ARG 195 ? CZ ? A ARG 69 CZ 59 1 Y 1 A ARG 195 ? NH1 ? A ARG 69 NH1 60 1 Y 1 A ARG 195 ? NH2 ? A ARG 69 NH2 61 1 Y 1 A ARG 220 ? CG ? A ARG 94 CG 62 1 Y 1 A ARG 220 ? CD ? A ARG 94 CD 63 1 Y 1 A ARG 220 ? NE ? A ARG 94 NE 64 1 Y 1 A ARG 220 ? CZ ? A ARG 94 CZ 65 1 Y 1 A ARG 220 ? NH1 ? A ARG 94 NH1 66 1 Y 1 A ARG 220 ? NH2 ? A ARG 94 NH2 67 1 Y 1 A LYS 224 ? CG ? A LYS 98 CG 68 1 Y 1 A LYS 224 ? CD ? A LYS 98 CD 69 1 Y 1 A LYS 224 ? CE ? A LYS 98 CE 70 1 Y 1 A LYS 224 ? NZ ? A LYS 98 NZ 71 1 Y 1 A GLN 231 ? CG ? A GLN 105 CG 72 1 Y 1 A GLN 231 ? CD ? A GLN 105 CD 73 1 Y 1 A GLN 231 ? OE1 ? A GLN 105 OE1 74 1 Y 1 A GLN 231 ? NE2 ? A GLN 105 NE2 75 1 Y 1 A LYS 250 ? CG ? A LYS 124 CG 76 1 Y 1 A LYS 250 ? CD ? A LYS 124 CD 77 1 Y 1 A LYS 250 ? CE ? A LYS 124 CE 78 1 Y 1 A LYS 250 ? NZ ? A LYS 124 NZ 79 1 Y 1 A ARG 251 ? CG ? A ARG 125 CG 80 1 Y 1 A ARG 251 ? CD ? A ARG 125 CD 81 1 Y 1 A ARG 251 ? NE ? A ARG 125 NE 82 1 Y 1 A ARG 251 ? CZ ? A ARG 125 CZ 83 1 Y 1 A ARG 251 ? NH1 ? A ARG 125 NH1 84 1 Y 1 A ARG 251 ? NH2 ? A ARG 125 NH2 85 1 Y 1 A ARG 255 ? CG ? A ARG 129 CG 86 1 Y 1 A ARG 255 ? CD ? A ARG 129 CD 87 1 Y 1 A ARG 255 ? NE ? A ARG 129 NE 88 1 Y 1 A ARG 255 ? CZ ? A ARG 129 CZ 89 1 Y 1 A ARG 255 ? NH1 ? A ARG 129 NH1 90 1 Y 1 A ARG 255 ? NH2 ? A ARG 129 NH2 91 1 Y 1 A LYS 258 ? CG ? A LYS 132 CG 92 1 Y 1 A LYS 258 ? CD ? A LYS 132 CD 93 1 Y 1 A LYS 258 ? CE ? A LYS 132 CE 94 1 Y 1 A LYS 258 ? NZ ? A LYS 132 NZ 95 1 Y 1 A MET 305 ? CG ? A MET 179 CG 96 1 Y 1 A MET 305 ? SD ? A MET 179 SD 97 1 Y 1 A MET 305 ? CE ? A MET 179 CE 98 1 Y 1 A LYS 326 ? CG ? A LYS 200 CG 99 1 Y 1 A LYS 326 ? CD ? A LYS 200 CD 100 1 Y 1 A LYS 326 ? CE ? A LYS 200 CE 101 1 Y 1 A LYS 326 ? NZ ? A LYS 200 NZ 102 1 Y 1 A GLU 336 ? CG ? A GLU 210 CG 103 1 Y 1 A GLU 336 ? CD ? A GLU 210 CD 104 1 Y 1 A GLU 336 ? OE1 ? A GLU 210 OE1 105 1 Y 1 A GLU 336 ? OE2 ? A GLU 210 OE2 106 1 Y 1 A LYS 339 ? CG ? A LYS 213 CG 107 1 Y 1 A LYS 339 ? CD ? A LYS 213 CD 108 1 Y 1 A LYS 339 ? CE ? A LYS 213 CE 109 1 Y 1 A LYS 339 ? NZ ? A LYS 213 NZ 110 1 Y 1 A ARG 375 ? CG ? A ARG 249 CG 111 1 Y 1 A ARG 375 ? CD ? A ARG 249 CD 112 1 Y 1 A ARG 375 ? NE ? A ARG 249 NE 113 1 Y 1 A ARG 375 ? CZ ? A ARG 249 CZ 114 1 Y 1 A ARG 375 ? NH1 ? A ARG 249 NH1 115 1 Y 1 A ARG 375 ? NH2 ? A ARG 249 NH2 116 1 Y 1 A LYS 389 ? CG ? A LYS 263 CG 117 1 Y 1 A LYS 389 ? CD ? A LYS 263 CD 118 1 Y 1 A LYS 389 ? CE ? A LYS 263 CE 119 1 Y 1 A LYS 389 ? NZ ? A LYS 263 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TRP 277 ? A TRP 151 2 1 Y 1 A SER 278 ? A SER 152 3 1 Y 1 A VAL 279 ? A VAL 153 4 1 Y 1 A HIS 280 ? A HIS 154 5 1 Y 1 A ALA 281 ? A ALA 155 6 1 Y 1 A PRO 282 ? A PRO 156 7 1 Y 1 A SER 283 ? A SER 157 8 1 Y 1 A SER 284 ? A SER 158 9 1 Y 1 A ARG 285 ? A ARG 159 10 1 Y 1 A ARG 286 ? A ARG 160 11 1 Y 1 A THR 287 ? A THR 161 12 1 Y 1 A THR 288 ? A THR 162 13 1 Y 1 A LEU 289 ? A LEU 163 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 E47 N1 N N N 88 E47 N3 N Y N 89 E47 C4 C N N 90 E47 C5 C Y N 91 E47 C6 C Y N 92 E47 C7 C Y N 93 E47 C8 C Y N 94 E47 C10 C Y N 95 E47 C13 C Y N 96 E47 C15 C Y N 97 E47 C17 C N N 98 E47 O1 O N N 99 E47 C1 C N N 100 E47 C2 C N N 101 E47 C3 C N N 102 E47 N2 N Y N 103 E47 N4 N Y N 104 E47 C9 C Y N 105 E47 C11 C Y N 106 E47 C12 C Y N 107 E47 C14 C Y N 108 E47 C16 C Y N 109 E47 O2 O N N 110 E47 H7 H N N 111 E47 H8 H N N 112 E47 H9 H N N 113 E47 H13 H N N 114 E47 H16 H N N 115 E47 H2 H N N 116 E47 H1 H N N 117 E47 H3 H N N 118 E47 H4 H N N 119 E47 H6 H N N 120 E47 H5 H N N 121 E47 H10 H N N 122 E47 H11 H N N 123 E47 H12 H N N 124 E47 H14 H N N 125 E47 H15 H N N 126 E47 O3 O N N 127 GLN N N N N 128 GLN CA C N S 129 GLN C C N N 130 GLN O O N N 131 GLN CB C N N 132 GLN CG C N N 133 GLN CD C N N 134 GLN OE1 O N N 135 GLN NE2 N N N 136 GLN OXT O N N 137 GLN H H N N 138 GLN H2 H N N 139 GLN HA H N N 140 GLN HB2 H N N 141 GLN HB3 H N N 142 GLN HG2 H N N 143 GLN HG3 H N N 144 GLN HE21 H N N 145 GLN HE22 H N N 146 GLN HXT H N N 147 GLU N N N N 148 GLU CA C N S 149 GLU C C N N 150 GLU O O N N 151 GLU CB C N N 152 GLU CG C N N 153 GLU CD C N N 154 GLU OE1 O N N 155 GLU OE2 O N N 156 GLU OXT O N N 157 GLU H H N N 158 GLU H2 H N N 159 GLU HA H N N 160 GLU HB2 H N N 161 GLU HB3 H N N 162 GLU HG2 H N N 163 GLU HG3 H N N 164 GLU HE2 H N N 165 GLU HXT H N N 166 GLY N N N N 167 GLY CA C N N 168 GLY C C N N 169 GLY O O N N 170 GLY OXT O N N 171 GLY H H N N 172 GLY H2 H N N 173 GLY HA2 H N N 174 GLY HA3 H N N 175 GLY HXT H N N 176 HIS N N N N 177 HIS CA C N S 178 HIS C C N N 179 HIS O O N N 180 HIS CB C N N 181 HIS CG C Y N 182 HIS ND1 N Y N 183 HIS CD2 C Y N 184 HIS CE1 C Y N 185 HIS NE2 N Y N 186 HIS OXT O N N 187 HIS H H N N 188 HIS H2 H N N 189 HIS HA H N N 190 HIS HB2 H N N 191 HIS HB3 H N N 192 HIS HD1 H N N 193 HIS HD2 H N N 194 HIS HE1 H N N 195 HIS HE2 H N N 196 HIS HXT H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TRP N N N N 358 TRP CA C N S 359 TRP C C N N 360 TRP O O N N 361 TRP CB C N N 362 TRP CG C Y N 363 TRP CD1 C Y N 364 TRP CD2 C Y N 365 TRP NE1 N Y N 366 TRP CE2 C Y N 367 TRP CE3 C Y N 368 TRP CZ2 C Y N 369 TRP CZ3 C Y N 370 TRP CH2 C Y N 371 TRP OXT O N N 372 TRP H H N N 373 TRP H2 H N N 374 TRP HA H N N 375 TRP HB2 H N N 376 TRP HB3 H N N 377 TRP HD1 H N N 378 TRP HE1 H N N 379 TRP HE3 H N N 380 TRP HZ2 H N N 381 TRP HZ3 H N N 382 TRP HH2 H N N 383 TRP HXT H N N 384 TYR N N N N 385 TYR CA C N S 386 TYR C C N N 387 TYR O O N N 388 TYR CB C N N 389 TYR CG C Y N 390 TYR CD1 C Y N 391 TYR CD2 C Y N 392 TYR CE1 C Y N 393 TYR CE2 C Y N 394 TYR CZ C Y N 395 TYR OH O N N 396 TYR OXT O N N 397 TYR H H N N 398 TYR H2 H N N 399 TYR HA H N N 400 TYR HB2 H N N 401 TYR HB3 H N N 402 TYR HD1 H N N 403 TYR HD2 H N N 404 TYR HE1 H N N 405 TYR HE2 H N N 406 TYR HH H N N 407 TYR HXT H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 E47 O1 C4 sing N N 83 E47 O1 C1 sing N N 84 E47 C4 C3 sing N N 85 E47 C1 C2 sing N N 86 E47 C3 N1 sing N N 87 E47 C2 N1 sing N N 88 E47 N1 C5 sing N N 89 E47 N2 C5 doub Y N 90 E47 N2 C6 sing Y N 91 E47 C5 C8 sing Y N 92 E47 O2 C14 sing N N 93 E47 C15 C14 doub Y N 94 E47 C15 C16 sing Y N 95 E47 C6 N3 doub Y N 96 E47 C14 C13 sing Y N 97 E47 C16 C11 doub Y N 98 E47 C8 C10 sing Y N 99 E47 C8 C7 doub Y N 100 E47 C13 C17 sing N N 101 E47 C13 C12 doub Y N 102 E47 C11 C12 sing Y N 103 E47 C11 C10 sing N N 104 E47 N3 C7 sing Y N 105 E47 C10 C9 doub Y N 106 E47 C7 N4 sing Y N 107 E47 C9 N4 sing Y N 108 E47 C4 H7 sing N N 109 E47 C4 H8 sing N N 110 E47 C6 H9 sing N N 111 E47 C15 H13 sing N N 112 E47 C17 H16 sing N N 113 E47 C1 H2 sing N N 114 E47 C1 H1 sing N N 115 E47 C2 H3 sing N N 116 E47 C2 H4 sing N N 117 E47 C3 H6 sing N N 118 E47 C3 H5 sing N N 119 E47 N4 H10 sing N N 120 E47 C9 H11 sing N N 121 E47 C12 H12 sing N N 122 E47 C16 H14 sing N N 123 E47 O2 H15 sing N N 124 E47 C17 O3 doub N N 125 GLN N CA sing N N 126 GLN N H sing N N 127 GLN N H2 sing N N 128 GLN CA C sing N N 129 GLN CA CB sing N N 130 GLN CA HA sing N N 131 GLN C O doub N N 132 GLN C OXT sing N N 133 GLN CB CG sing N N 134 GLN CB HB2 sing N N 135 GLN CB HB3 sing N N 136 GLN CG CD sing N N 137 GLN CG HG2 sing N N 138 GLN CG HG3 sing N N 139 GLN CD OE1 doub N N 140 GLN CD NE2 sing N N 141 GLN NE2 HE21 sing N N 142 GLN NE2 HE22 sing N N 143 GLN OXT HXT sing N N 144 GLU N CA sing N N 145 GLU N H sing N N 146 GLU N H2 sing N N 147 GLU CA C sing N N 148 GLU CA CB sing N N 149 GLU CA HA sing N N 150 GLU C O doub N N 151 GLU C OXT sing N N 152 GLU CB CG sing N N 153 GLU CB HB2 sing N N 154 GLU CB HB3 sing N N 155 GLU CG CD sing N N 156 GLU CG HG2 sing N N 157 GLU CG HG3 sing N N 158 GLU CD OE1 doub N N 159 GLU CD OE2 sing N N 160 GLU OE2 HE2 sing N N 161 GLU OXT HXT sing N N 162 GLY N CA sing N N 163 GLY N H sing N N 164 GLY N H2 sing N N 165 GLY CA C sing N N 166 GLY CA HA2 sing N N 167 GLY CA HA3 sing N N 168 GLY C O doub N N 169 GLY C OXT sing N N 170 GLY OXT HXT sing N N 171 HIS N CA sing N N 172 HIS N H sing N N 173 HIS N H2 sing N N 174 HIS CA C sing N N 175 HIS CA CB sing N N 176 HIS CA HA sing N N 177 HIS C O doub N N 178 HIS C OXT sing N N 179 HIS CB CG sing N N 180 HIS CB HB2 sing N N 181 HIS CB HB3 sing N N 182 HIS CG ND1 sing Y N 183 HIS CG CD2 doub Y N 184 HIS ND1 CE1 doub Y N 185 HIS ND1 HD1 sing N N 186 HIS CD2 NE2 sing Y N 187 HIS CD2 HD2 sing N N 188 HIS CE1 NE2 sing Y N 189 HIS CE1 HE1 sing N N 190 HIS NE2 HE2 sing N N 191 HIS OXT HXT sing N N 192 ILE N CA sing N N 193 ILE N H sing N N 194 ILE N H2 sing N N 195 ILE CA C sing N N 196 ILE CA CB sing N N 197 ILE CA HA sing N N 198 ILE C O doub N N 199 ILE C OXT sing N N 200 ILE CB CG1 sing N N 201 ILE CB CG2 sing N N 202 ILE CB HB sing N N 203 ILE CG1 CD1 sing N N 204 ILE CG1 HG12 sing N N 205 ILE CG1 HG13 sing N N 206 ILE CG2 HG21 sing N N 207 ILE CG2 HG22 sing N N 208 ILE CG2 HG23 sing N N 209 ILE CD1 HD11 sing N N 210 ILE CD1 HD12 sing N N 211 ILE CD1 HD13 sing N N 212 ILE OXT HXT sing N N 213 LEU N CA sing N N 214 LEU N H sing N N 215 LEU N H2 sing N N 216 LEU CA C sing N N 217 LEU CA CB sing N N 218 LEU CA HA sing N N 219 LEU C O doub N N 220 LEU C OXT sing N N 221 LEU CB CG sing N N 222 LEU CB HB2 sing N N 223 LEU CB HB3 sing N N 224 LEU CG CD1 sing N N 225 LEU CG CD2 sing N N 226 LEU CG HG sing N N 227 LEU CD1 HD11 sing N N 228 LEU CD1 HD12 sing N N 229 LEU CD1 HD13 sing N N 230 LEU CD2 HD21 sing N N 231 LEU CD2 HD22 sing N N 232 LEU CD2 HD23 sing N N 233 LEU OXT HXT sing N N 234 LYS N CA sing N N 235 LYS N H sing N N 236 LYS N H2 sing N N 237 LYS CA C sing N N 238 LYS CA CB sing N N 239 LYS CA HA sing N N 240 LYS C O doub N N 241 LYS C OXT sing N N 242 LYS CB CG sing N N 243 LYS CB HB2 sing N N 244 LYS CB HB3 sing N N 245 LYS CG CD sing N N 246 LYS CG HG2 sing N N 247 LYS CG HG3 sing N N 248 LYS CD CE sing N N 249 LYS CD HD2 sing N N 250 LYS CD HD3 sing N N 251 LYS CE NZ sing N N 252 LYS CE HE2 sing N N 253 LYS CE HE3 sing N N 254 LYS NZ HZ1 sing N N 255 LYS NZ HZ2 sing N N 256 LYS NZ HZ3 sing N N 257 LYS OXT HXT sing N N 258 MET N CA sing N N 259 MET N H sing N N 260 MET N H2 sing N N 261 MET CA C sing N N 262 MET CA CB sing N N 263 MET CA HA sing N N 264 MET C O doub N N 265 MET C OXT sing N N 266 MET CB CG sing N N 267 MET CB HB2 sing N N 268 MET CB HB3 sing N N 269 MET CG SD sing N N 270 MET CG HG2 sing N N 271 MET CG HG3 sing N N 272 MET SD CE sing N N 273 MET CE HE1 sing N N 274 MET CE HE2 sing N N 275 MET CE HE3 sing N N 276 MET OXT HXT sing N N 277 PHE N CA sing N N 278 PHE N H sing N N 279 PHE N H2 sing N N 280 PHE CA C sing N N 281 PHE CA CB sing N N 282 PHE CA HA sing N N 283 PHE C O doub N N 284 PHE C OXT sing N N 285 PHE CB CG sing N N 286 PHE CB HB2 sing N N 287 PHE CB HB3 sing N N 288 PHE CG CD1 doub Y N 289 PHE CG CD2 sing Y N 290 PHE CD1 CE1 sing Y N 291 PHE CD1 HD1 sing N N 292 PHE CD2 CE2 doub Y N 293 PHE CD2 HD2 sing N N 294 PHE CE1 CZ doub Y N 295 PHE CE1 HE1 sing N N 296 PHE CE2 CZ sing Y N 297 PHE CE2 HE2 sing N N 298 PHE CZ HZ sing N N 299 PHE OXT HXT sing N N 300 PRO N CA sing N N 301 PRO N CD sing N N 302 PRO N H sing N N 303 PRO CA C sing N N 304 PRO CA CB sing N N 305 PRO CA HA sing N N 306 PRO C O doub N N 307 PRO C OXT sing N N 308 PRO CB CG sing N N 309 PRO CB HB2 sing N N 310 PRO CB HB3 sing N N 311 PRO CG CD sing N N 312 PRO CG HG2 sing N N 313 PRO CG HG3 sing N N 314 PRO CD HD2 sing N N 315 PRO CD HD3 sing N N 316 PRO OXT HXT sing N N 317 SER N CA sing N N 318 SER N H sing N N 319 SER N H2 sing N N 320 SER CA C sing N N 321 SER CA CB sing N N 322 SER CA HA sing N N 323 SER C O doub N N 324 SER C OXT sing N N 325 SER CB OG sing N N 326 SER CB HB2 sing N N 327 SER CB HB3 sing N N 328 SER OG HG sing N N 329 SER OXT HXT sing N N 330 THR N CA sing N N 331 THR N H sing N N 332 THR N H2 sing N N 333 THR CA C sing N N 334 THR CA CB sing N N 335 THR CA HA sing N N 336 THR C O doub N N 337 THR C OXT sing N N 338 THR CB OG1 sing N N 339 THR CB CG2 sing N N 340 THR CB HB sing N N 341 THR OG1 HG1 sing N N 342 THR CG2 HG21 sing N N 343 THR CG2 HG22 sing N N 344 THR CG2 HG23 sing N N 345 THR OXT HXT sing N N 346 TRP N CA sing N N 347 TRP N H sing N N 348 TRP N H2 sing N N 349 TRP CA C sing N N 350 TRP CA CB sing N N 351 TRP CA HA sing N N 352 TRP C O doub N N 353 TRP C OXT sing N N 354 TRP CB CG sing N N 355 TRP CB HB2 sing N N 356 TRP CB HB3 sing N N 357 TRP CG CD1 doub Y N 358 TRP CG CD2 sing Y N 359 TRP CD1 NE1 sing Y N 360 TRP CD1 HD1 sing N N 361 TRP CD2 CE2 doub Y N 362 TRP CD2 CE3 sing Y N 363 TRP NE1 CE2 sing Y N 364 TRP NE1 HE1 sing N N 365 TRP CE2 CZ2 sing Y N 366 TRP CE3 CZ3 doub Y N 367 TRP CE3 HE3 sing N N 368 TRP CZ2 CH2 doub Y N 369 TRP CZ2 HZ2 sing N N 370 TRP CZ3 CH2 sing Y N 371 TRP CZ3 HZ3 sing N N 372 TRP CH2 HH2 sing N N 373 TRP OXT HXT sing N N 374 TYR N CA sing N N 375 TYR N H sing N N 376 TYR N H2 sing N N 377 TYR CA C sing N N 378 TYR CA CB sing N N 379 TYR CA HA sing N N 380 TYR C O doub N N 381 TYR C OXT sing N N 382 TYR CB CG sing N N 383 TYR CB HB2 sing N N 384 TYR CB HB3 sing N N 385 TYR CG CD1 doub Y N 386 TYR CG CD2 sing Y N 387 TYR CD1 CE1 sing Y N 388 TYR CD1 HD1 sing N N 389 TYR CD2 CE2 doub Y N 390 TYR CD2 HD2 sing N N 391 TYR CE1 CZ doub Y N 392 TYR CE1 HE1 sing N N 393 TYR CE2 CZ sing Y N 394 TYR CE2 HE2 sing N N 395 TYR CZ OH sing N N 396 TYR OH HH sing N N 397 TYR OXT HXT sing N N 398 VAL N CA sing N N 399 VAL N H sing N N 400 VAL N H2 sing N N 401 VAL CA C sing N N 402 VAL CA CB sing N N 403 VAL CA HA sing N N 404 VAL C O doub N N 405 VAL C OXT sing N N 406 VAL CB CG1 sing N N 407 VAL CB CG2 sing N N 408 VAL CB HB sing N N 409 VAL CG1 HG11 sing N N 410 VAL CG1 HG12 sing N N 411 VAL CG1 HG13 sing N N 412 VAL CG2 HG21 sing N N 413 VAL CG2 HG22 sing N N 414 VAL CG2 HG23 sing N N 415 VAL OXT HXT sing N N 416 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id E47 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id E47 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '5-(4-morpholin-4-yl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-2-oxidanyl-benzaldehyde' _pdbx_entity_nonpoly.comp_id E47 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7FIC _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Superdex G200' # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 #