data_8JNG # _entry.id 8JNG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JNG pdb_00008jng 10.2210/pdb8jng/pdb WWPDB D_1300038333 ? ? EMDB EMD-33597 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details . _pdbx_database_related.db_id EMD-33597 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JNG _pdbx_database_status.recvd_initial_deposition_date 2023-06-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'You, X.' 1 ? 'Zhang, X.' 2 ? 'Cheng, J.' 3 ? 'Xiao, Y.N.' 4 ? 'Sun, S.' 5 ? 'Sui, S.F.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of lateral hexamer of PBS-PSII-PSI-LHCs megacomplex at 6.3 Angstroms resolution.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'You, X.' 1 ? primary 'Zhang, X.' 2 ? primary 'Cheng, J.' 3 ? primary 'Xiao, Y.N.' 4 ? primary 'Sun, S.' 5 ? primary 'Sui, S.F.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methanesulfonate monooxygenase ferredoxin subunit' 20734.240 1 ? ? ? ? 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAFVSAGGVGASRQNRAAGSWSGVQGAWAAAAPAAPVRARQNRRAAQIQMAKEAWVQLLPTSDISPGELKPVFAAGQSVV VACDYDGQVYASANICPHLGTPLDNGSVGDGNIVCAQHKSSWNLSTGELAGDWCPFPPLIGPLLGKLVTPSPLNVFSVRE NDGFIEALLDIDLKSDYESNYWVGLLDARGKASGEYF ; _entity_poly.pdbx_seq_one_letter_code_can ;MAFVSAGGVGASRQNRAAGSWSGVQGAWAAAAPAAPVRARQNRRAAQIQMAKEAWVQLLPTSDISPGELKPVFAAGQSVV VACDYDGQVYASANICPHLGTPLDNGSVGDGNIVCAQHKSSWNLSTGELAGDWCPFPPLIGPLLGKLVTPSPLNVFSVRE NDGFIEALLDIDLKSDYESNYWVGLLDARGKASGEYF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 PHE n 1 4 VAL n 1 5 SER n 1 6 ALA n 1 7 GLY n 1 8 GLY n 1 9 VAL n 1 10 GLY n 1 11 ALA n 1 12 SER n 1 13 ARG n 1 14 GLN n 1 15 ASN n 1 16 ARG n 1 17 ALA n 1 18 ALA n 1 19 GLY n 1 20 SER n 1 21 TRP n 1 22 SER n 1 23 GLY n 1 24 VAL n 1 25 GLN n 1 26 GLY n 1 27 ALA n 1 28 TRP n 1 29 ALA n 1 30 ALA n 1 31 ALA n 1 32 ALA n 1 33 PRO n 1 34 ALA n 1 35 ALA n 1 36 PRO n 1 37 VAL n 1 38 ARG n 1 39 ALA n 1 40 ARG n 1 41 GLN n 1 42 ASN n 1 43 ARG n 1 44 ARG n 1 45 ALA n 1 46 ALA n 1 47 GLN n 1 48 ILE n 1 49 GLN n 1 50 MET n 1 51 ALA n 1 52 LYS n 1 53 GLU n 1 54 ALA n 1 55 TRP n 1 56 VAL n 1 57 GLN n 1 58 LEU n 1 59 LEU n 1 60 PRO n 1 61 THR n 1 62 SER n 1 63 ASP n 1 64 ILE n 1 65 SER n 1 66 PRO n 1 67 GLY n 1 68 GLU n 1 69 LEU n 1 70 LYS n 1 71 PRO n 1 72 VAL n 1 73 PHE n 1 74 ALA n 1 75 ALA n 1 76 GLY n 1 77 GLN n 1 78 SER n 1 79 VAL n 1 80 VAL n 1 81 VAL n 1 82 ALA n 1 83 CYS n 1 84 ASP n 1 85 TYR n 1 86 ASP n 1 87 GLY n 1 88 GLN n 1 89 VAL n 1 90 TYR n 1 91 ALA n 1 92 SER n 1 93 ALA n 1 94 ASN n 1 95 ILE n 1 96 CYS n 1 97 PRO n 1 98 HIS n 1 99 LEU n 1 100 GLY n 1 101 THR n 1 102 PRO n 1 103 LEU n 1 104 ASP n 1 105 ASN n 1 106 GLY n 1 107 SER n 1 108 VAL n 1 109 GLY n 1 110 ASP n 1 111 GLY n 1 112 ASN n 1 113 ILE n 1 114 VAL n 1 115 CYS n 1 116 ALA n 1 117 GLN n 1 118 HIS n 1 119 LYS n 1 120 SER n 1 121 SER n 1 122 TRP n 1 123 ASN n 1 124 LEU n 1 125 SER n 1 126 THR n 1 127 GLY n 1 128 GLU n 1 129 LEU n 1 130 ALA n 1 131 GLY n 1 132 ASP n 1 133 TRP n 1 134 CYS n 1 135 PRO n 1 136 PHE n 1 137 PRO n 1 138 PRO n 1 139 LEU n 1 140 ILE n 1 141 GLY n 1 142 PRO n 1 143 LEU n 1 144 LEU n 1 145 GLY n 1 146 LYS n 1 147 LEU n 1 148 VAL n 1 149 THR n 1 150 PRO n 1 151 SER n 1 152 PRO n 1 153 LEU n 1 154 ASN n 1 155 VAL n 1 156 PHE n 1 157 SER n 1 158 VAL n 1 159 ARG n 1 160 GLU n 1 161 ASN n 1 162 ASP n 1 163 GLY n 1 164 PHE n 1 165 ILE n 1 166 GLU n 1 167 ALA n 1 168 LEU n 1 169 LEU n 1 170 ASP n 1 171 ILE n 1 172 ASP n 1 173 LEU n 1 174 LYS n 1 175 SER n 1 176 ASP n 1 177 TYR n 1 178 GLU n 1 179 SER n 1 180 ASN n 1 181 TYR n 1 182 TRP n 1 183 VAL n 1 184 GLY n 1 185 LEU n 1 186 LEU n 1 187 ASP n 1 188 ALA n 1 189 ARG n 1 190 GLY n 1 191 LYS n 1 192 ALA n 1 193 SER n 1 194 GLY n 1 195 GLU n 1 196 TYR n 1 197 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 197 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FVE85_7812 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Porphyridium purpureum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 35688 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Porphyridium purpureum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 35688 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5J4YIW4_PORPP _struct_ref.pdbx_db_accession A0A5J4YIW4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAFVSAGGVGASRQNRAAGSWSGVQGAWAAAAPAAPVRARQNRRAAQIQMAKEAWVQLLPTSDISPGELKPVFAAGQSVV VACDYDGQVYASANICPHLGTPLDNGSVGDGNIVCAQHKSSWNLSTGELAGDWCPFPPLIGPLLGKLVTPSPLNVFSVRE NDGFIEALLDIDLKSDYESNYWVGLLDARGKASGEYF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JNG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5J4YIW4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 197 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JNG _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 8JNG _struct.title 'Methanesulfonate monooxygenase ferredoxin subunit of PBS-PSII-PSI-LHCs from Porphyridium purpureum.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JNG _struct_keywords.text 'Methanesulfonate monooxygenase ferredoxin subunit, PHOTOSYNTHESIS' _struct_keywords.pdbx_keywords PHOTOSYNTHESIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 140 ? LYS A 146 ? ILE A 140 LYS A 146 1 ? 7 HELX_P HELX_P2 AA2 ASP A 172 ? GLU A 178 ? ASP A 172 GLU A 178 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 98 ND1 ? ? ? 1_555 B FES . FE2 ? ? A HIS 98 A FES 201 1_555 ? ? ? ? ? ? ? 2.016 ? ? metalc2 metalc ? ? A HIS 118 ND1 ? ? ? 1_555 B FES . FE2 ? ? A HIS 118 A FES 201 1_555 ? ? ? ? ? ? ? 2.797 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 53 ? PRO A 60 ? GLU A 53 PRO A 60 AA1 2 PHE A 164 ? ASP A 170 ? PHE A 164 ASP A 170 AA1 3 VAL A 158 ? ASN A 161 ? VAL A 158 ASN A 161 AA2 1 GLU A 68 ? ALA A 74 ? GLU A 68 ALA A 74 AA2 2 GLN A 77 ? CYS A 83 ? GLN A 77 CYS A 83 AA2 3 VAL A 89 ? ALA A 93 ? VAL A 89 ALA A 93 AA2 4 VAL A 155 ? PHE A 156 ? VAL A 155 PHE A 156 AA3 1 SER A 107 ? GLY A 109 ? SER A 107 GLY A 109 AA3 2 ASN A 112 ? VAL A 114 ? ASN A 112 VAL A 114 AA3 3 SER A 121 ? ASN A 123 ? SER A 121 ASN A 123 AA3 4 LEU A 129 ? ALA A 130 ? LEU A 129 ALA A 130 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 59 ? N LEU A 59 O ILE A 165 ? O ILE A 165 AA1 2 3 O GLU A 166 ? O GLU A 166 N ARG A 159 ? N ARG A 159 AA2 1 2 N VAL A 72 ? N VAL A 72 O VAL A 79 ? O VAL A 79 AA2 2 3 N ALA A 82 ? N ALA A 82 O TYR A 90 ? O TYR A 90 AA2 3 4 N ALA A 91 ? N ALA A 91 O PHE A 156 ? O PHE A 156 AA3 1 2 N GLY A 109 ? N GLY A 109 O ASN A 112 ? O ASN A 112 AA3 2 3 N ILE A 113 ? N ILE A 113 O TRP A 122 ? O TRP A 122 AA3 3 4 N SER A 121 ? N SER A 121 O ALA A 130 ? O ALA A 130 # _atom_sites.entry_id 8JNG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 ARG 13 13 ? ? ? A . n A 1 14 GLN 14 14 ? ? ? A . n A 1 15 ASN 15 15 ? ? ? A . n A 1 16 ARG 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 GLY 19 19 ? ? ? A . n A 1 20 SER 20 20 ? ? ? A . n A 1 21 TRP 21 21 ? ? ? A . n A 1 22 SER 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 VAL 24 24 ? ? ? A . n A 1 25 GLN 25 25 ? ? ? A . n A 1 26 GLY 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 TRP 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 ALA 31 31 ? ? ? A . n A 1 32 ALA 32 32 ? ? ? A . n A 1 33 PRO 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 ALA 35 35 ? ? ? A . n A 1 36 PRO 36 36 ? ? ? A . n A 1 37 VAL 37 37 ? ? ? A . n A 1 38 ARG 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 ARG 40 40 ? ? ? A . n A 1 41 GLN 41 41 ? ? ? A . n A 1 42 ASN 42 42 ? ? ? A . n A 1 43 ARG 43 43 ? ? ? A . n A 1 44 ARG 44 44 ? ? ? A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 ALA 46 46 ? ? ? A . n A 1 47 GLN 47 47 ? ? ? A . n A 1 48 ILE 48 48 ? ? ? A . n A 1 49 GLN 49 49 ? ? ? A . n A 1 50 MET 50 50 ? ? ? A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 TRP 122 122 122 TRP TRP A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 PHE 197 197 197 PHE PHE A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email youxin0927@126.com _pdbx_contact_author.name_first Xin _pdbx_contact_author.name_last You _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9181-8646 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FES _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id FES _pdbx_nonpoly_scheme.auth_mon_id FES _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 98 ? A HIS 98 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 S1 ? B FES . ? A FES 201 ? 1_555 45.4 ? 2 ND1 ? A HIS 98 ? A HIS 98 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 S2 ? B FES . ? A FES 201 ? 1_555 129.5 ? 3 S1 ? B FES . ? A FES 201 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 S2 ? B FES . ? A FES 201 ? 1_555 89.3 ? 4 ND1 ? A HIS 98 ? A HIS 98 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 ND1 ? A HIS 118 ? A HIS 118 ? 1_555 120.3 ? 5 S1 ? B FES . ? A FES 201 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 ND1 ? A HIS 118 ? A HIS 118 ? 1_555 92.7 ? 6 S2 ? B FES . ? A FES 201 ? 1_555 FE2 ? B FES . ? A FES 201 ? 1_555 ND1 ? A HIS 118 ? A HIS 118 ? 1_555 73.7 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_entry_details.entry_id 8JNG _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8JNG _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 8JNG _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 3.2 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 762000 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.6 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type CELL _em_entity_assembly.name 'Methanesulfonate monooxygenase ferredoxin subunit from Porphyridium purpureum.' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8JNG _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'SPOT SCAN' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_defocus_max 6000 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? # _em_vitrification.entry_id 8JNG _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8JNG _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state CELL _em_experiment.entity_assembly_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ND1 A HIS 98 ? ? S1 A FES 201 ? ? 1.63 2 1 NH2 A ARG 189 ? ? OE1 A GLU 195 ? ? 1.97 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 57 ? ? -68.56 93.09 2 1 PRO A 137 ? ? -32.97 121.54 3 1 LEU A 139 ? ? 63.19 -0.88 4 1 ASP A 187 ? ? 80.71 16.74 5 1 ALA A 188 ? ? -158.62 -126.75 6 1 ARG A 189 ? ? 47.91 23.01 7 1 GLU A 195 ? ? 46.75 -138.50 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 136 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PRO _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 137 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -111.11 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A ARG 13 ? A ARG 13 14 1 Y 1 A GLN 14 ? A GLN 14 15 1 Y 1 A ASN 15 ? A ASN 15 16 1 Y 1 A ARG 16 ? A ARG 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A GLY 19 ? A GLY 19 20 1 Y 1 A SER 20 ? A SER 20 21 1 Y 1 A TRP 21 ? A TRP 21 22 1 Y 1 A SER 22 ? A SER 22 23 1 Y 1 A GLY 23 ? A GLY 23 24 1 Y 1 A VAL 24 ? A VAL 24 25 1 Y 1 A GLN 25 ? A GLN 25 26 1 Y 1 A GLY 26 ? A GLY 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A TRP 28 ? A TRP 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A ALA 31 ? A ALA 31 32 1 Y 1 A ALA 32 ? A ALA 32 33 1 Y 1 A PRO 33 ? A PRO 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A ALA 35 ? A ALA 35 36 1 Y 1 A PRO 36 ? A PRO 36 37 1 Y 1 A VAL 37 ? A VAL 37 38 1 Y 1 A ARG 38 ? A ARG 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A ARG 40 ? A ARG 40 41 1 Y 1 A GLN 41 ? A GLN 41 42 1 Y 1 A ASN 42 ? A ASN 42 43 1 Y 1 A ARG 43 ? A ARG 43 44 1 Y 1 A ARG 44 ? A ARG 44 45 1 Y 1 A ALA 45 ? A ALA 45 46 1 Y 1 A ALA 46 ? A ALA 46 47 1 Y 1 A GLN 47 ? A GLN 47 48 1 Y 1 A ILE 48 ? A ILE 48 49 1 Y 1 A GLN 49 ? A GLN 49 50 1 Y 1 A MET 50 ? A MET 50 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 35688 _em_entity_assembly_naturalsource.organism 'Porphyridium purpureum' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 35 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? ? ? ? ? 'MODEL REFINEMENT' ? 8 ? ? ? ? ? OTHER ? 9 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? RECONSTRUCTION ? 13 1 ? ? ? ? 'VOLUME SELECTION' ? 14 1 1 1 ? ? 'SERIES ALIGNMENT' ? 15 1 1 1 ? ? 'MOLECULAR REPLACEMENT' ? 16 1 1 1 ? ? 'LATTICE DISTORTION CORRECTION' ? 17 1 1 1 ? ? 'SYMMETRY DETERMINATION' ? 18 1 1 1 ? ? 'CRYSTALLOGRAPHY MERGING' ? 19 1 1 1 ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FES _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FES _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE2/S2 (INORGANIC) CLUSTER' _pdbx_entity_nonpoly.comp_id FES # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' #