data_8JNM # _entry.id 8JNM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JNM pdb_00008jnm 10.2210/pdb8jnm/pdb WWPDB D_1300038338 ? ? EMDB EMD-33597 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details . _pdbx_database_related.db_id EMD-33597 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JNM _pdbx_database_status.recvd_initial_deposition_date 2023-06-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'You, X.' 1 ? 'Zhang, X.' 2 ? 'Cheng, J.' 3 ? 'Xiao, Y.N.' 4 ? 'Sun, S.' 5 ? 'Sui, S.F.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of lateral hexamer of PBS-PSII-PSI-LHCs megacomplex at 6.3 Angstroms resolution.' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'You, X.' 1 ? primary 'Zhang, X.' 2 ? primary 'Cheng, J.' 3 ? primary 'Xiao, Y.N.' 4 ? primary 'Sun, S.' 5 ? primary 'Sui, S.F.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description PsbW _entity.formula_weight 11316.226 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAFVSGSFGPASALVAQPKRAVSAQRRGVVAMSAAGKKAQQMAALAVAQVAVAMPALAAEGTGAALGVEEPLLFLPLILI PSVFFILFLGFSNKQPKDDFFGAKDDRRN ; _entity_poly.pdbx_seq_one_letter_code_can ;MAFVSGSFGPASALVAQPKRAVSAQRRGVVAMSAAGKKAQQMAALAVAQVAVAMPALAAEGTGAALGVEEPLLFLPLILI PSVFFILFLGFSNKQPKDDFFGAKDDRRN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 PHE n 1 4 VAL n 1 5 SER n 1 6 GLY n 1 7 SER n 1 8 PHE n 1 9 GLY n 1 10 PRO n 1 11 ALA n 1 12 SER n 1 13 ALA n 1 14 LEU n 1 15 VAL n 1 16 ALA n 1 17 GLN n 1 18 PRO n 1 19 LYS n 1 20 ARG n 1 21 ALA n 1 22 VAL n 1 23 SER n 1 24 ALA n 1 25 GLN n 1 26 ARG n 1 27 ARG n 1 28 GLY n 1 29 VAL n 1 30 VAL n 1 31 ALA n 1 32 MET n 1 33 SER n 1 34 ALA n 1 35 ALA n 1 36 GLY n 1 37 LYS n 1 38 LYS n 1 39 ALA n 1 40 GLN n 1 41 GLN n 1 42 MET n 1 43 ALA n 1 44 ALA n 1 45 LEU n 1 46 ALA n 1 47 VAL n 1 48 ALA n 1 49 GLN n 1 50 VAL n 1 51 ALA n 1 52 VAL n 1 53 ALA n 1 54 MET n 1 55 PRO n 1 56 ALA n 1 57 LEU n 1 58 ALA n 1 59 ALA n 1 60 GLU n 1 61 GLY n 1 62 THR n 1 63 GLY n 1 64 ALA n 1 65 ALA n 1 66 LEU n 1 67 GLY n 1 68 VAL n 1 69 GLU n 1 70 GLU n 1 71 PRO n 1 72 LEU n 1 73 LEU n 1 74 PHE n 1 75 LEU n 1 76 PRO n 1 77 LEU n 1 78 ILE n 1 79 LEU n 1 80 ILE n 1 81 PRO n 1 82 SER n 1 83 VAL n 1 84 PHE n 1 85 PHE n 1 86 ILE n 1 87 LEU n 1 88 PHE n 1 89 LEU n 1 90 GLY n 1 91 PHE n 1 92 SER n 1 93 ASN n 1 94 LYS n 1 95 GLN n 1 96 PRO n 1 97 LYS n 1 98 ASP n 1 99 ASP n 1 100 PHE n 1 101 PHE n 1 102 GLY n 1 103 ALA n 1 104 LYS n 1 105 ASP n 1 106 ASP n 1 107 ARG n 1 108 ARG n 1 109 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FVE85_7594 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Porphyridium purpureum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 35688 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Porphyridium purpureum' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 35688 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5J4Z7J1_PORPP _struct_ref.pdbx_db_accession A0A5J4Z7J1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAFVSGSFGPASALVAQPKRAVSAQRRGVVAMSAAGKKAQQMAALAVAQVAVAMPALAAEGTGAALGVEEPLLFLPLILI PSVFFILFLGFSNKQPKDDFFGAKDDRRN ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JNM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5J4Z7J1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JNM _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 8JNM _struct.title 'PsbW from red algal Porphyridium purpureum.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JNM _struct_keywords.text 'Psb34, PHOTOSYNTHESIS' _struct_keywords.pdbx_keywords PHOTOSYNTHESIS # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 64 ? VAL A 68 ? ALA A 64 VAL A 68 5 ? 5 HELX_P HELX_P2 AA2 GLU A 70 ? LEU A 73 ? GLU A 70 LEU A 73 5 ? 4 HELX_P HELX_P3 AA3 PHE A 74 ? LEU A 79 ? PHE A 74 LEU A 79 1 ? 6 HELX_P HELX_P4 AA4 LEU A 79 ? ASN A 93 ? LEU A 79 ASN A 93 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8JNM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PHE 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 PHE 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 PRO 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 GLN 17 17 ? ? ? A . n A 1 18 PRO 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 ARG 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 VAL 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 GLN 25 25 ? ? ? A . n A 1 26 ARG 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 VAL 29 29 ? ? ? A . n A 1 30 VAL 30 30 ? ? ? A . n A 1 31 ALA 31 31 ? ? ? A . n A 1 32 MET 32 32 ? ? ? A . n A 1 33 SER 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 ALA 35 35 ? ? ? A . n A 1 36 GLY 36 36 ? ? ? A . n A 1 37 LYS 37 37 ? ? ? A . n A 1 38 LYS 38 38 ? ? ? A . n A 1 39 ALA 39 39 ? ? ? A . n A 1 40 GLN 40 40 ? ? ? A . n A 1 41 GLN 41 41 ? ? ? A . n A 1 42 MET 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 ALA 44 44 ? ? ? A . n A 1 45 LEU 45 45 ? ? ? A . n A 1 46 ALA 46 46 ? ? ? A . n A 1 47 VAL 47 47 ? ? ? A . n A 1 48 ALA 48 48 ? ? ? A . n A 1 49 GLN 49 49 ? ? ? A . n A 1 50 VAL 50 50 ? ? ? A . n A 1 51 ALA 51 51 ? ? ? A . n A 1 52 VAL 52 52 ? ? ? A . n A 1 53 ALA 53 53 ? ? ? A . n A 1 54 MET 54 54 ? ? ? A . n A 1 55 PRO 55 55 ? ? ? A . n A 1 56 ALA 56 56 ? ? ? A . n A 1 57 LEU 57 57 ? ? ? A . n A 1 58 ALA 58 58 ? ? ? A . n A 1 59 ALA 59 59 ? ? ? A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ASN 109 109 109 ASN ASN A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email youxin0927@126.com _pdbx_contact_author.name_first Xin _pdbx_contact_author.name_last You _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9181-8646 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8JNM _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 8JNM _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 3.2 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 762000 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.6 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type CELL _em_entity_assembly.name 'PSII subunit PsbW from Porphyridium purpureum.' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8JNM _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'SPOT SCAN' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_defocus_max 6000 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? # _em_vitrification.entry_id 8JNM _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8JNM _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state CELL _em_experiment.entity_assembly_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 105 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 107 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.04 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A PHE 3 ? A PHE 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A PHE 8 ? A PHE 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A PRO 10 ? A PRO 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A GLN 17 ? A GLN 17 18 1 Y 1 A PRO 18 ? A PRO 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A ARG 20 ? A ARG 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A VAL 22 ? A VAL 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A GLN 25 ? A GLN 25 26 1 Y 1 A ARG 26 ? A ARG 26 27 1 Y 1 A ARG 27 ? A ARG 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A VAL 29 ? A VAL 29 30 1 Y 1 A VAL 30 ? A VAL 30 31 1 Y 1 A ALA 31 ? A ALA 31 32 1 Y 1 A MET 32 ? A MET 32 33 1 Y 1 A SER 33 ? A SER 33 34 1 Y 1 A ALA 34 ? A ALA 34 35 1 Y 1 A ALA 35 ? A ALA 35 36 1 Y 1 A GLY 36 ? A GLY 36 37 1 Y 1 A LYS 37 ? A LYS 37 38 1 Y 1 A LYS 38 ? A LYS 38 39 1 Y 1 A ALA 39 ? A ALA 39 40 1 Y 1 A GLN 40 ? A GLN 40 41 1 Y 1 A GLN 41 ? A GLN 41 42 1 Y 1 A MET 42 ? A MET 42 43 1 Y 1 A ALA 43 ? A ALA 43 44 1 Y 1 A ALA 44 ? A ALA 44 45 1 Y 1 A LEU 45 ? A LEU 45 46 1 Y 1 A ALA 46 ? A ALA 46 47 1 Y 1 A VAL 47 ? A VAL 47 48 1 Y 1 A ALA 48 ? A ALA 48 49 1 Y 1 A GLN 49 ? A GLN 49 50 1 Y 1 A VAL 50 ? A VAL 50 51 1 Y 1 A ALA 51 ? A ALA 51 52 1 Y 1 A VAL 52 ? A VAL 52 53 1 Y 1 A ALA 53 ? A ALA 53 54 1 Y 1 A MET 54 ? A MET 54 55 1 Y 1 A PRO 55 ? A PRO 55 56 1 Y 1 A ALA 56 ? A ALA 56 57 1 Y 1 A LEU 57 ? A LEU 57 58 1 Y 1 A ALA 58 ? A ALA 58 59 1 Y 1 A ALA 59 ? A ALA 59 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING ONLY' # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 35688 _em_entity_assembly_naturalsource.organism 'Porphyridium purpureum' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 35 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? ? ? ? ? 'MODEL REFINEMENT' ? 8 ? ? ? ? ? OTHER ? 9 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? RECONSTRUCTION ? 13 1 ? ? ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' #