data_8JYV # _entry.id 8JYV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JYV pdb_00008jyv 10.2210/pdb8jyv/pdb WWPDB D_1300039060 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-01 2 'Structure model' 1 1 2024-05-08 3 'Structure model' 1 2 2024-05-15 4 'Structure model' 1 3 2024-05-29 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' citation 6 5 'Structure model' pdbx_entry_details 7 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_citation_author.identifier_ORCID' 7 4 'Structure model' '_citation.journal_volume' 8 4 'Structure model' '_citation.page_first' 9 4 'Structure model' '_citation.page_last' 10 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JYV _pdbx_database_status.recvd_initial_deposition_date 2023-07-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email jding@ibp.ac.cn _pdbx_contact_author.name_first Jingjin _pdbx_contact_author.name_last Ding _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9941-7997 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zeng, H.' 1 ? 'Hou, Y.J.' 2 0000-0002-5234-9277 'Ding, J.' 3 0000-0001-9941-7997 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 384 _citation.language ? _citation.page_first adm9190 _citation.page_last adm9190 _citation.title 'Cleavage-independent activation of ancient eukaryotic gasdermins and structural mechanisms.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.adm9190 _citation.pdbx_database_id_PubMed 38662913 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.' 1 0009-0005-7886-2051 primary 'Hou, Y.' 2 0000-0002-5234-9277 primary 'Sun, Q.' 3 0009-0004-1515-1239 primary 'Zeng, H.' 4 ? primary 'Meng, F.' 5 ? primary 'Tian, X.' 6 ? primary 'He, Q.' 7 ? primary 'Shao, F.' 8 0000-0002-9562-7791 primary 'Ding, J.' 9 0000-0001-9941-7997 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gasdermin pore forming domain-containing protein' 26246.662 1 ? ? ? ? 2 water nat water 18.015 92 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SGRP(MSE)FAVAVNEFIRSAGQDSLCGVPDINSSGDF(MSE)PLHIIVKEVPKVLPCCRRPKIKRTPYTLNDILDEPCP NQLKSSDLVTFTEPLVSNVKASSSIGLQILKHFDSGAKGSKNFITSASLGTVVKAETIDITKVLAKVRTAKAKVENDLVS RV(MSE)KTKRLCLGLVVETACVAAAGKLTEADNWEISGHTNANIGEAVVTATAELDKNLSRKIEIPPGTALAYSF (MSE)DLEILEDRSLRVSSSAGA ; _entity_poly.pdbx_seq_one_letter_code_can ;SGRPMFAVAVNEFIRSAGQDSLCGVPDINSSGDFMPLHIIVKEVPKVLPCCRRPKIKRTPYTLNDILDEPCPNQLKSSDL VTFTEPLVSNVKASSSIGLQILKHFDSGAKGSKNFITSASLGTVVKAETIDITKVLAKVRTAKAKVENDLVSRVMKTKRL CLGLVVETACVAAAGKLTEADNWEISGHTNANIGEAVVTATAELDKNLSRKIEIPPGTALAYSFMDLEILEDRSLRVSSS AGA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 ARG n 1 4 PRO n 1 5 MSE n 1 6 PHE n 1 7 ALA n 1 8 VAL n 1 9 ALA n 1 10 VAL n 1 11 ASN n 1 12 GLU n 1 13 PHE n 1 14 ILE n 1 15 ARG n 1 16 SER n 1 17 ALA n 1 18 GLY n 1 19 GLN n 1 20 ASP n 1 21 SER n 1 22 LEU n 1 23 CYS n 1 24 GLY n 1 25 VAL n 1 26 PRO n 1 27 ASP n 1 28 ILE n 1 29 ASN n 1 30 SER n 1 31 SER n 1 32 GLY n 1 33 ASP n 1 34 PHE n 1 35 MSE n 1 36 PRO n 1 37 LEU n 1 38 HIS n 1 39 ILE n 1 40 ILE n 1 41 VAL n 1 42 LYS n 1 43 GLU n 1 44 VAL n 1 45 PRO n 1 46 LYS n 1 47 VAL n 1 48 LEU n 1 49 PRO n 1 50 CYS n 1 51 CYS n 1 52 ARG n 1 53 ARG n 1 54 PRO n 1 55 LYS n 1 56 ILE n 1 57 LYS n 1 58 ARG n 1 59 THR n 1 60 PRO n 1 61 TYR n 1 62 THR n 1 63 LEU n 1 64 ASN n 1 65 ASP n 1 66 ILE n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 PRO n 1 71 CYS n 1 72 PRO n 1 73 ASN n 1 74 GLN n 1 75 LEU n 1 76 LYS n 1 77 SER n 1 78 SER n 1 79 ASP n 1 80 LEU n 1 81 VAL n 1 82 THR n 1 83 PHE n 1 84 THR n 1 85 GLU n 1 86 PRO n 1 87 LEU n 1 88 VAL n 1 89 SER n 1 90 ASN n 1 91 VAL n 1 92 LYS n 1 93 ALA n 1 94 SER n 1 95 SER n 1 96 SER n 1 97 ILE n 1 98 GLY n 1 99 LEU n 1 100 GLN n 1 101 ILE n 1 102 LEU n 1 103 LYS n 1 104 HIS n 1 105 PHE n 1 106 ASP n 1 107 SER n 1 108 GLY n 1 109 ALA n 1 110 LYS n 1 111 GLY n 1 112 SER n 1 113 LYS n 1 114 ASN n 1 115 PHE n 1 116 ILE n 1 117 THR n 1 118 SER n 1 119 ALA n 1 120 SER n 1 121 LEU n 1 122 GLY n 1 123 THR n 1 124 VAL n 1 125 VAL n 1 126 LYS n 1 127 ALA n 1 128 GLU n 1 129 THR n 1 130 ILE n 1 131 ASP n 1 132 ILE n 1 133 THR n 1 134 LYS n 1 135 VAL n 1 136 LEU n 1 137 ALA n 1 138 LYS n 1 139 VAL n 1 140 ARG n 1 141 THR n 1 142 ALA n 1 143 LYS n 1 144 ALA n 1 145 LYS n 1 146 VAL n 1 147 GLU n 1 148 ASN n 1 149 ASP n 1 150 LEU n 1 151 VAL n 1 152 SER n 1 153 ARG n 1 154 VAL n 1 155 MSE n 1 156 LYS n 1 157 THR n 1 158 LYS n 1 159 ARG n 1 160 LEU n 1 161 CYS n 1 162 LEU n 1 163 GLY n 1 164 LEU n 1 165 VAL n 1 166 VAL n 1 167 GLU n 1 168 THR n 1 169 ALA n 1 170 CYS n 1 171 VAL n 1 172 ALA n 1 173 ALA n 1 174 ALA n 1 175 GLY n 1 176 LYS n 1 177 LEU n 1 178 THR n 1 179 GLU n 1 180 ALA n 1 181 ASP n 1 182 ASN n 1 183 TRP n 1 184 GLU n 1 185 ILE n 1 186 SER n 1 187 GLY n 1 188 HIS n 1 189 THR n 1 190 ASN n 1 191 ALA n 1 192 ASN n 1 193 ILE n 1 194 GLY n 1 195 GLU n 1 196 ALA n 1 197 VAL n 1 198 VAL n 1 199 THR n 1 200 ALA n 1 201 THR n 1 202 ALA n 1 203 GLU n 1 204 LEU n 1 205 ASP n 1 206 LYS n 1 207 ASN n 1 208 LEU n 1 209 SER n 1 210 ARG n 1 211 LYS n 1 212 ILE n 1 213 GLU n 1 214 ILE n 1 215 PRO n 1 216 PRO n 1 217 GLY n 1 218 THR n 1 219 ALA n 1 220 LEU n 1 221 ALA n 1 222 TYR n 1 223 SER n 1 224 PHE n 1 225 MSE n 1 226 ASP n 1 227 LEU n 1 228 GLU n 1 229 ILE n 1 230 LEU n 1 231 GLU n 1 232 ASP n 1 233 ARG n 1 234 SER n 1 235 LEU n 1 236 ARG n 1 237 VAL n 1 238 SER n 1 239 SER n 1 240 SER n 1 241 ALA n 1 242 GLY n 1 243 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 243 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TRIADDRAFT_52857 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trichoplax adhaerens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10228 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -3 ? ? ? A . n A 1 2 GLY 2 -2 -2 GLY GLY A . n A 1 3 ARG 3 -1 -1 ARG ARG A . n A 1 4 PRO 4 0 0 PRO PRO A . n A 1 5 MSE 5 1 1 MSE MSE A . n A 1 6 PHE 6 2 2 PHE PHE A . n A 1 7 ALA 7 3 3 ALA ALA A . n A 1 8 VAL 8 4 4 VAL VAL A . n A 1 9 ALA 9 5 5 ALA ALA A . n A 1 10 VAL 10 6 6 VAL VAL A . n A 1 11 ASN 11 7 7 ASN ASN A . n A 1 12 GLU 12 8 8 GLU GLU A . n A 1 13 PHE 13 9 9 PHE PHE A . n A 1 14 ILE 14 10 10 ILE ILE A . n A 1 15 ARG 15 11 11 ARG ARG A . n A 1 16 SER 16 12 12 SER SER A . n A 1 17 ALA 17 13 13 ALA ALA A . n A 1 18 GLY 18 14 14 GLY GLY A . n A 1 19 GLN 19 15 15 GLN GLN A . n A 1 20 ASP 20 16 16 ASP ASP A . n A 1 21 SER 21 17 17 SER SER A . n A 1 22 LEU 22 18 18 LEU LEU A . n A 1 23 CYS 23 19 19 CYS CYS A . n A 1 24 GLY 24 20 20 GLY GLY A . n A 1 25 VAL 25 21 21 VAL VAL A . n A 1 26 PRO 26 22 22 PRO PRO A . n A 1 27 ASP 27 23 23 ASP ASP A . n A 1 28 ILE 28 24 24 ILE ILE A . n A 1 29 ASN 29 25 25 ASN ASN A . n A 1 30 SER 30 26 26 SER SER A . n A 1 31 SER 31 27 27 SER SER A . n A 1 32 GLY 32 28 28 GLY GLY A . n A 1 33 ASP 33 29 29 ASP ASP A . n A 1 34 PHE 34 30 30 PHE PHE A . n A 1 35 MSE 35 31 31 MSE MSE A . n A 1 36 PRO 36 32 32 PRO PRO A . n A 1 37 LEU 37 33 33 LEU LEU A . n A 1 38 HIS 38 34 34 HIS HIS A . n A 1 39 ILE 39 35 35 ILE ILE A . n A 1 40 ILE 40 36 36 ILE ILE A . n A 1 41 VAL 41 37 37 VAL VAL A . n A 1 42 LYS 42 38 38 LYS LYS A . n A 1 43 GLU 43 39 39 GLU GLU A . n A 1 44 VAL 44 40 40 VAL VAL A . n A 1 45 PRO 45 41 41 PRO PRO A . n A 1 46 LYS 46 42 42 LYS LYS A . n A 1 47 VAL 47 43 43 VAL VAL A . n A 1 48 LEU 48 44 44 LEU LEU A . n A 1 49 PRO 49 45 45 PRO PRO A . n A 1 50 CYS 50 46 46 CYS CYS A . n A 1 51 CYS 51 47 47 CYS CYS A . n A 1 52 ARG 52 48 48 ARG ARG A . n A 1 53 ARG 53 49 49 ARG ARG A . n A 1 54 PRO 54 50 50 PRO PRO A . n A 1 55 LYS 55 51 51 LYS LYS A . n A 1 56 ILE 56 52 52 ILE ILE A . n A 1 57 LYS 57 53 53 LYS LYS A . n A 1 58 ARG 58 54 54 ARG ARG A . n A 1 59 THR 59 55 55 THR THR A . n A 1 60 PRO 60 56 56 PRO PRO A . n A 1 61 TYR 61 57 57 TYR TYR A . n A 1 62 THR 62 58 58 THR THR A . n A 1 63 LEU 63 59 59 LEU LEU A . n A 1 64 ASN 64 60 60 ASN ASN A . n A 1 65 ASP 65 61 61 ASP ASP A . n A 1 66 ILE 66 62 62 ILE ILE A . n A 1 67 LEU 67 63 63 LEU LEU A . n A 1 68 ASP 68 64 64 ASP ASP A . n A 1 69 GLU 69 65 65 GLU GLU A . n A 1 70 PRO 70 66 66 PRO PRO A . n A 1 71 CYS 71 67 67 CYS CYS A . n A 1 72 PRO 72 68 68 PRO PRO A . n A 1 73 ASN 73 69 69 ASN ASN A . n A 1 74 GLN 74 70 70 GLN GLN A . n A 1 75 LEU 75 71 71 LEU LEU A . n A 1 76 LYS 76 72 72 LYS LYS A . n A 1 77 SER 77 73 73 SER SER A . n A 1 78 SER 78 74 74 SER SER A . n A 1 79 ASP 79 75 75 ASP ASP A . n A 1 80 LEU 80 76 76 LEU LEU A . n A 1 81 VAL 81 77 77 VAL VAL A . n A 1 82 THR 82 78 78 THR THR A . n A 1 83 PHE 83 79 79 PHE PHE A . n A 1 84 THR 84 80 80 THR THR A . n A 1 85 GLU 85 81 81 GLU GLU A . n A 1 86 PRO 86 82 82 PRO PRO A . n A 1 87 LEU 87 83 83 LEU LEU A . n A 1 88 VAL 88 84 84 VAL VAL A . n A 1 89 SER 89 85 85 SER SER A . n A 1 90 ASN 90 86 86 ASN ASN A . n A 1 91 VAL 91 87 87 VAL VAL A . n A 1 92 LYS 92 88 88 LYS LYS A . n A 1 93 ALA 93 89 89 ALA ALA A . n A 1 94 SER 94 90 90 SER SER A . n A 1 95 SER 95 91 91 SER SER A . n A 1 96 SER 96 92 92 SER SER A . n A 1 97 ILE 97 93 93 ILE ILE A . n A 1 98 GLY 98 94 94 GLY GLY A . n A 1 99 LEU 99 95 95 LEU LEU A . n A 1 100 GLN 100 96 96 GLN GLN A . n A 1 101 ILE 101 97 97 ILE ILE A . n A 1 102 LEU 102 98 98 LEU LEU A . n A 1 103 LYS 103 99 99 LYS LYS A . n A 1 104 HIS 104 100 100 HIS HIS A . n A 1 105 PHE 105 101 101 PHE PHE A . n A 1 106 ASP 106 102 102 ASP ASP A . n A 1 107 SER 107 103 103 SER SER A . n A 1 108 GLY 108 104 104 GLY GLY A . n A 1 109 ALA 109 105 105 ALA ALA A . n A 1 110 LYS 110 106 106 LYS LYS A . n A 1 111 GLY 111 107 107 GLY GLY A . n A 1 112 SER 112 108 108 SER SER A . n A 1 113 LYS 113 109 109 LYS LYS A . n A 1 114 ASN 114 110 110 ASN ASN A . n A 1 115 PHE 115 111 111 PHE PHE A . n A 1 116 ILE 116 112 112 ILE ILE A . n A 1 117 THR 117 113 113 THR THR A . n A 1 118 SER 118 114 114 SER SER A . n A 1 119 ALA 119 115 115 ALA ALA A . n A 1 120 SER 120 116 116 SER SER A . n A 1 121 LEU 121 117 117 LEU LEU A . n A 1 122 GLY 122 118 118 GLY GLY A . n A 1 123 THR 123 119 119 THR THR A . n A 1 124 VAL 124 120 120 VAL VAL A . n A 1 125 VAL 125 121 121 VAL VAL A . n A 1 126 LYS 126 122 122 LYS LYS A . n A 1 127 ALA 127 123 123 ALA ALA A . n A 1 128 GLU 128 124 124 GLU GLU A . n A 1 129 THR 129 125 125 THR THR A . n A 1 130 ILE 130 126 126 ILE ILE A . n A 1 131 ASP 131 127 127 ASP ASP A . n A 1 132 ILE 132 128 128 ILE ILE A . n A 1 133 THR 133 129 129 THR THR A . n A 1 134 LYS 134 130 130 LYS LYS A . n A 1 135 VAL 135 131 131 VAL VAL A . n A 1 136 LEU 136 132 132 LEU LEU A . n A 1 137 ALA 137 133 133 ALA ALA A . n A 1 138 LYS 138 134 134 LYS LYS A . n A 1 139 VAL 139 135 135 VAL VAL A . n A 1 140 ARG 140 136 136 ARG ARG A . n A 1 141 THR 141 137 137 THR THR A . n A 1 142 ALA 142 138 138 ALA ALA A . n A 1 143 LYS 143 139 139 LYS LYS A . n A 1 144 ALA 144 140 140 ALA ALA A . n A 1 145 LYS 145 141 141 LYS LYS A . n A 1 146 VAL 146 142 142 VAL VAL A . n A 1 147 GLU 147 143 143 GLU GLU A . n A 1 148 ASN 148 144 144 ASN ASN A . n A 1 149 ASP 149 145 145 ASP ASP A . n A 1 150 LEU 150 146 146 LEU LEU A . n A 1 151 VAL 151 147 147 VAL VAL A . n A 1 152 SER 152 148 148 SER SER A . n A 1 153 ARG 153 149 149 ARG ARG A . n A 1 154 VAL 154 150 150 VAL VAL A . n A 1 155 MSE 155 151 151 MSE MSE A . n A 1 156 LYS 156 152 152 LYS LYS A . n A 1 157 THR 157 153 153 THR THR A . n A 1 158 LYS 158 154 154 LYS LYS A . n A 1 159 ARG 159 155 155 ARG ARG A . n A 1 160 LEU 160 156 156 LEU LEU A . n A 1 161 CYS 161 157 157 CYS CYS A . n A 1 162 LEU 162 158 158 LEU LEU A . n A 1 163 GLY 163 159 159 GLY GLY A . n A 1 164 LEU 164 160 160 LEU LEU A . n A 1 165 VAL 165 161 161 VAL VAL A . n A 1 166 VAL 166 162 162 VAL VAL A . n A 1 167 GLU 167 163 163 GLU GLU A . n A 1 168 THR 168 164 164 THR THR A . n A 1 169 ALA 169 165 165 ALA ALA A . n A 1 170 CYS 170 166 166 CYS CYS A . n A 1 171 VAL 171 167 167 VAL VAL A . n A 1 172 ALA 172 168 168 ALA ALA A . n A 1 173 ALA 173 169 169 ALA ALA A . n A 1 174 ALA 174 170 170 ALA ALA A . n A 1 175 GLY 175 171 171 GLY GLY A . n A 1 176 LYS 176 172 172 LYS LYS A . n A 1 177 LEU 177 173 173 LEU LEU A . n A 1 178 THR 178 174 174 THR THR A . n A 1 179 GLU 179 175 175 GLU GLU A . n A 1 180 ALA 180 176 176 ALA ALA A . n A 1 181 ASP 181 177 177 ASP ASP A . n A 1 182 ASN 182 178 178 ASN ASN A . n A 1 183 TRP 183 179 179 TRP TRP A . n A 1 184 GLU 184 180 180 GLU GLU A . n A 1 185 ILE 185 181 181 ILE ILE A . n A 1 186 SER 186 182 182 SER SER A . n A 1 187 GLY 187 183 183 GLY GLY A . n A 1 188 HIS 188 184 184 HIS HIS A . n A 1 189 THR 189 185 185 THR THR A . n A 1 190 ASN 190 186 186 ASN ASN A . n A 1 191 ALA 191 187 187 ALA ALA A . n A 1 192 ASN 192 188 188 ASN ASN A . n A 1 193 ILE 193 189 189 ILE ILE A . n A 1 194 GLY 194 190 190 GLY GLY A . n A 1 195 GLU 195 191 191 GLU GLU A . n A 1 196 ALA 196 192 192 ALA ALA A . n A 1 197 VAL 197 193 193 VAL VAL A . n A 1 198 VAL 198 194 194 VAL VAL A . n A 1 199 THR 199 195 195 THR THR A . n A 1 200 ALA 200 196 196 ALA ALA A . n A 1 201 THR 201 197 197 THR THR A . n A 1 202 ALA 202 198 198 ALA ALA A . n A 1 203 GLU 203 199 199 GLU GLU A . n A 1 204 LEU 204 200 200 LEU LEU A . n A 1 205 ASP 205 201 201 ASP ASP A . n A 1 206 LYS 206 202 202 LYS LYS A . n A 1 207 ASN 207 203 203 ASN ASN A . n A 1 208 LEU 208 204 204 LEU LEU A . n A 1 209 SER 209 205 205 SER SER A . n A 1 210 ARG 210 206 206 ARG ARG A . n A 1 211 LYS 211 207 207 LYS LYS A . n A 1 212 ILE 212 208 208 ILE ILE A . n A 1 213 GLU 213 209 209 GLU GLU A . n A 1 214 ILE 214 210 210 ILE ILE A . n A 1 215 PRO 215 211 211 PRO PRO A . n A 1 216 PRO 216 212 212 PRO PRO A . n A 1 217 GLY 217 213 213 GLY GLY A . n A 1 218 THR 218 214 214 THR THR A . n A 1 219 ALA 219 215 215 ALA ALA A . n A 1 220 LEU 220 216 216 LEU LEU A . n A 1 221 ALA 221 217 217 ALA ALA A . n A 1 222 TYR 222 218 218 TYR TYR A . n A 1 223 SER 223 219 219 SER SER A . n A 1 224 PHE 224 220 220 PHE PHE A . n A 1 225 MSE 225 221 221 MSE MSE A . n A 1 226 ASP 226 222 222 ASP ASP A . n A 1 227 LEU 227 223 223 LEU LEU A . n A 1 228 GLU 228 224 224 GLU GLU A . n A 1 229 ILE 229 225 225 ILE ILE A . n A 1 230 LEU 230 226 226 LEU LEU A . n A 1 231 GLU 231 227 227 GLU GLU A . n A 1 232 ASP 232 228 228 ASP ASP A . n A 1 233 ARG 233 229 229 ARG ARG A . n A 1 234 SER 234 230 230 SER SER A . n A 1 235 LEU 235 231 231 LEU LEU A . n A 1 236 ARG 236 232 232 ARG ARG A . n A 1 237 VAL 237 233 233 VAL VAL A . n A 1 238 SER 238 234 234 SER SER A . n A 1 239 SER 239 235 235 SER SER A . n A 1 240 SER 240 236 236 SER SER A . n A 1 241 ALA 241 237 237 ALA ALA A . n A 1 242 GLY 242 238 238 GLY GLY A . n A 1 243 ALA 243 239 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 62 HOH HOH A . B 2 HOH 2 302 68 HOH HOH A . B 2 HOH 3 303 34 HOH HOH A . B 2 HOH 4 304 28 HOH HOH A . B 2 HOH 5 305 35 HOH HOH A . B 2 HOH 6 306 12 HOH HOH A . B 2 HOH 7 307 63 HOH HOH A . B 2 HOH 8 308 80 HOH HOH A . B 2 HOH 9 309 57 HOH HOH A . B 2 HOH 10 310 11 HOH HOH A . B 2 HOH 11 311 18 HOH HOH A . B 2 HOH 12 312 92 HOH HOH A . B 2 HOH 13 313 24 HOH HOH A . B 2 HOH 14 314 3 HOH HOH A . B 2 HOH 15 315 83 HOH HOH A . B 2 HOH 16 316 40 HOH HOH A . B 2 HOH 17 317 23 HOH HOH A . B 2 HOH 18 318 16 HOH HOH A . B 2 HOH 19 319 48 HOH HOH A . B 2 HOH 20 320 10 HOH HOH A . B 2 HOH 21 321 6 HOH HOH A . B 2 HOH 22 322 38 HOH HOH A . B 2 HOH 23 323 49 HOH HOH A . B 2 HOH 24 324 52 HOH HOH A . B 2 HOH 25 325 8 HOH HOH A . B 2 HOH 26 326 65 HOH HOH A . B 2 HOH 27 327 54 HOH HOH A . B 2 HOH 28 328 15 HOH HOH A . B 2 HOH 29 329 1 HOH HOH A . B 2 HOH 30 330 19 HOH HOH A . B 2 HOH 31 331 27 HOH HOH A . B 2 HOH 32 332 50 HOH HOH A . B 2 HOH 33 333 64 HOH HOH A . B 2 HOH 34 334 5 HOH HOH A . B 2 HOH 35 335 4 HOH HOH A . B 2 HOH 36 336 45 HOH HOH A . B 2 HOH 37 337 2 HOH HOH A . B 2 HOH 38 338 66 HOH HOH A . B 2 HOH 39 339 56 HOH HOH A . B 2 HOH 40 340 17 HOH HOH A . B 2 HOH 41 341 42 HOH HOH A . B 2 HOH 42 342 72 HOH HOH A . B 2 HOH 43 343 53 HOH HOH A . B 2 HOH 44 344 39 HOH HOH A . B 2 HOH 45 345 32 HOH HOH A . B 2 HOH 46 346 13 HOH HOH A . B 2 HOH 47 347 69 HOH HOH A . B 2 HOH 48 348 36 HOH HOH A . B 2 HOH 49 349 7 HOH HOH A . B 2 HOH 50 350 29 HOH HOH A . B 2 HOH 51 351 59 HOH HOH A . B 2 HOH 52 352 51 HOH HOH A . B 2 HOH 53 353 22 HOH HOH A . B 2 HOH 54 354 91 HOH HOH A . B 2 HOH 55 355 58 HOH HOH A . B 2 HOH 56 356 43 HOH HOH A . B 2 HOH 57 357 37 HOH HOH A . B 2 HOH 58 358 14 HOH HOH A . B 2 HOH 59 359 31 HOH HOH A . B 2 HOH 60 360 25 HOH HOH A . B 2 HOH 61 361 55 HOH HOH A . B 2 HOH 62 362 30 HOH HOH A . B 2 HOH 63 363 47 HOH HOH A . B 2 HOH 64 364 88 HOH HOH A . B 2 HOH 65 365 41 HOH HOH A . B 2 HOH 66 366 26 HOH HOH A . B 2 HOH 67 367 74 HOH HOH A . B 2 HOH 68 368 67 HOH HOH A . B 2 HOH 69 369 21 HOH HOH A . B 2 HOH 70 370 71 HOH HOH A . B 2 HOH 71 371 60 HOH HOH A . B 2 HOH 72 372 9 HOH HOH A . B 2 HOH 73 373 76 HOH HOH A . B 2 HOH 74 374 33 HOH HOH A . B 2 HOH 75 375 86 HOH HOH A . B 2 HOH 76 376 81 HOH HOH A . B 2 HOH 77 377 20 HOH HOH A . B 2 HOH 78 378 46 HOH HOH A . B 2 HOH 79 379 79 HOH HOH A . B 2 HOH 80 380 84 HOH HOH A . B 2 HOH 81 381 77 HOH HOH A . B 2 HOH 82 382 61 HOH HOH A . B 2 HOH 83 383 85 HOH HOH A . B 2 HOH 84 384 70 HOH HOH A . B 2 HOH 85 385 89 HOH HOH A . B 2 HOH 86 386 90 HOH HOH A . B 2 HOH 87 387 78 HOH HOH A . B 2 HOH 88 388 44 HOH HOH A . B 2 HOH 89 389 82 HOH HOH A . B 2 HOH 90 390 87 HOH HOH A . B 2 HOH 91 391 73 HOH HOH A . B 2 HOH 92 392 75 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AutoSol ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8JYV _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.718 _cell.length_a_esd ? _cell.length_b 55.718 _cell.length_b_esd ? _cell.length_c 140.085 _cell.length_c_esd ? _cell.volume 376628.607 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JYV _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JYV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM sodium citrate tribasic dihydrate pH 5.0, 18% polyethylene glycol 3550, 80 mM lithium nitrate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-07-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97927 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97927 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 38.72 _reflns.entry_id 8JYV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.86 _reflns.d_resolution_low 48.25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21681 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 34.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.062 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.86 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1237 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.581 _reflns_shell.pdbx_Rpim_I_all 0.164 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.968 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 92.2 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.555 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 58.80 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JYV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.86 _refine.ls_d_res_low 33.56 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21584 _refine.ls_number_reflns_R_free 1988 _refine.ls_number_reflns_R_work 19596 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.13 _refine.ls_percent_reflns_R_free 9.21 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2161 _refine.ls_R_factor_R_free 0.2343 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2142 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.2303 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2405 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.86 _refine_hist.d_res_low 33.56 _refine_hist.number_atoms_solvent 92 _refine_hist.number_atoms_total 1902 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1810 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0064 ? 1835 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7998 ? 2485 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0508 ? 304 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0074 ? 317 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.9582 ? 690 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.86 1.91 . . 129 1256 92.58 . . . . 0.3059 . . . . . . . . . . . 0.3625 'X-RAY DIFFRACTION' 1.91 1.96 . . 136 1348 97.89 . . . . 0.2777 . . . . . . . . . . . 0.3057 'X-RAY DIFFRACTION' 1.96 2.02 . . 141 1361 99.21 . . . . 0.2497 . . . . . . . . . . . 0.3188 'X-RAY DIFFRACTION' 2.02 2.09 . . 134 1384 99.54 . . . . 0.2272 . . . . . . . . . . . 0.2678 'X-RAY DIFFRACTION' 2.09 2.16 . . 144 1401 99.48 . . . . 0.2384 . . . . . . . . . . . 0.2388 'X-RAY DIFFRACTION' 2.16 2.25 . . 138 1390 99.48 . . . . 0.2372 . . . . . . . . . . . 0.2744 'X-RAY DIFFRACTION' 2.25 2.35 . . 138 1395 99.80 . . . . 0.2618 . . . . . . . . . . . 0.2656 'X-RAY DIFFRACTION' 2.35 2.47 . . 142 1414 100.00 . . . . 0.2234 . . . . . . . . . . . 0.2808 'X-RAY DIFFRACTION' 2.47 2.63 . . 141 1387 99.93 . . . . 0.2563 . . . . . . . . . . . 0.2761 'X-RAY DIFFRACTION' 2.63 2.83 . . 145 1421 100.00 . . . . 0.2439 . . . . . . . . . . . 0.2904 'X-RAY DIFFRACTION' 2.83 3.11 . . 142 1427 100.00 . . . . 0.2437 . . . . . . . . . . . 0.2740 'X-RAY DIFFRACTION' 3.11 3.56 . . 148 1420 100.00 . . . . 0.2066 . . . . . . . . . . . 0.2408 'X-RAY DIFFRACTION' 3.56 4.49 . . 150 1450 100.00 . . . . 0.2020 . . . . . . . . . . . 0.1902 'X-RAY DIFFRACTION' 4.49 33.56 . . 160 1542 99.71 . . . . 0.1785 . . . . . . . . . . . 0.1985 # _struct.entry_id 8JYV _struct.title 'Crystal structure of the gasdermin from Trichoplax adhaerens' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JYV _struct_keywords.text 'Pyroptosis, Gasdermnin, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B3RMM6_TRIAD _struct_ref.pdbx_db_accession B3RMM6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFAVAVNEFIRSAGQDSLCGVPDINSSGDFMPLHIIVKEVPKVLPCCRRPKIKRTPYTLNDILDEPCPNQLKSSDLVTFT EPLVSNVKASSSIGLQILKHFDSGAKGSKNFITSASLGTVVKAETIDITKVLAKVRTAKAKVENDLVSRVMKTKRLCLGL VVETACVAAAGKLTEADNWEISGHTNANIGEAVVTATAELDKNLSRKIEIPPGTALAYSFMDLEILEDRSLRVSSSAGA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JYV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 243 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B3RMM6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 239 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8JYV SER A 1 ? UNP B3RMM6 ? ? 'expression tag' -3 1 1 8JYV GLY A 2 ? UNP B3RMM6 ? ? 'expression tag' -2 2 1 8JYV ARG A 3 ? UNP B3RMM6 ? ? 'expression tag' -1 3 1 8JYV PRO A 4 ? UNP B3RMM6 ? ? 'expression tag' 0 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1490 ? 1 MORE -10 ? 1 'SSA (A^2)' 23750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? GLY A 18 ? GLY A -2 GLY A 14 1 ? 17 HELX_P HELX_P2 AA2 SER A 30 ? MSE A 35 ? SER A 26 MSE A 31 5 ? 6 HELX_P HELX_P3 AA3 LEU A 63 ? LEU A 67 ? LEU A 59 LEU A 63 1 ? 5 HELX_P HELX_P4 AA4 SER A 95 ? PHE A 105 ? SER A 91 PHE A 101 1 ? 11 HELX_P HELX_P5 AA5 ASP A 131 ? ALA A 142 ? ASP A 127 ALA A 138 1 ? 12 HELX_P HELX_P6 AA6 ASN A 148 ? THR A 157 ? ASN A 144 THR A 153 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 46 A CYS 46 4_555 ? ? ? ? ? ? ? 2.022 ? ? disulf2 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 161 SG ? ? A CYS 47 A CYS 157 4_555 ? ? ? ? ? ? ? 2.026 ? ? covale1 covale both ? A PRO 4 C ? ? ? 1_555 A MSE 5 N ? ? A PRO 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 5 C ? ? ? 1_555 A PHE 6 N ? ? A MSE 1 A PHE 2 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale3 covale both ? A PHE 34 C ? ? ? 1_555 A MSE 35 N ? ? A PHE 30 A MSE 31 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale4 covale both ? A MSE 35 C ? ? ? 1_555 A PRO 36 N ? ? A MSE 31 A PRO 32 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale5 covale both ? A VAL 154 C ? ? ? 1_555 A MSE 155 N ? ? A VAL 150 A MSE 151 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale6 covale both ? A MSE 155 C ? ? ? 1_555 A LYS 156 N ? ? A MSE 151 A LYS 152 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale7 covale both ? A PHE 224 C ? ? ? 1_555 A MSE 225 N ? ? A PHE 220 A MSE 221 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A MSE 225 C ? ? ? 1_555 A ASP 226 N ? ? A MSE 221 A ASP 222 1_555 ? ? ? ? ? ? ? 1.325 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 5 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 35 ? . . . . MSE A 31 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 155 ? . . . . MSE A 151 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 225 ? . . . . MSE A 221 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 CYS A 50 ? CYS A 50 ? CYS A 46 ? 1_555 CYS A 46 ? 4_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 51 ? CYS A 161 ? CYS A 47 ? 1_555 CYS A 157 ? 4_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 23 ? GLY A 24 ? CYS A 19 GLY A 20 AA1 2 ALA A 219 ? ILE A 229 ? ALA A 215 ILE A 225 AA1 3 LEU A 160 ? VAL A 171 ? LEU A 156 VAL A 167 AA1 4 THR A 123 ? THR A 129 ? THR A 119 THR A 125 AA1 5 GLN A 74 ? THR A 82 ? GLN A 70 THR A 78 AA1 6 ASN A 182 ? TRP A 183 ? ASN A 178 TRP A 179 AA2 1 LYS A 55 ? THR A 62 ? LYS A 51 THR A 58 AA2 2 HIS A 38 ? GLU A 43 ? HIS A 34 GLU A 39 AA2 3 LEU A 160 ? VAL A 171 ? LEU A 156 VAL A 167 AA2 4 ALA A 219 ? ILE A 229 ? ALA A 215 ILE A 225 AA2 5 LEU A 235 ? SER A 239 ? LEU A 231 SER A 235 AA3 1 LEU A 87 ? LYS A 92 ? LEU A 83 LYS A 88 AA3 2 ASN A 114 ? SER A 120 ? ASN A 110 SER A 116 AA3 3 VAL A 197 ? ALA A 202 ? VAL A 193 ALA A 198 AA3 4 ASP A 205 ? GLU A 213 ? ASP A 201 GLU A 209 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 23 ? N CYS A 19 O TYR A 222 ? O TYR A 218 AA1 2 3 O LEU A 220 ? O LEU A 216 N ALA A 169 ? N ALA A 165 AA1 3 4 O THR A 168 ? O THR A 164 N ALA A 127 ? N ALA A 123 AA1 4 5 O LYS A 126 ? O LYS A 122 N SER A 78 ? N SER A 74 AA1 5 6 N LEU A 75 ? N LEU A 71 O ASN A 182 ? O ASN A 178 AA2 1 2 O LYS A 57 ? O LYS A 53 N VAL A 41 ? N VAL A 37 AA2 2 3 N LYS A 42 ? N LYS A 38 O CYS A 161 ? O CYS A 157 AA2 3 4 N ALA A 169 ? N ALA A 165 O LEU A 220 ? O LEU A 216 AA2 4 5 N GLU A 228 ? N GLU A 224 O ARG A 236 ? O ARG A 232 AA3 1 2 N LEU A 87 ? N LEU A 83 O ALA A 119 ? O ALA A 115 AA3 2 3 N SER A 120 ? N SER A 116 O VAL A 197 ? O VAL A 193 AA3 3 4 N ALA A 202 ? N ALA A 198 O LEU A 208 ? O LEU A 204 # _pdbx_entry_details.entry_id 8JYV _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 224 ? ? O A HOH 301 ? ? 1.84 2 1 NH2 A ARG 149 ? ? O A HOH 302 ? ? 2.00 3 1 NZ A LYS 134 ? ? O A HOH 303 ? ? 2.10 4 1 O A HOH 315 ? ? O A HOH 379 ? ? 2.13 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 381 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 392 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_555 _pdbx_validate_symm_contact.dist 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 45 ? ? -94.02 56.39 2 1 SER A 182 ? ? -86.15 -137.73 3 1 ARG A 229 ? ? 73.69 -0.94 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 5 A MSE 1 ? MET 'modified residue' 2 A MSE 35 A MSE 31 ? MET 'modified residue' 3 A MSE 155 A MSE 151 ? MET 'modified residue' 4 A MSE 225 A MSE 221 ? MET 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 323 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 15.7256984202 _pdbx_refine_tls.origin_y -0.450990440407 _pdbx_refine_tls.origin_z 3.44676992512 _pdbx_refine_tls.T[1][1] 0.193596413816 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0210987140809 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0160661110558 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.280815894956 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0413381045845 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.252328204608 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.28797918568 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.206264436393 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.262525977217 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 5.54483968749 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 3.00486352855 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.17091194237 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.132671426267 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.022873501372 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0371871785453 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.115552642203 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0393872099104 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0193768227971 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0534031683649 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.200067224009 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.075763232054 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 241 _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -3 ? A SER 1 2 1 Y 1 A ALA 239 ? A ALA 243 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Chinese Academy of Sciences' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 8JYV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017948 _atom_sites.fract_transf_matrix[1][2] 0.010362 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020724 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007139 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? 26.02326 7.89457 ? ? 1.54240 29.12501 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_