data_8JZK # _entry.id 8JZK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8JZK pdb_00008jzk 10.2210/pdb8jzk/pdb WWPDB D_1300039124 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-06-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8JZK _pdbx_database_status.recvd_initial_deposition_date 2023-07-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 1 _pdbx_contact_author.email qingyin.zeng@caf.ac.cn _pdbx_contact_author.name_first QingYin _pdbx_contact_author.name_last Zeng _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5730-3016 # _audit_author.name 'Xu, N.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9481-6136 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of glutathione S-transferase Tau7 from Salix lindleyana in complex with GSH' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Xu, N.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0000-0002-9481-6136 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'glutathione transferase' 25755.889 1 ? ? ? ;Sequence reference for Salix lindleyana is not available in UniProt at the time of biocuration. Current sequence reference is from UniProt id A0A5N5L538. ; 2 non-polymer syn GLUTATHIONE 307.323 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEQPKLLGALPSPFVYRVIWALKLKAIPYEFIEEDLTNKSPLLLKYNPVHKKIPVFLHGDKPVCESMIIVEYIDEVWPQ NPLLPKDPYERALARFWVKFAEDKGTAVWRMFRSKGEELEKTMKETQEMLQTVEEHGIGEKKFFGGESIGIADIAFGSVV YWLEVIEEAVGEGAVFEAHRFPRLHAWIKDFKQVPVIKENLPERDWMVTFFKNRREALVGSA ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEQPKLLGALPSPFVYRVIWALKLKAIPYEFIEEDLTNKSPLLLKYNPVHKKIPVFLHGDKPVCESMIIVEYIDEVWPQ NPLLPKDPYERALARFWVKFAEDKGTAVWRMFRSKGEELEKTMKETQEMLQTVEEHGIGEKKFFGGESIGIADIAFGSVV YWLEVIEEAVGEGAVFEAHRFPRLHAWIKDFKQVPVIKENLPERDWMVTFFKNRREALVGSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLUTATHIONE GSH 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 GLN n 1 5 PRO n 1 6 LYS n 1 7 LEU n 1 8 LEU n 1 9 GLY n 1 10 ALA n 1 11 LEU n 1 12 PRO n 1 13 SER n 1 14 PRO n 1 15 PHE n 1 16 VAL n 1 17 TYR n 1 18 ARG n 1 19 VAL n 1 20 ILE n 1 21 TRP n 1 22 ALA n 1 23 LEU n 1 24 LYS n 1 25 LEU n 1 26 LYS n 1 27 ALA n 1 28 ILE n 1 29 PRO n 1 30 TYR n 1 31 GLU n 1 32 PHE n 1 33 ILE n 1 34 GLU n 1 35 GLU n 1 36 ASP n 1 37 LEU n 1 38 THR n 1 39 ASN n 1 40 LYS n 1 41 SER n 1 42 PRO n 1 43 LEU n 1 44 LEU n 1 45 LEU n 1 46 LYS n 1 47 TYR n 1 48 ASN n 1 49 PRO n 1 50 VAL n 1 51 HIS n 1 52 LYS n 1 53 LYS n 1 54 ILE n 1 55 PRO n 1 56 VAL n 1 57 PHE n 1 58 LEU n 1 59 HIS n 1 60 GLY n 1 61 ASP n 1 62 LYS n 1 63 PRO n 1 64 VAL n 1 65 CYS n 1 66 GLU n 1 67 SER n 1 68 MET n 1 69 ILE n 1 70 ILE n 1 71 VAL n 1 72 GLU n 1 73 TYR n 1 74 ILE n 1 75 ASP n 1 76 GLU n 1 77 VAL n 1 78 TRP n 1 79 PRO n 1 80 GLN n 1 81 ASN n 1 82 PRO n 1 83 LEU n 1 84 LEU n 1 85 PRO n 1 86 LYS n 1 87 ASP n 1 88 PRO n 1 89 TYR n 1 90 GLU n 1 91 ARG n 1 92 ALA n 1 93 LEU n 1 94 ALA n 1 95 ARG n 1 96 PHE n 1 97 TRP n 1 98 VAL n 1 99 LYS n 1 100 PHE n 1 101 ALA n 1 102 GLU n 1 103 ASP n 1 104 LYS n 1 105 GLY n 1 106 THR n 1 107 ALA n 1 108 VAL n 1 109 TRP n 1 110 ARG n 1 111 MET n 1 112 PHE n 1 113 ARG n 1 114 SER n 1 115 LYS n 1 116 GLY n 1 117 GLU n 1 118 GLU n 1 119 LEU n 1 120 GLU n 1 121 LYS n 1 122 THR n 1 123 MET n 1 124 LYS n 1 125 GLU n 1 126 THR n 1 127 GLN n 1 128 GLU n 1 129 MET n 1 130 LEU n 1 131 GLN n 1 132 THR n 1 133 VAL n 1 134 GLU n 1 135 GLU n 1 136 HIS n 1 137 GLY n 1 138 ILE n 1 139 GLY n 1 140 GLU n 1 141 LYS n 1 142 LYS n 1 143 PHE n 1 144 PHE n 1 145 GLY n 1 146 GLY n 1 147 GLU n 1 148 SER n 1 149 ILE n 1 150 GLY n 1 151 ILE n 1 152 ALA n 1 153 ASP n 1 154 ILE n 1 155 ALA n 1 156 PHE n 1 157 GLY n 1 158 SER n 1 159 VAL n 1 160 VAL n 1 161 TYR n 1 162 TRP n 1 163 LEU n 1 164 GLU n 1 165 VAL n 1 166 ILE n 1 167 GLU n 1 168 GLU n 1 169 ALA n 1 170 VAL n 1 171 GLY n 1 172 GLU n 1 173 GLY n 1 174 ALA n 1 175 VAL n 1 176 PHE n 1 177 GLU n 1 178 ALA n 1 179 HIS n 1 180 ARG n 1 181 PHE n 1 182 PRO n 1 183 ARG n 1 184 LEU n 1 185 HIS n 1 186 ALA n 1 187 TRP n 1 188 ILE n 1 189 LYS n 1 190 ASP n 1 191 PHE n 1 192 LYS n 1 193 GLN n 1 194 VAL n 1 195 PRO n 1 196 VAL n 1 197 ILE n 1 198 LYS n 1 199 GLU n 1 200 ASN n 1 201 LEU n 1 202 PRO n 1 203 GLU n 1 204 ARG n 1 205 ASP n 1 206 TRP n 1 207 MET n 1 208 VAL n 1 209 THR n 1 210 PHE n 1 211 PHE n 1 212 LYS n 1 213 ASN n 1 214 ARG n 1 215 ARG n 1 216 GLU n 1 217 ALA n 1 218 LEU n 1 219 VAL n 1 220 GLY n 1 221 SER n 1 222 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 222 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DKX38_015263 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salix lindleyana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1510605 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GSH non-polymer . GLUTATHIONE ? 'C10 H17 N3 O6 S' 307.323 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 TYR 89 89 89 TYR TYR A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 TRP 187 187 187 TRP TRP A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 LYS 192 192 192 LYS LYS A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 TRP 206 206 206 TRP TRP A . n A 1 207 MET 207 207 207 MET MET A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ARG 215 215 215 ARG ARG A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 LEU 218 218 ? ? ? A . n A 1 219 VAL 219 219 ? ? ? A . n A 1 220 GLY 220 220 ? ? ? A . n A 1 221 SER 221 221 ? ? ? A . n A 1 222 ALA 222 222 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GSH 1 301 301 GSH GSH A . C 3 HOH 1 401 35 HOH HOH A . C 3 HOH 2 402 19 HOH HOH A . C 3 HOH 3 403 12 HOH HOH A . C 3 HOH 4 404 21 HOH HOH A . C 3 HOH 5 405 33 HOH HOH A . C 3 HOH 6 406 15 HOH HOH A . C 3 HOH 7 407 39 HOH HOH A . C 3 HOH 8 408 4 HOH HOH A . C 3 HOH 9 409 27 HOH HOH A . C 3 HOH 10 410 36 HOH HOH A . C 3 HOH 11 411 6 HOH HOH A . C 3 HOH 12 412 28 HOH HOH A . C 3 HOH 13 413 10 HOH HOH A . C 3 HOH 14 414 31 HOH HOH A . C 3 HOH 15 415 42 HOH HOH A . C 3 HOH 16 416 13 HOH HOH A . C 3 HOH 17 417 8 HOH HOH A . C 3 HOH 18 418 1 HOH HOH A . C 3 HOH 19 419 17 HOH HOH A . C 3 HOH 20 420 2 HOH HOH A . C 3 HOH 21 421 18 HOH HOH A . C 3 HOH 22 422 37 HOH HOH A . C 3 HOH 23 423 3 HOH HOH A . C 3 HOH 24 424 7 HOH HOH A . C 3 HOH 25 425 24 HOH HOH A . C 3 HOH 26 426 26 HOH HOH A . C 3 HOH 27 427 38 HOH HOH A . C 3 HOH 28 428 9 HOH HOH A . C 3 HOH 29 429 40 HOH HOH A . C 3 HOH 30 430 41 HOH HOH A . C 3 HOH 31 431 34 HOH HOH A . C 3 HOH 32 432 29 HOH HOH A . C 3 HOH 33 433 20 HOH HOH A . C 3 HOH 34 434 16 HOH HOH A . C 3 HOH 35 435 22 HOH HOH A . C 3 HOH 36 436 30 HOH HOH A . C 3 HOH 37 437 23 HOH HOH A . C 3 HOH 38 438 25 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692+SVN 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 # _cell.angle_alpha 90.0 _cell.angle_alpha_esd ? _cell.angle_beta 90.0 _cell.angle_beta_esd ? _cell.angle_gamma 90.0 _cell.angle_gamma_esd ? _cell.entry_id 8JZK _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.727 _cell.length_a_esd ? _cell.length_b 87.931 _cell.length_b_esd ? _cell.length_c 113.973 _cell.length_c_esd ? _cell.volume 608591.4112 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8JZK _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8JZK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M BIS-TRIS propane pH 9.0, 8% w/v Polyethylene glycol 20000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-03-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979183 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL10U2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979183 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL10U2 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 25.969849838 _reflns.entry_id 8JZK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.55004430946 _reflns.d_resolution_low 29.3401515991 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10186 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.233 _reflns.pdbx_Rpim_I_all 0.071 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.978 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.55004430946 _reflns_shell.d_res_low 2.55004430946 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 724 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.978 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 28.5274376791 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8JZK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.55004430946 _refine.ls_d_res_low 29.3401515991 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10178 _refine.ls_number_reflns_R_free 491 _refine.ls_number_reflns_R_work 9687 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.1814461119 _refine.ls_percent_reflns_R_free 4.8241304775 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19172701895 _refine.ls_R_factor_R_free 0.258354324323 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.188358358396 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38496459539 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.8417971238 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.301574382114 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.55004430946 _refine_hist.d_res_low 29.3401515991 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1825 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1767 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00889533587019 ? 1839 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.14602964921 ? 2488 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0469363057102 ? 260 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00551251287418 ? 317 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.532167743 ? 688 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.56 2.8065 . . 120 2374 98.7722772277 . . . . 0.206888832682 . . . . . . . . . . . 0.289991670179 'X-RAY DIFFRACTION' 2.8065 3.2122 . . 129 2358 99.0442054958 . . . . 0.216055683208 . . . . . . . . . . . 0.29285931393 'X-RAY DIFFRACTION' 3.2122 4.0453 . . 110 2440 99.3377483444 . . . . 0.180659729799 . . . . . . . . . . . 0.278424919263 'X-RAY DIFFRACTION' 4.0453 29.3421 . . 132 2515 99.5487025197 . . . . 0.173489891406 . . . . . . . . . . . 0.213494239526 # _struct.entry_id 8JZK _struct.title 'Crystal structure of glutathione S-transferase Tau7 from Salix lindleyana in complex with GSH' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8JZK _struct_keywords.text 'glutathione $-transferase, Tau class, GSH, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A5N5L538_9ROSI _struct_ref.pdbx_db_accession A0A5N5L538 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEQPKLLGALPSPFVYRVIWALKLKAIPYEFIEEDLTNKSPLLLKYNPVHKKIPVFLHGDKPVCESMIIVEYIDEVWPQ NPLLPKDPYERALARFWVKFAEDKGTAVWRMFRSKGEELEKTMKETQEMLQTVEEHGIGEKKFFGGESIGIADIAFGSVV YWLEVIEEAVGKGAVFEAHRFPRLDAWIKNFKQVPVIKENLPERDWMVTFFKNRREALVGSA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8JZK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 222 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A5N5L538 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 222 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 222 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8JZK GLU A 172 ? UNP A0A5N5L538 LYS 172 conflict 172 1 1 8JZK HIS A 185 ? UNP A0A5N5L538 ASP 185 conflict 185 2 1 8JZK ASP A 190 ? UNP A0A5N5L538 ASN 190 conflict 190 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3860 ? 1 MORE -25 ? 1 'SSA (A^2)' 19650 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 13 ? LYS A 26 ? SER A 13 LYS A 26 1 ? 14 HELX_P HELX_P2 AA2 ASP A 36 ? LYS A 40 ? ASP A 36 LYS A 40 5 ? 5 HELX_P HELX_P3 AA3 SER A 41 ? ASN A 48 ? SER A 41 ASN A 48 1 ? 8 HELX_P HELX_P4 AA4 GLU A 66 ? TRP A 78 ? GLU A 66 TRP A 78 1 ? 13 HELX_P HELX_P5 AA5 ASP A 87 ? GLY A 105 ? ASP A 87 GLY A 105 1 ? 19 HELX_P HELX_P6 AA6 GLY A 105 ? SER A 114 ? GLY A 105 SER A 114 1 ? 10 HELX_P HELX_P7 AA7 GLY A 116 ? GLY A 137 ? GLY A 116 GLY A 137 1 ? 22 HELX_P HELX_P8 AA8 GLY A 150 ? GLY A 171 ? GLY A 150 GLY A 171 1 ? 22 HELX_P HELX_P9 AA9 PHE A 181 ? VAL A 194 ? PHE A 181 VAL A 194 1 ? 14 HELX_P HELX_P10 AB1 VAL A 194 ? ASN A 200 ? VAL A 194 ASN A 200 1 ? 7 HELX_P HELX_P11 AB2 GLU A 203 ? GLU A 216 ? GLU A 203 GLU A 216 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 54 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 54 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 55 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 55 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.79 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 31 ? GLU A 34 ? GLU A 31 GLU A 34 AA1 2 LYS A 6 ? GLY A 9 ? LYS A 6 GLY A 9 AA1 3 VAL A 56 ? HIS A 59 ? VAL A 56 HIS A 59 AA1 4 LYS A 62 ? VAL A 64 ? LYS A 62 VAL A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 33 ? O ILE A 33 N LEU A 7 ? N LEU A 7 AA1 2 3 N LYS A 6 ? N LYS A 6 O LEU A 58 ? O LEU A 58 AA1 3 4 N PHE A 57 ? N PHE A 57 O VAL A 64 ? O VAL A 64 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 65 ? ? -106.44 -65.02 2 1 LYS A 115 ? ? -126.15 -66.39 3 1 ALA A 174 ? ? -88.12 37.46 4 1 VAL A 175 ? ? -87.14 -76.27 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 8JZK _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A LEU 218 ? A LEU 218 5 1 Y 1 A VAL 219 ? A VAL 219 6 1 Y 1 A GLY 220 ? A GLY 220 7 1 Y 1 A SER 221 ? A SER 221 8 1 Y 1 A ALA 222 ? A ALA 222 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GSH N1 N N N 137 GSH CA1 C N S 138 GSH C1 C N N 139 GSH O11 O N N 140 GSH O12 O N N 141 GSH CB1 C N N 142 GSH CG1 C N N 143 GSH CD1 C N N 144 GSH OE1 O N N 145 GSH N2 N N N 146 GSH CA2 C N R 147 GSH C2 C N N 148 GSH O2 O N N 149 GSH CB2 C N N 150 GSH SG2 S N N 151 GSH N3 N N N 152 GSH CA3 C N N 153 GSH C3 C N N 154 GSH O31 O N N 155 GSH O32 O N N 156 GSH HN11 H N N 157 GSH HN12 H N N 158 GSH HA1 H N N 159 GSH H12 H N N 160 GSH HB12 H N N 161 GSH HB13 H N N 162 GSH HG12 H N N 163 GSH HG13 H N N 164 GSH HN2 H N N 165 GSH HA2 H N N 166 GSH HB22 H N N 167 GSH HB23 H N N 168 GSH HSG H N N 169 GSH HN3 H N N 170 GSH HA31 H N N 171 GSH HA32 H N N 172 GSH H32 H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TRP N N N N 358 TRP CA C N S 359 TRP C C N N 360 TRP O O N N 361 TRP CB C N N 362 TRP CG C Y N 363 TRP CD1 C Y N 364 TRP CD2 C Y N 365 TRP NE1 N Y N 366 TRP CE2 C Y N 367 TRP CE3 C Y N 368 TRP CZ2 C Y N 369 TRP CZ3 C Y N 370 TRP CH2 C Y N 371 TRP OXT O N N 372 TRP H H N N 373 TRP H2 H N N 374 TRP HA H N N 375 TRP HB2 H N N 376 TRP HB3 H N N 377 TRP HD1 H N N 378 TRP HE1 H N N 379 TRP HE3 H N N 380 TRP HZ2 H N N 381 TRP HZ3 H N N 382 TRP HH2 H N N 383 TRP HXT H N N 384 TYR N N N N 385 TYR CA C N S 386 TYR C C N N 387 TYR O O N N 388 TYR CB C N N 389 TYR CG C Y N 390 TYR CD1 C Y N 391 TYR CD2 C Y N 392 TYR CE1 C Y N 393 TYR CE2 C Y N 394 TYR CZ C Y N 395 TYR OH O N N 396 TYR OXT O N N 397 TYR H H N N 398 TYR H2 H N N 399 TYR HA H N N 400 TYR HB2 H N N 401 TYR HB3 H N N 402 TYR HD1 H N N 403 TYR HD2 H N N 404 TYR HE1 H N N 405 TYR HE2 H N N 406 TYR HH H N N 407 TYR HXT H N N 408 VAL N N N N 409 VAL CA C N S 410 VAL C C N N 411 VAL O O N N 412 VAL CB C N N 413 VAL CG1 C N N 414 VAL CG2 C N N 415 VAL OXT O N N 416 VAL H H N N 417 VAL H2 H N N 418 VAL HA H N N 419 VAL HB H N N 420 VAL HG11 H N N 421 VAL HG12 H N N 422 VAL HG13 H N N 423 VAL HG21 H N N 424 VAL HG22 H N N 425 VAL HG23 H N N 426 VAL HXT H N N 427 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GSH N1 CA1 sing N N 129 GSH N1 HN11 sing N N 130 GSH N1 HN12 sing N N 131 GSH CA1 C1 sing N N 132 GSH CA1 CB1 sing N N 133 GSH CA1 HA1 sing N N 134 GSH C1 O11 doub N N 135 GSH C1 O12 sing N N 136 GSH O12 H12 sing N N 137 GSH CB1 CG1 sing N N 138 GSH CB1 HB12 sing N N 139 GSH CB1 HB13 sing N N 140 GSH CG1 CD1 sing N N 141 GSH CG1 HG12 sing N N 142 GSH CG1 HG13 sing N N 143 GSH CD1 OE1 doub N N 144 GSH CD1 N2 sing N N 145 GSH N2 CA2 sing N N 146 GSH N2 HN2 sing N N 147 GSH CA2 C2 sing N N 148 GSH CA2 CB2 sing N N 149 GSH CA2 HA2 sing N N 150 GSH C2 O2 doub N N 151 GSH C2 N3 sing N N 152 GSH CB2 SG2 sing N N 153 GSH CB2 HB22 sing N N 154 GSH CB2 HB23 sing N N 155 GSH SG2 HSG sing N N 156 GSH N3 CA3 sing N N 157 GSH N3 HN3 sing N N 158 GSH CA3 C3 sing N N 159 GSH CA3 HA31 sing N N 160 GSH CA3 HA32 sing N N 161 GSH C3 O31 doub N N 162 GSH C3 O32 sing N N 163 GSH O32 H32 sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 HOH O H1 sing N N 186 HOH O H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GSH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GSH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name SwissModel _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8JZK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016467 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011373 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008774 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 24.73122 6.32584 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_