data_8K6P # _entry.id 8K6P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8K6P pdb_00008k6p 10.2210/pdb8k6p/pdb WWPDB D_1300039654 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8K6P _pdbx_database_status.recvd_initial_deposition_date 2023-07-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email 1124868563@qq.com _pdbx_contact_author.name_first Yan _pdbx_contact_author.name_last Zhang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0009-0000-0545-1036 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yan, Z.' 1 ? 'Pan, L.F.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Biochem.Biophys.Res.Commun. BBRCA9 0146 1090-2104 ? ? 689 ? 149239 149239 'Mechanistic insights into the homo-dimerization of HOIL-1L and SHARPIN.' 2023 ? 10.1016/j.bbrc.2023.149239 37976837 ? ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Crystal structure of SHARPIN LTM motif.' ? ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.' 1 ? primary 'Xu, X.' 2 ? primary 'Wang, Y.' 3 ? primary 'Wang, Y.' 4 ? primary 'Zhou, X.' 5 ? primary 'Pan, L.' 6 ? 1 'Yan, Z.' 7 ? 1 'Pan, L.F.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Sharpin 4979.568 3 ? ? 'LTM motif' ? 2 water nat water 18.015 12 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Shank-associated RH domain-interacting protein,Shank-interacting protein-like 1,hSIPL1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code YRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQ _entity_poly.pdbx_seq_one_letter_code_can YRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQ _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 ARG n 1 3 SER n 1 4 PRO n 1 5 GLY n 1 6 ASN n 1 7 LEU n 1 8 THR n 1 9 GLU n 1 10 ARG n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 ALA n 1 15 GLY n 1 16 SER n 1 17 LEU n 1 18 ALA n 1 19 ARG n 1 20 ALA n 1 21 ILE n 1 22 ALA n 1 23 GLY n 1 24 GLY n 1 25 ASP n 1 26 GLU n 1 27 LYS n 1 28 GLY n 1 29 ALA n 1 30 ALA n 1 31 GLN n 1 32 VAL n 1 33 ALA n 1 34 ALA n 1 35 VAL n 1 36 LEU n 1 37 ALA n 1 38 GLN n 1 39 HIS n 1 40 ARG n 1 41 VAL n 1 42 ALA n 1 43 LEU n 1 44 SER n 1 45 VAL n 1 46 GLN n 1 47 LEU n 1 48 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 48 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SHARPIN, SIPL1, PSEC0216' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 163 ? ? ? A . n A 1 2 ARG 2 164 ? ? ? A . n A 1 3 SER 3 165 ? ? ? A . n A 1 4 PRO 4 166 ? ? ? A . n A 1 5 GLY 5 167 ? ? ? A . n A 1 6 ASN 6 168 168 ASN ASN A . n A 1 7 LEU 7 169 169 LEU LEU A . n A 1 8 THR 8 170 170 THR THR A . n A 1 9 GLU 9 171 171 GLU GLU A . n A 1 10 ARG 10 172 172 ARG ARG A . n A 1 11 GLU 11 173 173 GLU GLU A . n A 1 12 GLU 12 174 174 GLU GLU A . n A 1 13 LEU 13 175 175 LEU LEU A . n A 1 14 ALA 14 176 176 ALA ALA A . n A 1 15 GLY 15 177 177 GLY GLY A . n A 1 16 SER 16 178 178 SER SER A . n A 1 17 LEU 17 179 179 LEU LEU A . n A 1 18 ALA 18 180 180 ALA ALA A . n A 1 19 ARG 19 181 181 ARG ARG A . n A 1 20 ALA 20 182 182 ALA ALA A . n A 1 21 ILE 21 183 183 ILE ILE A . n A 1 22 ALA 22 184 184 ALA ALA A . n A 1 23 GLY 23 185 185 GLY GLY A . n A 1 24 GLY 24 186 186 GLY GLY A . n A 1 25 ASP 25 187 187 ASP ASP A . n A 1 26 GLU 26 188 188 GLU GLU A . n A 1 27 LYS 27 189 189 LYS LYS A . n A 1 28 GLY 28 190 190 GLY GLY A . n A 1 29 ALA 29 191 191 ALA ALA A . n A 1 30 ALA 30 192 192 ALA ALA A . n A 1 31 GLN 31 193 193 GLN GLN A . n A 1 32 VAL 32 194 194 VAL VAL A . n A 1 33 ALA 33 195 195 ALA ALA A . n A 1 34 ALA 34 196 196 ALA ALA A . n A 1 35 VAL 35 197 197 VAL VAL A . n A 1 36 LEU 36 198 198 LEU LEU A . n A 1 37 ALA 37 199 199 ALA ALA A . n A 1 38 GLN 38 200 200 GLN GLN A . n A 1 39 HIS 39 201 201 HIS HIS A . n A 1 40 ARG 40 202 202 ARG ARG A . n A 1 41 VAL 41 203 203 VAL VAL A . n A 1 42 ALA 42 204 204 ALA ALA A . n A 1 43 LEU 43 205 205 LEU LEU A . n A 1 44 SER 44 206 206 SER SER A . n A 1 45 VAL 45 207 207 VAL VAL A . n A 1 46 GLN 46 208 208 GLN GLN A . n A 1 47 LEU 47 209 209 LEU LEU A . n A 1 48 GLN 48 210 210 GLN GLN A . n B 1 1 TYR 1 163 163 TYR TYR B . n B 1 2 ARG 2 164 164 ARG ARG B . n B 1 3 SER 3 165 165 SER SER B . n B 1 4 PRO 4 166 166 PRO PRO B . n B 1 5 GLY 5 167 167 GLY GLY B . n B 1 6 ASN 6 168 168 ASN ASN B . n B 1 7 LEU 7 169 169 LEU LEU B . n B 1 8 THR 8 170 170 THR THR B . n B 1 9 GLU 9 171 171 GLU GLU B . n B 1 10 ARG 10 172 172 ARG ARG B . n B 1 11 GLU 11 173 173 GLU GLU B . n B 1 12 GLU 12 174 174 GLU GLU B . n B 1 13 LEU 13 175 175 LEU LEU B . n B 1 14 ALA 14 176 176 ALA ALA B . n B 1 15 GLY 15 177 177 GLY GLY B . n B 1 16 SER 16 178 178 SER SER B . n B 1 17 LEU 17 179 179 LEU LEU B . n B 1 18 ALA 18 180 180 ALA ALA B . n B 1 19 ARG 19 181 181 ARG ARG B . n B 1 20 ALA 20 182 182 ALA ALA B . n B 1 21 ILE 21 183 183 ILE ILE B . n B 1 22 ALA 22 184 184 ALA ALA B . n B 1 23 GLY 23 185 185 GLY GLY B . n B 1 24 GLY 24 186 186 GLY GLY B . n B 1 25 ASP 25 187 187 ASP ASP B . n B 1 26 GLU 26 188 188 GLU GLU B . n B 1 27 LYS 27 189 189 LYS LYS B . n B 1 28 GLY 28 190 190 GLY GLY B . n B 1 29 ALA 29 191 191 ALA ALA B . n B 1 30 ALA 30 192 192 ALA ALA B . n B 1 31 GLN 31 193 193 GLN GLN B . n B 1 32 VAL 32 194 194 VAL VAL B . n B 1 33 ALA 33 195 195 ALA ALA B . n B 1 34 ALA 34 196 196 ALA ALA B . n B 1 35 VAL 35 197 197 VAL VAL B . n B 1 36 LEU 36 198 198 LEU LEU B . n B 1 37 ALA 37 199 199 ALA ALA B . n B 1 38 GLN 38 200 200 GLN GLN B . n B 1 39 HIS 39 201 201 HIS HIS B . n B 1 40 ARG 40 202 202 ARG ARG B . n B 1 41 VAL 41 203 203 VAL VAL B . n B 1 42 ALA 42 204 204 ALA ALA B . n B 1 43 LEU 43 205 205 LEU LEU B . n B 1 44 SER 44 206 206 SER SER B . n B 1 45 VAL 45 207 207 VAL VAL B . n B 1 46 GLN 46 208 208 GLN GLN B . n B 1 47 LEU 47 209 209 LEU LEU B . n B 1 48 GLN 48 210 210 GLN GLN B . n C 1 1 TYR 1 163 ? ? ? C . n C 1 2 ARG 2 164 ? ? ? C . n C 1 3 SER 3 165 ? ? ? C . n C 1 4 PRO 4 166 166 PRO PRO C . n C 1 5 GLY 5 167 167 GLY GLY C . n C 1 6 ASN 6 168 168 ASN ASN C . n C 1 7 LEU 7 169 169 LEU LEU C . n C 1 8 THR 8 170 170 THR THR C . n C 1 9 GLU 9 171 171 GLU GLU C . n C 1 10 ARG 10 172 172 ARG ARG C . n C 1 11 GLU 11 173 173 GLU GLU C . n C 1 12 GLU 12 174 174 GLU GLU C . n C 1 13 LEU 13 175 175 LEU LEU C . n C 1 14 ALA 14 176 176 ALA ALA C . n C 1 15 GLY 15 177 177 GLY GLY C . n C 1 16 SER 16 178 178 SER SER C . n C 1 17 LEU 17 179 179 LEU LEU C . n C 1 18 ALA 18 180 180 ALA ALA C . n C 1 19 ARG 19 181 181 ARG ARG C . n C 1 20 ALA 20 182 182 ALA ALA C . n C 1 21 ILE 21 183 183 ILE ILE C . n C 1 22 ALA 22 184 184 ALA ALA C . n C 1 23 GLY 23 185 185 GLY GLY C . n C 1 24 GLY 24 186 186 GLY GLY C . n C 1 25 ASP 25 187 187 ASP ASP C . n C 1 26 GLU 26 188 188 GLU GLU C . n C 1 27 LYS 27 189 189 LYS LYS C . n C 1 28 GLY 28 190 190 GLY GLY C . n C 1 29 ALA 29 191 191 ALA ALA C . n C 1 30 ALA 30 192 192 ALA ALA C . n C 1 31 GLN 31 193 193 GLN GLN C . n C 1 32 VAL 32 194 194 VAL VAL C . n C 1 33 ALA 33 195 195 ALA ALA C . n C 1 34 ALA 34 196 196 ALA ALA C . n C 1 35 VAL 35 197 197 VAL VAL C . n C 1 36 LEU 36 198 198 LEU LEU C . n C 1 37 ALA 37 199 199 ALA ALA C . n C 1 38 GLN 38 200 200 GLN GLN C . n C 1 39 HIS 39 201 201 HIS HIS C . n C 1 40 ARG 40 202 202 ARG ARG C . n C 1 41 VAL 41 203 203 VAL VAL C . n C 1 42 ALA 42 204 204 ALA ALA C . n C 1 43 LEU 43 205 205 LEU LEU C . n C 1 44 SER 44 206 206 SER SER C . n C 1 45 VAL 45 207 207 VAL VAL C . n C 1 46 GLN 46 208 208 GLN GLN C . n C 1 47 LEU 47 209 209 LEU LEU C . n C 1 48 GLN 48 210 210 GLN GLN C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 301 9 HOH HOH A . D 2 HOH 2 302 7 HOH HOH A . E 2 HOH 1 301 4 HOH HOH B . E 2 HOH 2 302 6 HOH HOH B . E 2 HOH 3 303 12 HOH HOH B . E 2 HOH 4 304 3 HOH HOH B . E 2 HOH 5 305 2 HOH HOH B . E 2 HOH 6 306 11 HOH HOH B . E 2 HOH 7 307 5 HOH HOH B . E 2 HOH 8 308 1 HOH HOH B . F 2 HOH 1 301 10 HOH HOH C . F 2 HOH 2 302 8 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.041 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8K6P _cell.details ? _cell.formula_units_Z ? _cell.length_a 99.380 _cell.length_a_esd ? _cell.length_b 39.240 _cell.length_b_esd ? _cell.length_c 31.350 _cell.length_c_esd ? _cell.volume 121332.732 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8K6P _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8K6P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium acetate trihydrate, and 2.0 M ammonium sulfate (pH 4.5).' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-04-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL02U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL02U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 32.17 _reflns.entry_id 8K6P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.86 _reflns.d_resolution_low 36.46 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9723 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.86 _reflns_shell.d_res_low 1.92 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 866 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.622 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 87 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 52.95 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8K6P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.86 _refine.ls_d_res_low 25.20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9723 _refine.ls_number_reflns_R_free 458 _refine.ls_number_reflns_R_work 9265 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.47 _refine.ls_percent_reflns_R_free 4.71 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2208 _refine.ls_R_factor_R_free 0.2772 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2180 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.46 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 43.4000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2539 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.86 _refine_hist.d_res_low 25.20 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 990 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 978 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0053 ? 990 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6654 ? 1334 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0432 ? 159 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0039 ? 180 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 33.0258 ? 365 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.86 2.13 . . 133 2926 91.42 . . . . 0.3099 . . . . . . . . . . . 0.4325 'X-RAY DIFFRACTION' 2.13 2.68 . . 155 3138 97.17 . . . . 0.2600 . . . . . . . . . . . 0.3163 'X-RAY DIFFRACTION' 2.69 25.20 . . 170 3201 97.74 . . . . 0.1913 . . . . . . . . . . . 0.2468 # _struct.entry_id 8K6P _struct.title 'Crystal structure of SHARPIN LTM motif' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8K6P _struct_keywords.text 'SHARPIN, LTM, homodimer, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SHRPN_HUMAN _struct_ref.pdbx_db_accession Q9H0F6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQ _struct_ref.pdbx_align_begin 164 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8K6P A 2 ? 48 ? Q9H0F6 164 ? 210 ? 164 210 2 1 8K6P B 2 ? 48 ? Q9H0F6 164 ? 210 ? 164 210 3 1 8K6P C 2 ? 48 ? Q9H0F6 164 ? 210 ? 164 210 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8K6P TYR A 1 ? UNP Q9H0F6 ? ? 'expression tag' 163 1 2 8K6P TYR B 1 ? UNP Q9H0F6 ? ? 'expression tag' 163 2 3 8K6P TYR C 1 ? UNP Q9H0F6 ? ? 'expression tag' 163 3 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2570 ? 1 MORE -21 ? 1 'SSA (A^2)' 5470 ? 2 'ABSA (A^2)' 2550 ? 2 MORE -21 ? 2 'SSA (A^2)' 5340 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,D,E 2 1,2 C,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 8 ? GLY A 24 ? THR A 170 GLY A 186 1 ? 17 HELX_P HELX_P2 AA2 ASP A 25 ? HIS A 39 ? ASP A 187 HIS A 201 1 ? 15 HELX_P HELX_P3 AA3 SER B 3 ? LEU B 7 ? SER B 165 LEU B 169 5 ? 5 HELX_P HELX_P4 AA4 THR B 8 ? GLY B 24 ? THR B 170 GLY B 186 1 ? 17 HELX_P HELX_P5 AA5 ASP B 25 ? HIS B 39 ? ASP B 187 HIS B 201 1 ? 15 HELX_P HELX_P6 AA6 THR C 8 ? GLY C 24 ? THR C 170 GLY C 186 1 ? 17 HELX_P HELX_P7 AA7 ASP C 25 ? HIS C 39 ? ASP C 187 HIS C 201 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 43 ? LEU A 47 ? LEU A 205 LEU A 209 AA1 2 LEU B 43 ? LEU B 47 ? LEU B 205 LEU B 209 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 46 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 208 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 44 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 206 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 168 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 15.2319594696 -7.69182853759 3.61130499882 0.259389731208 ? 0.0270475846925 ? 0.0174474699132 ? 0.45759209057 ? 0.0203974602053 ? 0.32612345412 ? 8.90423231611 ? 0.267211861617 ? -0.032021768379 ? 8.76590817134 ? -2.05244252002 ? 8.14977111993 ? -0.00467504422431 ? 1.47991189467 ? 0.138121039299 ? -0.355670957853 ? 0.172147404122 ? -0.325214763096 ? -0.833402048326 ? -0.305424320848 ? -0.19497809592 ? 2 'X-RAY DIFFRACTION' ? refined 10.8231261696 -17.1581573366 6.625462485 0.267497355956 ? 0.0219422123573 ? -0.0393110640818 ? 0.270022574525 ? -0.0318827317431 ? 0.489705296107 ? 8.50005133442 ? -2.90247907817 ? -3.16811000322 ? 7.10982144878 ? 6.07003251004 ? 9.16767341065 ? 0.320944755724 ? 0.486385918243 ? -1.20832128663 ? -0.0790196243808 ? -0.254944804658 ? 0.171049203058 ? 0.531674047877 ? -0.346838472779 ? 0.0449567674673 ? 3 'X-RAY DIFFRACTION' ? refined 22.8524816896 -14.2212304327 3.22326600676 0.449483186935 ? 0.215418364168 ? 0.0433965589778 ? 1.01054064002 ? 0.0191561531814 ? 0.513110669699 ? 2.22565166613 ? 4.11642412445 ? 2.73509775765 ? 8.5876592618 ? 5.77085029901 ? 3.83917394655 ? -0.516579578354 ? 1.02285666555 ? -0.162493812459 ? -0.717886362626 ? 0.422367991531 ? 0.0599172656257 ? -0.338431592409 ? 1.42591494769 ? 0.408382647625 ? 4 'X-RAY DIFFRACTION' ? refined 36.4908004404 -21.2456835711 13.0976539329 0.479690691238 ? 0.0446913882097 ? -0.00833313370293 ? 0.707402062046 ? 0.0726033585252 ? 0.44025802169 ? 9.3201297971 ? 1.90304975182 ? -6.23688785159 ? 6.85559729688 ? -1.85431142491 ? 4.2562962901 ? 0.317830666769 ? 1.90061744442 ? 0.732965801089 ? -0.733159277697 ? -0.037537896961 ? -0.916349584115 ? -0.549500940996 ? 0.376816166217 ? -0.247475497999 ? 5 'X-RAY DIFFRACTION' ? refined 24.3352933885 -20.7641376589 9.0320726828 0.333963500601 ? 0.0583160651311 ? 0.0228752363951 ? 0.556617653903 ? -0.0897970562089 ? 0.598154070057 ? 5.85597613981 ? -1.30837187528 ? 5.85171046626 ? 6.49004573673 ? -1.82533807041 ? 5.98286521295 ? 0.173921998313 ? 0.764915682662 ? -0.892852684228 ? 0.159205548259 ? -0.195559759756 ? -0.00780488598586 ? 0.170358560356 ? 0.337058852182 ? -0.0549575446563 ? 6 'X-RAY DIFFRACTION' ? refined 15.5046292684 -22.0460262073 10.3788961188 0.373084424377 ? 0.00513772295794 ? -0.0272242465472 ? 0.383267756183 ? -0.129231567286 ? 0.702072446145 ? 9.38468271127 ? 1.82842884231 ? 5.56668667656 ? 9.00299647371 ? 4.77522064335 ? 4.92574252105 ? 0.645215364355 ? 0.484543449316 ? -2.22943064294 ? 0.0344917631364 ? 0.0248188992819 ? -0.138345196893 ? 0.662179620716 ? -0.327402080561 ? -0.836155113221 ? 7 'X-RAY DIFFRACTION' ? refined 21.4377978653 -10.8599373314 9.99297735238 0.38519553466 ? -0.104652477671 ? -0.00357394697588 ? 0.434005183551 ? -0.0505799830289 ? 0.444661784514 ? 7.78185435586 ? 2.01151237251 ? -3.88540697988 ? 6.82131590166 ? -4.40231757089 ? 5.9435285808 ? -0.433363168079 ? 0.901869979655 ? -0.00429807663172 ? -0.158148794355 ? 0.147552125184 ? -0.989504467336 ? -0.547205893938 ? 0.567682962244 ? 0.167965905002 ? 8 'X-RAY DIFFRACTION' ? refined 15.7252748575 0.348466826658 8.37793816281 0.597463609453 ? -0.278051777825 ? -0.0646617537613 ? 0.943186328855 ? 0.070014202571 ? 0.527215643581 ? 2.90357386486 ? 2.28427118084 ? 2.57240563449 ? 8.89755133465 ? -0.383151081513 ? 3.12150858467 ? -0.20386623111 ? 0.352402781123 ? 0.583610264777 ? -0.0205371353629 ? -0.0695462757881 ? -1.48463764099 ? -1.65850828382 ? 1.97735681683 ? 0.462405946426 ? 9 'X-RAY DIFFRACTION' ? refined 7.4673775894 -5.58077464761 1.47207680408 0.27208756899 ? -0.0206695920613 ? 0.0320996804279 ? 0.400148494039 ? 0.00937603398472 ? 0.324311161971 ? 8.67927440954 ? 1.41356205264 ? 5.26891797266 ? 6.64763215227 ? 1.53506840473 ? 3.32221550983 ? -0.0685770149321 ? 0.481248751475 ? 0.448949448709 ? -0.0414480547082 ? -0.107826242262 ? -0.262908133562 ? -0.478013954617 ? 1.03315333068 ? 0.181568955624 ? 10 'X-RAY DIFFRACTION' ? refined 3.52833897715 -13.4983560964 2.10433209277 0.229667993886 ? -0.0195620784173 ? -0.0117679863138 ? 0.399842902295 ? 0.00762295366263 ? 0.331488911355 ? 8.8074611068 ? -3.3850413047 ? -0.513031232897 ? 7.22698169819 ? -0.716704187048 ? 9.0712067954 ? 0.17877600206 ? 0.352736587354 ? -0.556512913151 ? -0.0823091720165 ? -0.455287392626 ? 0.000898864652731 ? 0.617525853268 ? 0.68674120318 ? 0.1258969448 ? 11 'X-RAY DIFFRACTION' ? refined -1.74986635815 -1.06962016868 2.18508295227 0.39872796985 ? -0.0488402013227 ? 0.00758311306392 ? 0.423038441421 ? -0.0375546415034 ? 0.349066462868 ? 8.83053595977 ? -4.05009410595 ? 2.96310700392 ? 8.49271159667 ? -3.91597873795 ? 2.51687380343 ? 0.132273580253 ? -0.0903647049757 ? 0.669953177267 ? 0.298224759131 ? 0.249836185032 ? 0.243781018175 ? -0.748898253505 ? 0.541826951441 ? 0.2961228229 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 168 through 185 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 186 through 200 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 201 through 210 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 163 through 170 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 171 through 185 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 186 through 201 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 202 through 210 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 166 through 170 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 171 through 185 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 186 through 201 ) ; 11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 202 through 210 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 163 ? A TYR 1 2 1 Y 1 A ARG 164 ? A ARG 2 3 1 Y 1 A SER 165 ? A SER 3 4 1 Y 1 A PRO 166 ? A PRO 4 5 1 Y 1 A GLY 167 ? A GLY 5 6 1 Y 1 C TYR 163 ? C TYR 1 7 1 Y 1 C ARG 164 ? C ARG 2 8 1 Y 1 C SER 165 ? C SER 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PRO N N N N 216 PRO CA C N S 217 PRO C C N N 218 PRO O O N N 219 PRO CB C N N 220 PRO CG C N N 221 PRO CD C N N 222 PRO OXT O N N 223 PRO H H N N 224 PRO HA H N N 225 PRO HB2 H N N 226 PRO HB3 H N N 227 PRO HG2 H N N 228 PRO HG3 H N N 229 PRO HD2 H N N 230 PRO HD3 H N N 231 PRO HXT H N N 232 SER N N N N 233 SER CA C N S 234 SER C C N N 235 SER O O N N 236 SER CB C N N 237 SER OG O N N 238 SER OXT O N N 239 SER H H N N 240 SER H2 H N N 241 SER HA H N N 242 SER HB2 H N N 243 SER HB3 H N N 244 SER HG H N N 245 SER HXT H N N 246 THR N N N N 247 THR CA C N S 248 THR C C N N 249 THR O O N N 250 THR CB C N R 251 THR OG1 O N N 252 THR CG2 C N N 253 THR OXT O N N 254 THR H H N N 255 THR H2 H N N 256 THR HA H N N 257 THR HB H N N 258 THR HG1 H N N 259 THR HG21 H N N 260 THR HG22 H N N 261 THR HG23 H N N 262 THR HXT H N N 263 TYR N N N N 264 TYR CA C N S 265 TYR C C N N 266 TYR O O N N 267 TYR CB C N N 268 TYR CG C Y N 269 TYR CD1 C Y N 270 TYR CD2 C Y N 271 TYR CE1 C Y N 272 TYR CE2 C Y N 273 TYR CZ C Y N 274 TYR OH O N N 275 TYR OXT O N N 276 TYR H H N N 277 TYR H2 H N N 278 TYR HA H N N 279 TYR HB2 H N N 280 TYR HB3 H N N 281 TYR HD1 H N N 282 TYR HD2 H N N 283 TYR HE1 H N N 284 TYR HE2 H N N 285 TYR HH H N N 286 TYR HXT H N N 287 VAL N N N N 288 VAL CA C N S 289 VAL C C N N 290 VAL O O N N 291 VAL CB C N N 292 VAL CG1 C N N 293 VAL CG2 C N N 294 VAL OXT O N N 295 VAL H H N N 296 VAL H2 H N N 297 VAL HA H N N 298 VAL HB H N N 299 VAL HG11 H N N 300 VAL HG12 H N N 301 VAL HG13 H N N 302 VAL HG21 H N N 303 VAL HG22 H N N 304 VAL HG23 H N N 305 VAL HXT H N N 306 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 THR N CA sing N N 235 THR N H sing N N 236 THR N H2 sing N N 237 THR CA C sing N N 238 THR CA CB sing N N 239 THR CA HA sing N N 240 THR C O doub N N 241 THR C OXT sing N N 242 THR CB OG1 sing N N 243 THR CB CG2 sing N N 244 THR CB HB sing N N 245 THR OG1 HG1 sing N N 246 THR CG2 HG21 sing N N 247 THR CG2 HG22 sing N N 248 THR CG2 HG23 sing N N 249 THR OXT HXT sing N N 250 TYR N CA sing N N 251 TYR N H sing N N 252 TYR N H2 sing N N 253 TYR CA C sing N N 254 TYR CA CB sing N N 255 TYR CA HA sing N N 256 TYR C O doub N N 257 TYR C OXT sing N N 258 TYR CB CG sing N N 259 TYR CB HB2 sing N N 260 TYR CB HB3 sing N N 261 TYR CG CD1 doub Y N 262 TYR CG CD2 sing Y N 263 TYR CD1 CE1 sing Y N 264 TYR CD1 HD1 sing N N 265 TYR CD2 CE2 doub Y N 266 TYR CD2 HD2 sing N N 267 TYR CE1 CZ doub Y N 268 TYR CE1 HE1 sing N N 269 TYR CE2 CZ sing Y N 270 TYR CE2 HE2 sing N N 271 TYR CZ OH sing N N 272 TYR OH HH sing N N 273 TYR OXT HXT sing N N 274 VAL N CA sing N N 275 VAL N H sing N N 276 VAL N H2 sing N N 277 VAL CA C sing N N 278 VAL CA CB sing N N 279 VAL CA HA sing N N 280 VAL C O doub N N 281 VAL C OXT sing N N 282 VAL CB CG1 sing N N 283 VAL CB CG2 sing N N 284 VAL CB HB sing N N 285 VAL CG1 HG11 sing N N 286 VAL CG1 HG12 sing N N 287 VAL CG1 HG13 sing N N 288 VAL CG2 HG21 sing N N 289 VAL CG2 HG22 sing N N 290 VAL CG2 HG23 sing N N 291 VAL OXT HXT sing N N 292 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 91753113 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5Y3T _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 8K6P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010062 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001243 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025484 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.032140 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_