data_8K9D # _entry.id 8K9D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8K9D pdb_00008k9d 10.2210/pdb8k9d/pdb WWPDB D_1300039736 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-08-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8K9D _pdbx_database_status.recvd_initial_deposition_date 2023-07-31 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email xmsong01@sibcb.ac.cn _pdbx_contact_author.name_first Xiaomin _pdbx_contact_author.name_last Song _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9721-0682 # _audit_author.name 'Song, X.M.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9721-0682 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural insights into the Caprin-2 HR1 domain in canonical Wnt signaling' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Song, X.M.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0000-0002-9721-0682 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Caprin-2 _entity.formula_weight 30547.910 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;C1q domain-containing protein 1,Cytoplasmic activation/proliferation-associated protein 2,Gastric cancer multidrug resistance-associated protein,Protein EEG-1,RNA granule protein 140 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)DSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLE FAKELQKTFSGLSLDLLKAQKKAQRREH(MSE)LKLEAEKKKLRT(MSE)LQVQYVLQNLTQEHVQKDFKGGLNGAVYLP SKE(MSE)DYLIKFSKLTCPERNESLSVEDQ(MSE)EQSSLYFWDLLEGSEKAVVGTTYKH(MSE)KDLLSKLLNSGYFE SIPVPKNAKEKEVPLEEE(MSE)LIQSEKKTQLSKTESVKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKE LQKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTMLQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKEMDYLIKFSK LTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKHMKDLLSKLLNSGYFESIPVPKNAKEKEVPLEEEMLIQSE KKTQLSKTESVKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASP n 1 3 SER n 1 4 PRO n 1 5 LEU n 1 6 GLN n 1 7 SER n 1 8 THR n 1 9 LEU n 1 10 SER n 1 11 SER n 1 12 ALA n 1 13 ALA n 1 14 SER n 1 15 PRO n 1 16 SER n 1 17 GLN n 1 18 ALA n 1 19 TYR n 1 20 GLU n 1 21 THR n 1 22 TYR n 1 23 ILE n 1 24 GLU n 1 25 ASN n 1 26 GLY n 1 27 LEU n 1 28 ILE n 1 29 CYS n 1 30 LEU n 1 31 LYS n 1 32 HIS n 1 33 LYS n 1 34 ILE n 1 35 ARG n 1 36 ASN n 1 37 ILE n 1 38 GLU n 1 39 LYS n 1 40 LYS n 1 41 LYS n 1 42 LEU n 1 43 LYS n 1 44 LEU n 1 45 GLU n 1 46 ASP n 1 47 TYR n 1 48 LYS n 1 49 ASP n 1 50 ARG n 1 51 LEU n 1 52 LYS n 1 53 SER n 1 54 GLY n 1 55 GLU n 1 56 HIS n 1 57 LEU n 1 58 ASN n 1 59 PRO n 1 60 ASP n 1 61 GLN n 1 62 LEU n 1 63 GLU n 1 64 ALA n 1 65 VAL n 1 66 GLU n 1 67 LYS n 1 68 TYR n 1 69 GLU n 1 70 GLU n 1 71 VAL n 1 72 LEU n 1 73 HIS n 1 74 ASN n 1 75 LEU n 1 76 GLU n 1 77 PHE n 1 78 ALA n 1 79 LYS n 1 80 GLU n 1 81 LEU n 1 82 GLN n 1 83 LYS n 1 84 THR n 1 85 PHE n 1 86 SER n 1 87 GLY n 1 88 LEU n 1 89 SER n 1 90 LEU n 1 91 ASP n 1 92 LEU n 1 93 LEU n 1 94 LYS n 1 95 ALA n 1 96 GLN n 1 97 LYS n 1 98 LYS n 1 99 ALA n 1 100 GLN n 1 101 ARG n 1 102 ARG n 1 103 GLU n 1 104 HIS n 1 105 MSE n 1 106 LEU n 1 107 LYS n 1 108 LEU n 1 109 GLU n 1 110 ALA n 1 111 GLU n 1 112 LYS n 1 113 LYS n 1 114 LYS n 1 115 LEU n 1 116 ARG n 1 117 THR n 1 118 MSE n 1 119 LEU n 1 120 GLN n 1 121 VAL n 1 122 GLN n 1 123 TYR n 1 124 VAL n 1 125 LEU n 1 126 GLN n 1 127 ASN n 1 128 LEU n 1 129 THR n 1 130 GLN n 1 131 GLU n 1 132 HIS n 1 133 VAL n 1 134 GLN n 1 135 LYS n 1 136 ASP n 1 137 PHE n 1 138 LYS n 1 139 GLY n 1 140 GLY n 1 141 LEU n 1 142 ASN n 1 143 GLY n 1 144 ALA n 1 145 VAL n 1 146 TYR n 1 147 LEU n 1 148 PRO n 1 149 SER n 1 150 LYS n 1 151 GLU n 1 152 MSE n 1 153 ASP n 1 154 TYR n 1 155 LEU n 1 156 ILE n 1 157 LYS n 1 158 PHE n 1 159 SER n 1 160 LYS n 1 161 LEU n 1 162 THR n 1 163 CYS n 1 164 PRO n 1 165 GLU n 1 166 ARG n 1 167 ASN n 1 168 GLU n 1 169 SER n 1 170 LEU n 1 171 SER n 1 172 VAL n 1 173 GLU n 1 174 ASP n 1 175 GLN n 1 176 MSE n 1 177 GLU n 1 178 GLN n 1 179 SER n 1 180 SER n 1 181 LEU n 1 182 TYR n 1 183 PHE n 1 184 TRP n 1 185 ASP n 1 186 LEU n 1 187 LEU n 1 188 GLU n 1 189 GLY n 1 190 SER n 1 191 GLU n 1 192 LYS n 1 193 ALA n 1 194 VAL n 1 195 VAL n 1 196 GLY n 1 197 THR n 1 198 THR n 1 199 TYR n 1 200 LYS n 1 201 HIS n 1 202 MSE n 1 203 LYS n 1 204 ASP n 1 205 LEU n 1 206 LEU n 1 207 SER n 1 208 LYS n 1 209 LEU n 1 210 LEU n 1 211 ASN n 1 212 SER n 1 213 GLY n 1 214 TYR n 1 215 PHE n 1 216 GLU n 1 217 SER n 1 218 ILE n 1 219 PRO n 1 220 VAL n 1 221 PRO n 1 222 LYS n 1 223 ASN n 1 224 ALA n 1 225 LYS n 1 226 GLU n 1 227 LYS n 1 228 GLU n 1 229 VAL n 1 230 PRO n 1 231 LEU n 1 232 GLU n 1 233 GLU n 1 234 GLU n 1 235 MSE n 1 236 LEU n 1 237 ILE n 1 238 GLN n 1 239 SER n 1 240 GLU n 1 241 LYS n 1 242 LYS n 1 243 THR n 1 244 GLN n 1 245 LEU n 1 246 SER n 1 247 LYS n 1 248 THR n 1 249 GLU n 1 250 SER n 1 251 VAL n 1 252 LYS n 1 253 LEU n 1 254 GLU n 1 255 HIS n 1 256 HIS n 1 257 HIS n 1 258 HIS n 1 259 HIS n 1 260 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 260 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CAPRIN2, C1QDC1, EEG1, KIAA1873, RNG140' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 100 ? ? ? A . n A 1 2 ASP 2 101 ? ? ? A . n A 1 3 SER 3 102 ? ? ? A . n A 1 4 PRO 4 103 ? ? ? A . n A 1 5 LEU 5 104 ? ? ? A . n A 1 6 GLN 6 105 ? ? ? A . n A 1 7 SER 7 106 ? ? ? A . n A 1 8 THR 8 107 ? ? ? A . n A 1 9 LEU 9 108 ? ? ? A . n A 1 10 SER 10 109 ? ? ? A . n A 1 11 SER 11 110 ? ? ? A . n A 1 12 ALA 12 111 ? ? ? A . n A 1 13 ALA 13 112 ? ? ? A . n A 1 14 SER 14 113 ? ? ? A . n A 1 15 PRO 15 114 ? ? ? A . n A 1 16 SER 16 115 ? ? ? A . n A 1 17 GLN 17 116 ? ? ? A . n A 1 18 ALA 18 117 ? ? ? A . n A 1 19 TYR 19 118 ? ? ? A . n A 1 20 GLU 20 119 ? ? ? A . n A 1 21 THR 21 120 ? ? ? A . n A 1 22 TYR 22 121 ? ? ? A . n A 1 23 ILE 23 122 ? ? ? A . n A 1 24 GLU 24 123 ? ? ? A . n A 1 25 ASN 25 124 ? ? ? A . n A 1 26 GLY 26 125 ? ? ? A . n A 1 27 LEU 27 126 ? ? ? A . n A 1 28 ILE 28 127 ? ? ? A . n A 1 29 CYS 29 128 ? ? ? A . n A 1 30 LEU 30 129 ? ? ? A . n A 1 31 LYS 31 130 ? ? ? A . n A 1 32 HIS 32 131 ? ? ? A . n A 1 33 LYS 33 132 ? ? ? A . n A 1 34 ILE 34 133 ? ? ? A . n A 1 35 ARG 35 134 ? ? ? A . n A 1 36 ASN 36 135 ? ? ? A . n A 1 37 ILE 37 136 ? ? ? A . n A 1 38 GLU 38 137 ? ? ? A . n A 1 39 LYS 39 138 ? ? ? A . n A 1 40 LYS 40 139 ? ? ? A . n A 1 41 LYS 41 140 ? ? ? A . n A 1 42 LEU 42 141 ? ? ? A . n A 1 43 LYS 43 142 ? ? ? A . n A 1 44 LEU 44 143 ? ? ? A . n A 1 45 GLU 45 144 ? ? ? A . n A 1 46 ASP 46 145 ? ? ? A . n A 1 47 TYR 47 146 ? ? ? A . n A 1 48 LYS 48 147 ? ? ? A . n A 1 49 ASP 49 148 ? ? ? A . n A 1 50 ARG 50 149 ? ? ? A . n A 1 51 LEU 51 150 ? ? ? A . n A 1 52 LYS 52 151 ? ? ? A . n A 1 53 SER 53 152 ? ? ? A . n A 1 54 GLY 54 153 ? ? ? A . n A 1 55 GLU 55 154 ? ? ? A . n A 1 56 HIS 56 155 ? ? ? A . n A 1 57 LEU 57 156 ? ? ? A . n A 1 58 ASN 58 157 ? ? ? A . n A 1 59 PRO 59 158 ? ? ? A . n A 1 60 ASP 60 159 ? ? ? A . n A 1 61 GLN 61 160 ? ? ? A . n A 1 62 LEU 62 161 ? ? ? A . n A 1 63 GLU 63 162 ? ? ? A . n A 1 64 ALA 64 163 ? ? ? A . n A 1 65 VAL 65 164 ? ? ? A . n A 1 66 GLU 66 165 ? ? ? A . n A 1 67 LYS 67 166 ? ? ? A . n A 1 68 TYR 68 167 ? ? ? A . n A 1 69 GLU 69 168 ? ? ? A . n A 1 70 GLU 70 169 ? ? ? A . n A 1 71 VAL 71 170 ? ? ? A . n A 1 72 LEU 72 171 ? ? ? A . n A 1 73 HIS 73 172 ? ? ? A . n A 1 74 ASN 74 173 ? ? ? A . n A 1 75 LEU 75 174 ? ? ? A . n A 1 76 GLU 76 175 ? ? ? A . n A 1 77 PHE 77 176 ? ? ? A . n A 1 78 ALA 78 177 ? ? ? A . n A 1 79 LYS 79 178 ? ? ? A . n A 1 80 GLU 80 179 ? ? ? A . n A 1 81 LEU 81 180 ? ? ? A . n A 1 82 GLN 82 181 ? ? ? A . n A 1 83 LYS 83 182 ? ? ? A . n A 1 84 THR 84 183 ? ? ? A . n A 1 85 PHE 85 184 ? ? ? A . n A 1 86 SER 86 185 ? ? ? A . n A 1 87 GLY 87 186 ? ? ? A . n A 1 88 LEU 88 187 ? ? ? A . n A 1 89 SER 89 188 ? ? ? A . n A 1 90 LEU 90 189 ? ? ? A . n A 1 91 ASP 91 190 ? ? ? A . n A 1 92 LEU 92 191 ? ? ? A . n A 1 93 LEU 93 192 ? ? ? A . n A 1 94 LYS 94 193 ? ? ? A . n A 1 95 ALA 95 194 ? ? ? A . n A 1 96 GLN 96 195 ? ? ? A . n A 1 97 LYS 97 196 196 LYS LYS A . n A 1 98 LYS 98 197 197 LYS LYS A . n A 1 99 ALA 99 198 198 ALA ALA A . n A 1 100 GLN 100 199 199 GLN GLN A . n A 1 101 ARG 101 200 200 ARG ARG A . n A 1 102 ARG 102 201 201 ARG ARG A . n A 1 103 GLU 103 202 202 GLU GLU A . n A 1 104 HIS 104 203 203 HIS HIS A . n A 1 105 MSE 105 204 204 MSE MSE A . n A 1 106 LEU 106 205 205 LEU LEU A . n A 1 107 LYS 107 206 206 LYS LYS A . n A 1 108 LEU 108 207 207 LEU LEU A . n A 1 109 GLU 109 208 208 GLU GLU A . n A 1 110 ALA 110 209 209 ALA ALA A . n A 1 111 GLU 111 210 210 GLU GLU A . n A 1 112 LYS 112 211 211 LYS LYS A . n A 1 113 LYS 113 212 212 LYS LYS A . n A 1 114 LYS 114 213 213 LYS LYS A . n A 1 115 LEU 115 214 214 LEU LEU A . n A 1 116 ARG 116 215 215 ARG ARG A . n A 1 117 THR 117 216 216 THR THR A . n A 1 118 MSE 118 217 217 MSE MSE A . n A 1 119 LEU 119 218 218 LEU LEU A . n A 1 120 GLN 120 219 219 GLN GLN A . n A 1 121 VAL 121 220 220 VAL VAL A . n A 1 122 GLN 122 221 221 GLN GLN A . n A 1 123 TYR 123 222 222 TYR TYR A . n A 1 124 VAL 124 223 223 VAL VAL A . n A 1 125 LEU 125 224 224 LEU LEU A . n A 1 126 GLN 126 225 225 GLN GLN A . n A 1 127 ASN 127 226 226 ASN ASN A . n A 1 128 LEU 128 227 227 LEU LEU A . n A 1 129 THR 129 228 228 THR THR A . n A 1 130 GLN 130 229 229 GLN GLN A . n A 1 131 GLU 131 230 230 GLU GLU A . n A 1 132 HIS 132 231 231 HIS HIS A . n A 1 133 VAL 133 232 232 VAL VAL A . n A 1 134 GLN 134 233 233 GLN GLN A . n A 1 135 LYS 135 234 234 LYS LYS A . n A 1 136 ASP 136 235 235 ASP ASP A . n A 1 137 PHE 137 236 236 PHE PHE A . n A 1 138 LYS 138 237 237 LYS LYS A . n A 1 139 GLY 139 238 238 GLY GLY A . n A 1 140 GLY 140 239 239 GLY GLY A . n A 1 141 LEU 141 240 240 LEU LEU A . n A 1 142 ASN 142 241 241 ASN ASN A . n A 1 143 GLY 143 242 242 GLY GLY A . n A 1 144 ALA 144 243 243 ALA ALA A . n A 1 145 VAL 145 244 244 VAL VAL A . n A 1 146 TYR 146 245 245 TYR TYR A . n A 1 147 LEU 147 246 246 LEU LEU A . n A 1 148 PRO 148 247 247 PRO PRO A . n A 1 149 SER 149 248 248 SER SER A . n A 1 150 LYS 150 249 249 LYS LYS A . n A 1 151 GLU 151 250 250 GLU GLU A . n A 1 152 MSE 152 251 251 MSE MSE A . n A 1 153 ASP 153 252 252 ASP ASP A . n A 1 154 TYR 154 253 253 TYR TYR A . n A 1 155 LEU 155 254 254 LEU LEU A . n A 1 156 ILE 156 255 255 ILE ILE A . n A 1 157 LYS 157 256 256 LYS LYS A . n A 1 158 PHE 158 257 257 PHE PHE A . n A 1 159 SER 159 258 258 SER SER A . n A 1 160 LYS 160 259 259 LYS LYS A . n A 1 161 LEU 161 260 260 LEU LEU A . n A 1 162 THR 162 261 261 THR THR A . n A 1 163 CYS 163 262 262 CYS CYS A . n A 1 164 PRO 164 263 263 PRO PRO A . n A 1 165 GLU 165 264 264 GLU GLU A . n A 1 166 ARG 166 265 265 ARG ARG A . n A 1 167 ASN 167 266 266 ASN ASN A . n A 1 168 GLU 168 267 267 GLU GLU A . n A 1 169 SER 169 268 268 SER SER A . n A 1 170 LEU 170 269 269 LEU LEU A . n A 1 171 SER 171 270 270 SER SER A . n A 1 172 VAL 172 271 271 VAL VAL A . n A 1 173 GLU 173 272 272 GLU GLU A . n A 1 174 ASP 174 273 273 ASP ASP A . n A 1 175 GLN 175 274 274 GLN GLN A . n A 1 176 MSE 176 275 275 MSE MSE A . n A 1 177 GLU 177 276 276 GLU GLU A . n A 1 178 GLN 178 277 277 GLN GLN A . n A 1 179 SER 179 278 278 SER SER A . n A 1 180 SER 180 279 279 SER SER A . n A 1 181 LEU 181 280 280 LEU LEU A . n A 1 182 TYR 182 281 281 TYR TYR A . n A 1 183 PHE 183 282 282 PHE PHE A . n A 1 184 TRP 184 283 283 TRP TRP A . n A 1 185 ASP 185 284 284 ASP ASP A . n A 1 186 LEU 186 285 285 LEU LEU A . n A 1 187 LEU 187 286 286 LEU LEU A . n A 1 188 GLU 188 287 287 GLU GLU A . n A 1 189 GLY 189 288 288 GLY GLY A . n A 1 190 SER 190 289 289 SER SER A . n A 1 191 GLU 191 290 290 GLU GLU A . n A 1 192 LYS 192 291 291 LYS LYS A . n A 1 193 ALA 193 292 292 ALA ALA A . n A 1 194 VAL 194 293 293 VAL VAL A . n A 1 195 VAL 195 294 294 VAL VAL A . n A 1 196 GLY 196 295 295 GLY GLY A . n A 1 197 THR 197 296 296 THR THR A . n A 1 198 THR 198 297 297 THR THR A . n A 1 199 TYR 199 298 298 TYR TYR A . n A 1 200 LYS 200 299 299 LYS LYS A . n A 1 201 HIS 201 300 300 HIS HIS A . n A 1 202 MSE 202 301 301 MSE MSE A . n A 1 203 LYS 203 302 302 LYS LYS A . n A 1 204 ASP 204 303 303 ASP ASP A . n A 1 205 LEU 205 304 304 LEU LEU A . n A 1 206 LEU 206 305 305 LEU LEU A . n A 1 207 SER 207 306 306 SER SER A . n A 1 208 LYS 208 307 307 LYS LYS A . n A 1 209 LEU 209 308 308 LEU LEU A . n A 1 210 LEU 210 309 309 LEU LEU A . n A 1 211 ASN 211 310 310 ASN ASN A . n A 1 212 SER 212 311 311 SER SER A . n A 1 213 GLY 213 312 312 GLY GLY A . n A 1 214 TYR 214 313 313 TYR TYR A . n A 1 215 PHE 215 314 314 PHE PHE A . n A 1 216 GLU 216 315 315 GLU GLU A . n A 1 217 SER 217 316 316 SER SER A . n A 1 218 ILE 218 317 317 ILE ILE A . n A 1 219 PRO 219 318 318 PRO PRO A . n A 1 220 VAL 220 319 ? ? ? A . n A 1 221 PRO 221 320 ? ? ? A . n A 1 222 LYS 222 321 ? ? ? A . n A 1 223 ASN 223 322 ? ? ? A . n A 1 224 ALA 224 323 ? ? ? A . n A 1 225 LYS 225 324 ? ? ? A . n A 1 226 GLU 226 325 ? ? ? A . n A 1 227 LYS 227 326 ? ? ? A . n A 1 228 GLU 228 327 ? ? ? A . n A 1 229 VAL 229 328 ? ? ? A . n A 1 230 PRO 230 329 ? ? ? A . n A 1 231 LEU 231 330 ? ? ? A . n A 1 232 GLU 232 331 ? ? ? A . n A 1 233 GLU 233 332 ? ? ? A . n A 1 234 GLU 234 333 ? ? ? A . n A 1 235 MSE 235 334 ? ? ? A . n A 1 236 LEU 236 335 ? ? ? A . n A 1 237 ILE 237 336 ? ? ? A . n A 1 238 GLN 238 337 ? ? ? A . n A 1 239 SER 239 338 ? ? ? A . n A 1 240 GLU 240 339 ? ? ? A . n A 1 241 LYS 241 340 ? ? ? A . n A 1 242 LYS 242 341 ? ? ? A . n A 1 243 THR 243 342 ? ? ? A . n A 1 244 GLN 244 343 ? ? ? A . n A 1 245 LEU 245 344 ? ? ? A . n A 1 246 SER 246 345 ? ? ? A . n A 1 247 LYS 247 346 ? ? ? A . n A 1 248 THR 248 347 ? ? ? A . n A 1 249 GLU 249 348 ? ? ? A . n A 1 250 SER 250 349 ? ? ? A . n A 1 251 VAL 251 350 ? ? ? A . n A 1 252 LYS 252 351 ? ? ? A . n A 1 253 LEU 253 352 ? ? ? A . n A 1 254 GLU 254 353 ? ? ? A . n A 1 255 HIS 255 354 ? ? ? A . n A 1 256 HIS 256 355 ? ? ? A . n A 1 257 HIS 257 356 ? ? ? A . n A 1 258 HIS 258 357 ? ? ? A . n A 1 259 HIS 259 358 ? ? ? A . n A 1 260 HIS 260 359 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 196 ? CG ? A LYS 97 CG 2 1 Y 1 A LYS 196 ? CD ? A LYS 97 CD 3 1 Y 1 A LYS 196 ? CE ? A LYS 97 CE 4 1 Y 1 A LYS 196 ? NZ ? A LYS 97 NZ 5 1 Y 1 A LYS 197 ? CG ? A LYS 98 CG 6 1 Y 1 A LYS 197 ? CD ? A LYS 98 CD 7 1 Y 1 A LYS 197 ? CE ? A LYS 98 CE 8 1 Y 1 A LYS 197 ? NZ ? A LYS 98 NZ 9 1 Y 1 A GLN 199 ? CG ? A GLN 100 CG 10 1 Y 1 A GLN 199 ? CD ? A GLN 100 CD 11 1 Y 1 A GLN 199 ? OE1 ? A GLN 100 OE1 12 1 Y 1 A GLN 199 ? NE2 ? A GLN 100 NE2 13 1 Y 1 A ARG 200 ? CG ? A ARG 101 CG 14 1 Y 1 A ARG 200 ? CD ? A ARG 101 CD 15 1 Y 1 A ARG 200 ? NE ? A ARG 101 NE 16 1 Y 1 A ARG 200 ? CZ ? A ARG 101 CZ 17 1 Y 1 A ARG 200 ? NH1 ? A ARG 101 NH1 18 1 Y 1 A ARG 200 ? NH2 ? A ARG 101 NH2 19 1 Y 1 A ARG 201 ? CG ? A ARG 102 CG 20 1 Y 1 A ARG 201 ? CD ? A ARG 102 CD 21 1 Y 1 A ARG 201 ? NE ? A ARG 102 NE 22 1 Y 1 A ARG 201 ? CZ ? A ARG 102 CZ 23 1 Y 1 A ARG 201 ? NH1 ? A ARG 102 NH1 24 1 Y 1 A ARG 201 ? NH2 ? A ARG 102 NH2 25 1 Y 1 A GLU 202 ? CG ? A GLU 103 CG 26 1 Y 1 A GLU 202 ? CD ? A GLU 103 CD 27 1 Y 1 A GLU 202 ? OE1 ? A GLU 103 OE1 28 1 Y 1 A GLU 202 ? OE2 ? A GLU 103 OE2 29 1 Y 1 A HIS 203 ? CG ? A HIS 104 CG 30 1 Y 1 A HIS 203 ? ND1 ? A HIS 104 ND1 31 1 Y 1 A HIS 203 ? CD2 ? A HIS 104 CD2 32 1 Y 1 A HIS 203 ? CE1 ? A HIS 104 CE1 33 1 Y 1 A HIS 203 ? NE2 ? A HIS 104 NE2 34 1 Y 1 A MSE 204 ? CG ? A MSE 105 CG 35 1 Y 1 A MSE 204 ? SE ? A MSE 105 SE 36 1 Y 1 A MSE 204 ? CE ? A MSE 105 CE 37 1 Y 1 A LEU 205 ? CG ? A LEU 106 CG 38 1 Y 1 A LEU 205 ? CD1 ? A LEU 106 CD1 39 1 Y 1 A LEU 205 ? CD2 ? A LEU 106 CD2 40 1 Y 1 A LYS 206 ? CG ? A LYS 107 CG 41 1 Y 1 A LYS 206 ? CD ? A LYS 107 CD 42 1 Y 1 A LYS 206 ? CE ? A LYS 107 CE 43 1 Y 1 A LYS 206 ? NZ ? A LYS 107 NZ 44 1 Y 1 A LEU 207 ? CG ? A LEU 108 CG 45 1 Y 1 A LEU 207 ? CD1 ? A LEU 108 CD1 46 1 Y 1 A LEU 207 ? CD2 ? A LEU 108 CD2 47 1 Y 1 A GLU 208 ? CG ? A GLU 109 CG 48 1 Y 1 A GLU 208 ? CD ? A GLU 109 CD 49 1 Y 1 A GLU 208 ? OE1 ? A GLU 109 OE1 50 1 Y 1 A GLU 208 ? OE2 ? A GLU 109 OE2 51 1 Y 1 A GLU 210 ? CG ? A GLU 111 CG 52 1 Y 1 A GLU 210 ? CD ? A GLU 111 CD 53 1 Y 1 A GLU 210 ? OE1 ? A GLU 111 OE1 54 1 Y 1 A GLU 210 ? OE2 ? A GLU 111 OE2 55 1 Y 1 A LYS 211 ? CG ? A LYS 112 CG 56 1 Y 1 A LYS 211 ? CD ? A LYS 112 CD 57 1 Y 1 A LYS 211 ? CE ? A LYS 112 CE 58 1 Y 1 A LYS 211 ? NZ ? A LYS 112 NZ 59 1 Y 1 A LYS 212 ? CG ? A LYS 113 CG 60 1 Y 1 A LYS 212 ? CD ? A LYS 113 CD 61 1 Y 1 A LYS 212 ? CE ? A LYS 113 CE 62 1 Y 1 A LYS 212 ? NZ ? A LYS 113 NZ 63 1 Y 1 A LYS 213 ? CG ? A LYS 114 CG 64 1 Y 1 A LYS 213 ? CD ? A LYS 114 CD 65 1 Y 1 A LYS 213 ? CE ? A LYS 114 CE 66 1 Y 1 A LYS 213 ? NZ ? A LYS 114 NZ 67 1 Y 1 A LEU 214 ? CG ? A LEU 115 CG 68 1 Y 1 A LEU 214 ? CD1 ? A LEU 115 CD1 69 1 Y 1 A LEU 214 ? CD2 ? A LEU 115 CD2 70 1 Y 1 A ARG 215 ? CG ? A ARG 116 CG 71 1 Y 1 A ARG 215 ? CD ? A ARG 116 CD 72 1 Y 1 A ARG 215 ? NE ? A ARG 116 NE 73 1 Y 1 A ARG 215 ? CZ ? A ARG 116 CZ 74 1 Y 1 A ARG 215 ? NH1 ? A ARG 116 NH1 75 1 Y 1 A ARG 215 ? NH2 ? A ARG 116 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8K9D _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.852 _cell.length_a_esd ? _cell.length_b 281.903 _cell.length_b_esd ? _cell.length_c 63.449 _cell.length_c_esd ? _cell.volume 1016881.220 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8K9D _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8K9D _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 70.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20-25% PEG3350, 1.6M potassium thiocyanate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-05-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97922 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97922 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8K9D _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.11 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14540 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 17.30 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.116 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.11 _reflns_shell.d_res_low 3.66 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 408 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.782 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8K9D _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.30 _refine.ls_d_res_low 35.24 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14540 _refine.ls_number_reflns_R_free 1457 _refine.ls_number_reflns_R_work 13083 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.99 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2907 _refine.ls_R_factor_R_free 0.3022 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2895 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 43.5508 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5250 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.30 _refine_hist.d_res_low 35.24 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 931 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 931 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0027 ? 947 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5758 ? 1281 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0361 ? 146 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0038 ? 164 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.5995 ? 129 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.30 3.42 . . 136 1200 89.60 . . . . 0.4109 . . . . . . . . . . . 0.4842 'X-RAY DIFFRACTION' 3.42 3.56 . . 148 1344 99.20 . . . . 0.3644 . . . . . . . . . . . 0.4210 'X-RAY DIFFRACTION' 3.56 3.72 . . 139 1308 98.50 . . . . 0.4135 . . . . . . . . . . . 0.4707 'X-RAY DIFFRACTION' 3.72 3.91 . . 148 1322 99.39 . . . . 0.3298 . . . . . . . . . . . 0.3676 'X-RAY DIFFRACTION' 3.91 4.16 . . 150 1310 99.79 . . . . 0.2867 . . . . . . . . . . . 0.3620 'X-RAY DIFFRACTION' 4.16 4.48 . . 149 1354 99.80 . . . . 0.2366 . . . . . . . . . . . 0.2324 'X-RAY DIFFRACTION' 4.48 4.93 . . 147 1315 99.66 . . . . 0.2561 . . . . . . . . . . . 0.2636 'X-RAY DIFFRACTION' 4.93 5.64 . . 149 1334 99.40 . . . . 0.3174 . . . . . . . . . . . 0.2952 'X-RAY DIFFRACTION' 5.64 7.09 . . 151 1329 99.80 . . . . 0.3475 . . . . . . . . . . . 0.3386 'X-RAY DIFFRACTION' 7.10 35.24 . . 140 1267 94.88 . . . . 0.2375 . . . . . . . . . . . 0.2502 # _struct.entry_id 8K9D _struct.title 'Structure of human Caprin-2 HR1 domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8K9D _struct_keywords.text 'Wnt signaling, homodimer, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAPR2_HUMAN _struct_ref.pdbx_db_accession Q6IMN6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKELQ KTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLT CPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKHLKDLLSKLLNSGYFESIPVPKNAKEKEVPLEEEMLIQSEKK TQLSKTESVK ; _struct_ref.pdbx_align_begin 102 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8K9D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 252 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6IMN6 _struct_ref_seq.db_align_beg 102 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 351 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 102 _struct_ref_seq.pdbx_auth_seq_align_end 351 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8K9D MSE A 1 ? UNP Q6IMN6 ? ? 'initiating methionine' 100 1 1 8K9D ASP A 2 ? UNP Q6IMN6 ? ? 'expression tag' 101 2 1 8K9D MSE A 118 ? UNP Q6IMN6 ILE 217 conflict 217 3 1 8K9D MSE A 152 ? UNP Q6IMN6 LEU 251 conflict 251 4 1 8K9D MSE A 202 ? UNP Q6IMN6 LEU 301 conflict 301 5 1 8K9D LEU A 253 ? UNP Q6IMN6 ? ? 'expression tag' 352 6 1 8K9D GLU A 254 ? UNP Q6IMN6 ? ? 'expression tag' 353 7 1 8K9D HIS A 255 ? UNP Q6IMN6 ? ? 'expression tag' 354 8 1 8K9D HIS A 256 ? UNP Q6IMN6 ? ? 'expression tag' 355 9 1 8K9D HIS A 257 ? UNP Q6IMN6 ? ? 'expression tag' 356 10 1 8K9D HIS A 258 ? UNP Q6IMN6 ? ? 'expression tag' 357 11 1 8K9D HIS A 259 ? UNP Q6IMN6 ? ? 'expression tag' 358 12 1 8K9D HIS A 260 ? UNP Q6IMN6 ? ? 'expression tag' 359 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2060 ? 1 MORE -17 ? 1 'SSA (A^2)' 13500 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 31.7245000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 97 ? THR A 129 ? LYS A 196 THR A 228 1 ? 33 HELX_P HELX_P2 AA2 GLN A 130 ? LYS A 135 ? GLN A 229 LYS A 234 1 ? 6 HELX_P HELX_P3 AA3 ASP A 136 ? GLY A 139 ? ASP A 235 GLY A 238 5 ? 4 HELX_P HELX_P4 AA4 PRO A 148 ? CYS A 163 ? PRO A 247 CYS A 262 1 ? 16 HELX_P HELX_P5 AA5 SER A 171 ? GLU A 188 ? SER A 270 GLU A 287 1 ? 18 HELX_P HELX_P6 AA6 TYR A 199 ? LEU A 210 ? TYR A 298 LEU A 309 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 104 C ? ? ? 1_555 A MSE 105 N ? ? A HIS 203 A MSE 204 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A MSE 105 C ? ? ? 1_555 A LEU 106 N ? ? A MSE 204 A LEU 205 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? A THR 117 C ? ? ? 1_555 A MSE 118 N ? ? A THR 216 A MSE 217 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 118 C ? ? ? 1_555 A LEU 119 N ? ? A MSE 217 A LEU 218 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? A GLU 151 C ? ? ? 1_555 A MSE 152 N ? ? A GLU 250 A MSE 251 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A MSE 152 C ? ? ? 1_555 A ASP 153 N ? ? A MSE 251 A ASP 252 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale7 covale both ? A GLN 175 C ? ? ? 1_555 A MSE 176 N ? ? A GLN 274 A MSE 275 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale8 covale both ? A MSE 176 C ? ? ? 1_555 A GLU 177 N ? ? A MSE 275 A GLU 276 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale9 covale both ? A HIS 201 C ? ? ? 1_555 A MSE 202 N ? ? A HIS 300 A MSE 301 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale10 covale both ? A MSE 202 C ? ? ? 1_555 A LYS 203 N ? ? A MSE 301 A LYS 302 1_555 ? ? ? ? ? ? ? 1.335 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 193 ? VAL A 194 ? ALA A 292 VAL A 293 AA1 2 THR A 197 ? THR A 198 ? THR A 296 THR A 297 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 194 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 293 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 197 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 296 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 241 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -150.48 _pdbx_validate_torsion.psi 40.64 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 105 A MSE 204 ? MET 'modified residue' 2 A MSE 176 A MSE 275 ? MET 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 8K9D _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 100 ? A MSE 1 2 1 Y 1 A ASP 101 ? A ASP 2 3 1 Y 1 A SER 102 ? A SER 3 4 1 Y 1 A PRO 103 ? A PRO 4 5 1 Y 1 A LEU 104 ? A LEU 5 6 1 Y 1 A GLN 105 ? A GLN 6 7 1 Y 1 A SER 106 ? A SER 7 8 1 Y 1 A THR 107 ? A THR 8 9 1 Y 1 A LEU 108 ? A LEU 9 10 1 Y 1 A SER 109 ? A SER 10 11 1 Y 1 A SER 110 ? A SER 11 12 1 Y 1 A ALA 111 ? A ALA 12 13 1 Y 1 A ALA 112 ? A ALA 13 14 1 Y 1 A SER 113 ? A SER 14 15 1 Y 1 A PRO 114 ? A PRO 15 16 1 Y 1 A SER 115 ? A SER 16 17 1 Y 1 A GLN 116 ? A GLN 17 18 1 Y 1 A ALA 117 ? A ALA 18 19 1 Y 1 A TYR 118 ? A TYR 19 20 1 Y 1 A GLU 119 ? A GLU 20 21 1 Y 1 A THR 120 ? A THR 21 22 1 Y 1 A TYR 121 ? A TYR 22 23 1 Y 1 A ILE 122 ? A ILE 23 24 1 Y 1 A GLU 123 ? A GLU 24 25 1 Y 1 A ASN 124 ? A ASN 25 26 1 Y 1 A GLY 125 ? A GLY 26 27 1 Y 1 A LEU 126 ? A LEU 27 28 1 Y 1 A ILE 127 ? A ILE 28 29 1 Y 1 A CYS 128 ? A CYS 29 30 1 Y 1 A LEU 129 ? A LEU 30 31 1 Y 1 A LYS 130 ? A LYS 31 32 1 Y 1 A HIS 131 ? A HIS 32 33 1 Y 1 A LYS 132 ? A LYS 33 34 1 Y 1 A ILE 133 ? A ILE 34 35 1 Y 1 A ARG 134 ? A ARG 35 36 1 Y 1 A ASN 135 ? A ASN 36 37 1 Y 1 A ILE 136 ? A ILE 37 38 1 Y 1 A GLU 137 ? A GLU 38 39 1 Y 1 A LYS 138 ? A LYS 39 40 1 Y 1 A LYS 139 ? A LYS 40 41 1 Y 1 A LYS 140 ? A LYS 41 42 1 Y 1 A LEU 141 ? A LEU 42 43 1 Y 1 A LYS 142 ? A LYS 43 44 1 Y 1 A LEU 143 ? A LEU 44 45 1 Y 1 A GLU 144 ? A GLU 45 46 1 Y 1 A ASP 145 ? A ASP 46 47 1 Y 1 A TYR 146 ? A TYR 47 48 1 Y 1 A LYS 147 ? A LYS 48 49 1 Y 1 A ASP 148 ? A ASP 49 50 1 Y 1 A ARG 149 ? A ARG 50 51 1 Y 1 A LEU 150 ? A LEU 51 52 1 Y 1 A LYS 151 ? A LYS 52 53 1 Y 1 A SER 152 ? A SER 53 54 1 Y 1 A GLY 153 ? A GLY 54 55 1 Y 1 A GLU 154 ? A GLU 55 56 1 Y 1 A HIS 155 ? A HIS 56 57 1 Y 1 A LEU 156 ? A LEU 57 58 1 Y 1 A ASN 157 ? A ASN 58 59 1 Y 1 A PRO 158 ? A PRO 59 60 1 Y 1 A ASP 159 ? A ASP 60 61 1 Y 1 A GLN 160 ? A GLN 61 62 1 Y 1 A LEU 161 ? A LEU 62 63 1 Y 1 A GLU 162 ? A GLU 63 64 1 Y 1 A ALA 163 ? A ALA 64 65 1 Y 1 A VAL 164 ? A VAL 65 66 1 Y 1 A GLU 165 ? A GLU 66 67 1 Y 1 A LYS 166 ? A LYS 67 68 1 Y 1 A TYR 167 ? A TYR 68 69 1 Y 1 A GLU 168 ? A GLU 69 70 1 Y 1 A GLU 169 ? A GLU 70 71 1 Y 1 A VAL 170 ? A VAL 71 72 1 Y 1 A LEU 171 ? A LEU 72 73 1 Y 1 A HIS 172 ? A HIS 73 74 1 Y 1 A ASN 173 ? A ASN 74 75 1 Y 1 A LEU 174 ? A LEU 75 76 1 Y 1 A GLU 175 ? A GLU 76 77 1 Y 1 A PHE 176 ? A PHE 77 78 1 Y 1 A ALA 177 ? A ALA 78 79 1 Y 1 A LYS 178 ? A LYS 79 80 1 Y 1 A GLU 179 ? A GLU 80 81 1 Y 1 A LEU 180 ? A LEU 81 82 1 Y 1 A GLN 181 ? A GLN 82 83 1 Y 1 A LYS 182 ? A LYS 83 84 1 Y 1 A THR 183 ? A THR 84 85 1 Y 1 A PHE 184 ? A PHE 85 86 1 Y 1 A SER 185 ? A SER 86 87 1 Y 1 A GLY 186 ? A GLY 87 88 1 Y 1 A LEU 187 ? A LEU 88 89 1 Y 1 A SER 188 ? A SER 89 90 1 Y 1 A LEU 189 ? A LEU 90 91 1 Y 1 A ASP 190 ? A ASP 91 92 1 Y 1 A LEU 191 ? A LEU 92 93 1 Y 1 A LEU 192 ? A LEU 93 94 1 Y 1 A LYS 193 ? A LYS 94 95 1 Y 1 A ALA 194 ? A ALA 95 96 1 Y 1 A GLN 195 ? A GLN 96 97 1 Y 1 A VAL 319 ? A VAL 220 98 1 Y 1 A PRO 320 ? A PRO 221 99 1 Y 1 A LYS 321 ? A LYS 222 100 1 Y 1 A ASN 322 ? A ASN 223 101 1 Y 1 A ALA 323 ? A ALA 224 102 1 Y 1 A LYS 324 ? A LYS 225 103 1 Y 1 A GLU 325 ? A GLU 226 104 1 Y 1 A LYS 326 ? A LYS 227 105 1 Y 1 A GLU 327 ? A GLU 228 106 1 Y 1 A VAL 328 ? A VAL 229 107 1 Y 1 A PRO 329 ? A PRO 230 108 1 Y 1 A LEU 330 ? A LEU 231 109 1 Y 1 A GLU 331 ? A GLU 232 110 1 Y 1 A GLU 332 ? A GLU 233 111 1 Y 1 A GLU 333 ? A GLU 234 112 1 Y 1 A MSE 334 ? A MSE 235 113 1 Y 1 A LEU 335 ? A LEU 236 114 1 Y 1 A ILE 336 ? A ILE 237 115 1 Y 1 A GLN 337 ? A GLN 238 116 1 Y 1 A SER 338 ? A SER 239 117 1 Y 1 A GLU 339 ? A GLU 240 118 1 Y 1 A LYS 340 ? A LYS 241 119 1 Y 1 A LYS 341 ? A LYS 242 120 1 Y 1 A THR 342 ? A THR 243 121 1 Y 1 A GLN 343 ? A GLN 244 122 1 Y 1 A LEU 344 ? A LEU 245 123 1 Y 1 A SER 345 ? A SER 246 124 1 Y 1 A LYS 346 ? A LYS 247 125 1 Y 1 A THR 347 ? A THR 248 126 1 Y 1 A GLU 348 ? A GLU 249 127 1 Y 1 A SER 349 ? A SER 250 128 1 Y 1 A VAL 350 ? A VAL 251 129 1 Y 1 A LYS 351 ? A LYS 252 130 1 Y 1 A LEU 352 ? A LEU 253 131 1 Y 1 A GLU 353 ? A GLU 254 132 1 Y 1 A HIS 354 ? A HIS 255 133 1 Y 1 A HIS 355 ? A HIS 256 134 1 Y 1 A HIS 356 ? A HIS 257 135 1 Y 1 A HIS 357 ? A HIS 258 136 1 Y 1 A HIS 358 ? A HIS 259 137 1 Y 1 A HIS 359 ? A HIS 260 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MSE N N N N 227 MSE CA C N S 228 MSE C C N N 229 MSE O O N N 230 MSE OXT O N N 231 MSE CB C N N 232 MSE CG C N N 233 MSE SE SE N N 234 MSE CE C N N 235 MSE H H N N 236 MSE H2 H N N 237 MSE HA H N N 238 MSE HXT H N N 239 MSE HB2 H N N 240 MSE HB3 H N N 241 MSE HG2 H N N 242 MSE HG3 H N N 243 MSE HE1 H N N 244 MSE HE2 H N N 245 MSE HE3 H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MSE N CA sing N N 216 MSE N H sing N N 217 MSE N H2 sing N N 218 MSE CA C sing N N 219 MSE CA CB sing N N 220 MSE CA HA sing N N 221 MSE C O doub N N 222 MSE C OXT sing N N 223 MSE OXT HXT sing N N 224 MSE CB CG sing N N 225 MSE CB HB2 sing N N 226 MSE CB HB3 sing N N 227 MSE CG SE sing N N 228 MSE CG HG2 sing N N 229 MSE CG HG3 sing N N 230 MSE SE CE sing N N 231 MSE CE HE1 sing N N 232 MSE CE HE2 sing N N 233 MSE CE HE3 sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 31530094 1 'National Natural Science Foundation of China (NSFC)' China 31100532 2 # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8K9D _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017590 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.003547 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015761 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? SE ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_