data_8KC0 # _entry.id 8KC0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8KC0 pdb_00008kc0 10.2210/pdb8kc0/pdb WWPDB D_1300040042 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-08-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8KC0 _pdbx_database_status.recvd_initial_deposition_date 2023-08-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email hyliu@ustc.edu.cn _pdbx_contact_author.name_first Haiyan _pdbx_contact_author.name_last Liu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5926-820X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, S.' 1 0009-0001-8007-1348 'Liu, Y.' 2 0000-0001-5507-0514 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'De novo design protein -NB8' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, S.' 1 0009-0001-8007-1348 primary 'Liu, Y.' 2 0000-0001-5507-0514 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'De novo design protein -NB8' 14265.160 1 ? ? ? ? 2 water nat water 18.015 61 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GEEIKETFEVDDLDEALRLSAEKIIEEMKKWGVTEFDLKFYGKDDELAKKAKEVIEEAAKKAGVKVKSEFLYDENKDKIT LELTGPNGVKVTSEISKDGIKSTVERPDRKVTLTFKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;GEEIKETFEVDDLDEALRLSAEKIIEEMKKWGVTEFDLKFYGKDDELAKKAKEVIEEAAKKAGVKVKSEFLYDENKDKIT LELTGPNGVKVTSEISKDGIKSTVERPDRKVTLTFKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 GLU n 1 4 ILE n 1 5 LYS n 1 6 GLU n 1 7 THR n 1 8 PHE n 1 9 GLU n 1 10 VAL n 1 11 ASP n 1 12 ASP n 1 13 LEU n 1 14 ASP n 1 15 GLU n 1 16 ALA n 1 17 LEU n 1 18 ARG n 1 19 LEU n 1 20 SER n 1 21 ALA n 1 22 GLU n 1 23 LYS n 1 24 ILE n 1 25 ILE n 1 26 GLU n 1 27 GLU n 1 28 MET n 1 29 LYS n 1 30 LYS n 1 31 TRP n 1 32 GLY n 1 33 VAL n 1 34 THR n 1 35 GLU n 1 36 PHE n 1 37 ASP n 1 38 LEU n 1 39 LYS n 1 40 PHE n 1 41 TYR n 1 42 GLY n 1 43 LYS n 1 44 ASP n 1 45 ASP n 1 46 GLU n 1 47 LEU n 1 48 ALA n 1 49 LYS n 1 50 LYS n 1 51 ALA n 1 52 LYS n 1 53 GLU n 1 54 VAL n 1 55 ILE n 1 56 GLU n 1 57 GLU n 1 58 ALA n 1 59 ALA n 1 60 LYS n 1 61 LYS n 1 62 ALA n 1 63 GLY n 1 64 VAL n 1 65 LYS n 1 66 VAL n 1 67 LYS n 1 68 SER n 1 69 GLU n 1 70 PHE n 1 71 LEU n 1 72 TYR n 1 73 ASP n 1 74 GLU n 1 75 ASN n 1 76 LYS n 1 77 ASP n 1 78 LYS n 1 79 ILE n 1 80 THR n 1 81 LEU n 1 82 GLU n 1 83 LEU n 1 84 THR n 1 85 GLY n 1 86 PRO n 1 87 ASN n 1 88 GLY n 1 89 VAL n 1 90 LYS n 1 91 VAL n 1 92 THR n 1 93 SER n 1 94 GLU n 1 95 ILE n 1 96 SER n 1 97 LYS n 1 98 ASP n 1 99 GLY n 1 100 ILE n 1 101 LYS n 1 102 SER n 1 103 THR n 1 104 VAL n 1 105 GLU n 1 106 ARG n 1 107 PRO n 1 108 ASP n 1 109 ARG n 1 110 LYS n 1 111 VAL n 1 112 THR n 1 113 LEU n 1 114 THR n 1 115 PHE n 1 116 LYS n 1 117 LEU n 1 118 GLU n 1 119 HIS n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 124 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 GLU 2 1 ? ? ? A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 ILE 4 3 3 ILE ILE A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 THR 7 6 6 THR THR A . n A 1 8 PHE 8 7 7 PHE PHE A . n A 1 9 GLU 9 8 8 GLU GLU A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 ASP 11 10 10 ASP ASP A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 SER 20 19 19 SER SER A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 GLU 27 26 26 GLU GLU A . n A 1 28 MET 28 27 27 MET MET A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 TRP 31 30 30 TRP TRP A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 VAL 33 32 32 VAL VAL A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 PHE 40 39 39 PHE PHE A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 ASP 44 43 43 ASP ASP A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 ALA 51 50 50 ALA ALA A . n A 1 52 LYS 52 51 51 LYS LYS A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 GLU 57 56 56 GLU GLU A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 ALA 59 58 58 ALA ALA A . n A 1 60 LYS 60 59 59 LYS LYS A . n A 1 61 LYS 61 60 60 LYS LYS A . n A 1 62 ALA 62 61 61 ALA ALA A . n A 1 63 GLY 63 62 62 GLY GLY A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 LYS 65 64 64 LYS LYS A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 LYS 67 66 66 LYS LYS A . n A 1 68 SER 68 67 67 SER SER A . n A 1 69 GLU 69 68 68 GLU GLU A . n A 1 70 PHE 70 69 69 PHE PHE A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 TYR 72 71 71 TYR TYR A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 GLU 74 73 73 GLU GLU A . n A 1 75 ASN 75 74 74 ASN ASN A . n A 1 76 LYS 76 75 75 LYS LYS A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 GLU 82 81 81 GLU GLU A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 THR 84 83 83 THR THR A . n A 1 85 GLY 85 84 84 GLY GLY A . n A 1 86 PRO 86 85 85 PRO PRO A . n A 1 87 ASN 87 86 86 ASN ASN A . n A 1 88 GLY 88 87 87 GLY GLY A . n A 1 89 VAL 89 88 88 VAL VAL A . n A 1 90 LYS 90 89 89 LYS LYS A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 THR 92 91 91 THR THR A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 GLU 94 93 93 GLU GLU A . n A 1 95 ILE 95 94 94 ILE ILE A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 ASP 98 97 97 ASP ASP A . n A 1 99 GLY 99 98 98 GLY GLY A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 LYS 101 100 100 LYS LYS A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 THR 103 102 102 THR THR A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 GLU 105 104 104 GLU GLU A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 PRO 107 106 106 PRO PRO A . n A 1 108 ASP 108 107 107 ASP ASP A . n A 1 109 ARG 109 108 108 ARG ARG A . n A 1 110 LYS 110 109 109 LYS LYS A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 THR 112 111 111 THR THR A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 THR 114 113 113 THR THR A . n A 1 115 PHE 115 114 114 PHE PHE A . n A 1 116 LYS 116 115 115 LYS LYS A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 GLU 118 117 ? ? ? A . n A 1 119 HIS 119 118 ? ? ? A . n A 1 120 HIS 120 119 ? ? ? A . n A 1 121 HIS 121 120 ? ? ? A . n A 1 122 HIS 122 121 ? ? ? A . n A 1 123 HIS 123 122 ? ? ? A . n A 1 124 HIS 124 123 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 29 HOH HOH A . B 2 HOH 2 202 50 HOH HOH A . B 2 HOH 3 203 3 HOH HOH A . B 2 HOH 4 204 58 HOH HOH A . B 2 HOH 5 205 16 HOH HOH A . B 2 HOH 6 206 47 HOH HOH A . B 2 HOH 7 207 46 HOH HOH A . B 2 HOH 8 208 17 HOH HOH A . B 2 HOH 9 209 23 HOH HOH A . B 2 HOH 10 210 40 HOH HOH A . B 2 HOH 11 211 33 HOH HOH A . B 2 HOH 12 212 30 HOH HOH A . B 2 HOH 13 213 22 HOH HOH A . B 2 HOH 14 214 6 HOH HOH A . B 2 HOH 15 215 7 HOH HOH A . B 2 HOH 16 216 8 HOH HOH A . B 2 HOH 17 217 35 HOH HOH A . B 2 HOH 18 218 18 HOH HOH A . B 2 HOH 19 219 34 HOH HOH A . B 2 HOH 20 220 20 HOH HOH A . B 2 HOH 21 221 54 HOH HOH A . B 2 HOH 22 222 13 HOH HOH A . B 2 HOH 23 223 37 HOH HOH A . B 2 HOH 24 224 60 HOH HOH A . B 2 HOH 25 225 21 HOH HOH A . B 2 HOH 26 226 11 HOH HOH A . B 2 HOH 27 227 5 HOH HOH A . B 2 HOH 28 228 2 HOH HOH A . B 2 HOH 29 229 9 HOH HOH A . B 2 HOH 30 230 27 HOH HOH A . B 2 HOH 31 231 39 HOH HOH A . B 2 HOH 32 232 48 HOH HOH A . B 2 HOH 33 233 24 HOH HOH A . B 2 HOH 34 234 4 HOH HOH A . B 2 HOH 35 235 19 HOH HOH A . B 2 HOH 36 236 15 HOH HOH A . B 2 HOH 37 237 1 HOH HOH A . B 2 HOH 38 238 36 HOH HOH A . B 2 HOH 39 239 42 HOH HOH A . B 2 HOH 40 240 12 HOH HOH A . B 2 HOH 41 241 45 HOH HOH A . B 2 HOH 42 242 51 HOH HOH A . B 2 HOH 43 243 28 HOH HOH A . B 2 HOH 44 244 52 HOH HOH A . B 2 HOH 45 245 25 HOH HOH A . B 2 HOH 46 246 32 HOH HOH A . B 2 HOH 47 247 31 HOH HOH A . B 2 HOH 48 248 49 HOH HOH A . B 2 HOH 49 249 59 HOH HOH A . B 2 HOH 50 250 63 HOH HOH A . B 2 HOH 51 251 44 HOH HOH A . B 2 HOH 52 252 43 HOH HOH A . B 2 HOH 53 253 14 HOH HOH A . B 2 HOH 54 254 38 HOH HOH A . B 2 HOH 55 255 10 HOH HOH A . B 2 HOH 56 256 57 HOH HOH A . B 2 HOH 57 257 53 HOH HOH A . B 2 HOH 58 258 55 HOH HOH A . B 2 HOH 59 259 56 HOH HOH A . B 2 HOH 60 260 26 HOH HOH A . B 2 HOH 61 261 41 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 4 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 4 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 4 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 4 ? NZ ? A LYS 5 NZ 5 1 Y 1 A ASP 10 ? CG ? A ASP 11 CG 6 1 Y 1 A ASP 10 ? OD1 ? A ASP 11 OD1 7 1 Y 1 A ASP 10 ? OD2 ? A ASP 11 OD2 8 1 Y 1 A ASP 13 ? CG ? A ASP 14 CG 9 1 Y 1 A ASP 13 ? OD1 ? A ASP 14 OD1 10 1 Y 1 A ASP 13 ? OD2 ? A ASP 14 OD2 11 1 Y 1 A GLU 14 ? CG ? A GLU 15 CG 12 1 Y 1 A GLU 14 ? CD ? A GLU 15 CD 13 1 Y 1 A GLU 14 ? OE1 ? A GLU 15 OE1 14 1 Y 1 A GLU 14 ? OE2 ? A GLU 15 OE2 15 1 Y 1 A ARG 17 ? CG ? A ARG 18 CG 16 1 Y 1 A ARG 17 ? CD ? A ARG 18 CD 17 1 Y 1 A ARG 17 ? NE ? A ARG 18 NE 18 1 Y 1 A ARG 17 ? CZ ? A ARG 18 CZ 19 1 Y 1 A ARG 17 ? NH1 ? A ARG 18 NH1 20 1 Y 1 A ARG 17 ? NH2 ? A ARG 18 NH2 21 1 Y 1 A GLU 21 ? CG ? A GLU 22 CG 22 1 Y 1 A GLU 21 ? CD ? A GLU 22 CD 23 1 Y 1 A GLU 21 ? OE1 ? A GLU 22 OE1 24 1 Y 1 A GLU 21 ? OE2 ? A GLU 22 OE2 25 1 Y 1 A TRP 30 ? CG ? A TRP 31 CG 26 1 Y 1 A TRP 30 ? CD1 ? A TRP 31 CD1 27 1 Y 1 A TRP 30 ? CD2 ? A TRP 31 CD2 28 1 Y 1 A TRP 30 ? NE1 ? A TRP 31 NE1 29 1 Y 1 A TRP 30 ? CE2 ? A TRP 31 CE2 30 1 Y 1 A TRP 30 ? CE3 ? A TRP 31 CE3 31 1 Y 1 A TRP 30 ? CZ2 ? A TRP 31 CZ2 32 1 Y 1 A TRP 30 ? CZ3 ? A TRP 31 CZ3 33 1 Y 1 A TRP 30 ? CH2 ? A TRP 31 CH2 34 1 Y 1 A GLU 34 ? CG ? A GLU 35 CG 35 1 Y 1 A GLU 34 ? CD ? A GLU 35 CD 36 1 Y 1 A GLU 34 ? OE1 ? A GLU 35 OE1 37 1 Y 1 A GLU 34 ? OE2 ? A GLU 35 OE2 38 1 Y 1 A LYS 51 ? CG ? A LYS 52 CG 39 1 Y 1 A LYS 51 ? CD ? A LYS 52 CD 40 1 Y 1 A LYS 51 ? CE ? A LYS 52 CE 41 1 Y 1 A LYS 51 ? NZ ? A LYS 52 NZ 42 1 Y 1 A GLU 56 ? CG ? A GLU 57 CG 43 1 Y 1 A GLU 56 ? CD ? A GLU 57 CD 44 1 Y 1 A GLU 56 ? OE1 ? A GLU 57 OE1 45 1 Y 1 A GLU 56 ? OE2 ? A GLU 57 OE2 46 1 Y 1 A LYS 59 ? CG ? A LYS 60 CG 47 1 Y 1 A LYS 59 ? CD ? A LYS 60 CD 48 1 Y 1 A LYS 59 ? CE ? A LYS 60 CE 49 1 Y 1 A LYS 59 ? NZ ? A LYS 60 NZ 50 1 Y 1 A LYS 60 ? CG ? A LYS 61 CG 51 1 Y 1 A LYS 60 ? CD ? A LYS 61 CD 52 1 Y 1 A LYS 60 ? CE ? A LYS 61 CE 53 1 Y 1 A LYS 60 ? NZ ? A LYS 61 NZ 54 1 Y 1 A LYS 64 ? CG ? A LYS 65 CG 55 1 Y 1 A LYS 64 ? CD ? A LYS 65 CD 56 1 Y 1 A LYS 64 ? CE ? A LYS 65 CE 57 1 Y 1 A LYS 64 ? NZ ? A LYS 65 NZ 58 1 Y 1 A LYS 66 ? CG ? A LYS 67 CG 59 1 Y 1 A LYS 66 ? CD ? A LYS 67 CD 60 1 Y 1 A LYS 66 ? CE ? A LYS 67 CE 61 1 Y 1 A LYS 66 ? NZ ? A LYS 67 NZ 62 1 Y 1 A LYS 96 ? CG ? A LYS 97 CG 63 1 Y 1 A LYS 96 ? CD ? A LYS 97 CD 64 1 Y 1 A LYS 96 ? CE ? A LYS 97 CE 65 1 Y 1 A LYS 96 ? NZ ? A LYS 97 NZ 66 1 Y 1 A LYS 115 ? CG ? A LYS 116 CG 67 1 Y 1 A LYS 115 ? CD ? A LYS 116 CD 68 1 Y 1 A LYS 115 ? CE ? A LYS 116 CE 69 1 Y 1 A LYS 115 ? NZ ? A LYS 116 NZ 70 1 Y 1 A LEU 116 ? CG ? A LEU 117 CG 71 1 Y 1 A LEU 116 ? CD1 ? A LEU 117 CD1 72 1 Y 1 A LEU 116 ? CD2 ? A LEU 117 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8KC0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 46.160 _cell.length_a_esd ? _cell.length_b 46.160 _cell.length_b_esd ? _cell.length_c 127.157 _cell.length_c_esd ? _cell.volume 270939.218 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8KC0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8KC0 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8M Succinic acid pH7.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-03-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 35.28 _reflns.entry_id 8KC0 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 46.16 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15117 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 22.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 673 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.991 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 55.15 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8KC0 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 32.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15117 _refine.ls_number_reflns_R_free 1496 _refine.ls_number_reflns_R_work 13621 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.82 _refine.ls_percent_reflns_R_free 9.90 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2362 _refine.ls_R_factor_R_free 0.2745 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2320 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.2762 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2914 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 32.64 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 910 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 849 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0044 ? 857 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7388 ? 1157 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0511 ? 142 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0045 ? 148 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.4348 ? 118 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.17 . . 135 1191 98.08 . . . . 0.3095 . . . . . . . . . . . 0.3988 'X-RAY DIFFRACTION' 2.17 2.25 . . 135 1249 97.33 . . . . 0.2847 . . . . . . . . . . . 0.3224 'X-RAY DIFFRACTION' 2.25 2.34 . . 126 1231 97.77 . . . . 0.2678 . . . . . . . . . . . 0.3120 'X-RAY DIFFRACTION' 2.34 2.44 . . 127 1197 96.08 . . . . 0.2652 . . . . . . . . . . . 0.3208 'X-RAY DIFFRACTION' 2.44 2.57 . . 134 1262 99.50 . . . . 0.2591 . . . . . . . . . . . 0.3710 'X-RAY DIFFRACTION' 2.57 2.73 . . 143 1246 99.71 . . . . 0.2910 . . . . . . . . . . . 0.3103 'X-RAY DIFFRACTION' 2.73 2.94 . . 138 1239 99.78 . . . . 0.2824 . . . . . . . . . . . 0.3513 'X-RAY DIFFRACTION' 2.94 3.24 . . 141 1258 99.86 . . . . 0.2600 . . . . . . . . . . . 0.2658 'X-RAY DIFFRACTION' 3.24 3.70 . . 135 1246 100.00 . . . . 0.2020 . . . . . . . . . . . 0.3235 'X-RAY DIFFRACTION' 3.71 4.66 . . 141 1261 99.36 . . . . 0.1804 . . . . . . . . . . . 0.1812 'X-RAY DIFFRACTION' 4.67 32.64 . . 141 1241 99.64 . . . . 0.2215 . . . . . . . . . . . 0.2403 # _struct.entry_id 8KC0 _struct.title 'De novo design protein -NB8' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8KC0 _struct_keywords.text 'De novo design protein, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8KC0 _struct_ref.pdbx_db_accession 8KC0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8KC0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8KC0 _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 123 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 12 ? TRP A 31 ? ASP A 11 TRP A 30 1 ? 20 HELX_P HELX_P2 AA2 ASP A 45 ? ALA A 62 ? ASP A 44 ALA A 61 1 ? 18 HELX_P HELX_P3 AA3 PRO A 86 ? GLY A 88 ? PRO A 85 GLY A 87 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 4 ? GLU A 9 ? ILE A 3 GLU A 8 AA1 2 ARG A 109 ? LYS A 116 ? ARG A 108 LYS A 115 AA1 3 GLY A 99 ? ARG A 106 ? GLY A 98 ARG A 105 AA1 4 LYS A 90 ? SER A 96 ? LYS A 89 SER A 95 AA1 5 ILE A 79 ? THR A 84 ? ILE A 78 THR A 83 AA1 6 GLU A 35 ? GLY A 42 ? GLU A 34 GLY A 41 AA1 7 LYS A 65 ? TYR A 72 ? LYS A 64 TYR A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 6 ? N GLU A 5 O THR A 112 ? O THR A 111 AA1 2 3 O LEU A 113 ? O LEU A 112 N SER A 102 ? N SER A 101 AA1 3 4 O GLU A 105 ? O GLU A 104 N LYS A 90 ? N LYS A 89 AA1 4 5 O ILE A 95 ? O ILE A 94 N ILE A 79 ? N ILE A 78 AA1 5 6 O GLU A 82 ? O GLU A 81 N LYS A 39 ? N LYS A 38 AA1 6 7 N PHE A 40 ? N PHE A 39 O LEU A 71 ? O LEU A 70 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 1.98361229186 -26.4003262895 -9.08959907758 0.619659495407 ? 0.0995596695905 ? 0.0995843965691 ? 0.560748225376 ? 0.109447194786 ? 0.291193571586 ? 4.85311180673 ? 0.0144737014841 ? 0.549001509032 ? 6.31946820978 ? -1.74968561008 ? 9.44287471127 ? -0.509408330678 ? -1.16593403819 ? -0.640699747642 ? 0.129019137345 ? 0.176683183286 ? 0.298369490902 ? 1.54693654296 ? 0.657266359594 ? 0.0504871059341 ? 2 'X-RAY DIFFRACTION' ? refined 0.442906782344 -23.0074387425 -24.0786259442 0.452888256169 ? -0.0798683144916 ? -0.0210825888929 ? 0.308631884791 ? -0.0361968584773 ? 0.259980388945 ? 7.98219943691 ? 2.39205760115 ? -2.34062214168 ? 5.83087253926 ? -3.87328145364 ? 6.70507027505 ? -0.118606495416 ? 0.315648977948 ? -0.655628723416 ? -0.531490806562 ? 0.0391723034582 ? 0.146684206432 ? 1.04309919798 ? -0.295912984606 ? 0.108627546579 ? 3 'X-RAY DIFFRACTION' ? refined -3.20811878362 -18.02700704 -16.7100920434 0.295785292395 ? 0.0120807054192 ? 0.0283894236799 ? 0.523024552857 ? 0.0191974643903 ? 0.311853339125 ? 2.51048826864 ? 0.947325348003 ? -3.43933699086 ? 4.71449941448 ? -0.217401559584 ? 5.35136223227 ? 0.0452236613493 ? -0.266060753493 ? 1.11987258532 ? 0.419923377753 ? 0.199362559394 ? 0.673846687569 ? -0.255528162838 ? -1.00437202353 ? -0.169581539435 ? 4 'X-RAY DIFFRACTION' ? refined 0.130743801355 -18.8912929159 -8.23448851349 0.387446265544 ? 0.124335776945 ? 0.00493612171334 ? 0.747540029016 ? 0.129869438734 ? 0.342704892686 ? 3.8948351184 ? -4.89531531294 ? -1.67253207707 ? 7.51097565369 ? 1.38385426807 ? 4.80234729276 ? -0.411592278901 ? -0.820401017194 ? 0.977584958328 ? 0.080898564081 ? 0.628633034661 ? 0.381727467229 ? -0.368968143875 ? -0.478449555549 ? -0.28661766879 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 2 ? A 28 A 29 ? ? ;chain 'A' and (resid 2 through 29 ) ; 2 'X-RAY DIFFRACTION' 2 A 29 A 30 ? A 76 A 77 ? ? ;chain 'A' and (resid 30 through 77 ) ; 3 'X-RAY DIFFRACTION' 3 A 77 A 78 ? A 94 A 95 ? ? ;chain 'A' and (resid 78 through 95 ) ; 4 'X-RAY DIFFRACTION' 4 A 95 A 96 ? A 115 A 116 ? ? ;chain 'A' and (resid 96 through 116 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A GLU 1 ? A GLU 2 3 1 Y 1 A GLU 117 ? A GLU 118 4 1 Y 1 A HIS 118 ? A HIS 119 5 1 Y 1 A HIS 119 ? A HIS 120 6 1 Y 1 A HIS 120 ? A HIS 121 7 1 Y 1 A HIS 121 ? A HIS 122 8 1 Y 1 A HIS 122 ? A HIS 123 9 1 Y 1 A HIS 123 ? A HIS 124 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 HOH O H1 sing N N 118 HOH O H2 sing N N 119 ILE N CA sing N N 120 ILE N H sing N N 121 ILE N H2 sing N N 122 ILE CA C sing N N 123 ILE CA CB sing N N 124 ILE CA HA sing N N 125 ILE C O doub N N 126 ILE C OXT sing N N 127 ILE CB CG1 sing N N 128 ILE CB CG2 sing N N 129 ILE CB HB sing N N 130 ILE CG1 CD1 sing N N 131 ILE CG1 HG12 sing N N 132 ILE CG1 HG13 sing N N 133 ILE CG2 HG21 sing N N 134 ILE CG2 HG22 sing N N 135 ILE CG2 HG23 sing N N 136 ILE CD1 HD11 sing N N 137 ILE CD1 HD12 sing N N 138 ILE CD1 HD13 sing N N 139 ILE OXT HXT sing N N 140 LEU N CA sing N N 141 LEU N H sing N N 142 LEU N H2 sing N N 143 LEU CA C sing N N 144 LEU CA CB sing N N 145 LEU CA HA sing N N 146 LEU C O doub N N 147 LEU C OXT sing N N 148 LEU CB CG sing N N 149 LEU CB HB2 sing N N 150 LEU CB HB3 sing N N 151 LEU CG CD1 sing N N 152 LEU CG CD2 sing N N 153 LEU CG HG sing N N 154 LEU CD1 HD11 sing N N 155 LEU CD1 HD12 sing N N 156 LEU CD1 HD13 sing N N 157 LEU CD2 HD21 sing N N 158 LEU CD2 HD22 sing N N 159 LEU CD2 HD23 sing N N 160 LEU OXT HXT sing N N 161 LYS N CA sing N N 162 LYS N H sing N N 163 LYS N H2 sing N N 164 LYS CA C sing N N 165 LYS CA CB sing N N 166 LYS CA HA sing N N 167 LYS C O doub N N 168 LYS C OXT sing N N 169 LYS CB CG sing N N 170 LYS CB HB2 sing N N 171 LYS CB HB3 sing N N 172 LYS CG CD sing N N 173 LYS CG HG2 sing N N 174 LYS CG HG3 sing N N 175 LYS CD CE sing N N 176 LYS CD HD2 sing N N 177 LYS CD HD3 sing N N 178 LYS CE NZ sing N N 179 LYS CE HE2 sing N N 180 LYS CE HE3 sing N N 181 LYS NZ HZ1 sing N N 182 LYS NZ HZ2 sing N N 183 LYS NZ HZ3 sing N N 184 LYS OXT HXT sing N N 185 MET N CA sing N N 186 MET N H sing N N 187 MET N H2 sing N N 188 MET CA C sing N N 189 MET CA CB sing N N 190 MET CA HA sing N N 191 MET C O doub N N 192 MET C OXT sing N N 193 MET CB CG sing N N 194 MET CB HB2 sing N N 195 MET CB HB3 sing N N 196 MET CG SD sing N N 197 MET CG HG2 sing N N 198 MET CG HG3 sing N N 199 MET SD CE sing N N 200 MET CE HE1 sing N N 201 MET CE HE2 sing N N 202 MET CE HE3 sing N N 203 MET OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type other _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'design model' # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 8KC0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021664 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021664 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007864 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_