data_8OFE # _entry.id 8OFE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.390 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OFE pdb_00008ofe 10.2210/pdb8ofe/pdb WWPDB D_1292129186 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-12-27 2 'Structure model' 1 1 2024-04-03 3 'Structure model' 1 2 2024-04-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8OFE _pdbx_database_status.recvd_initial_deposition_date 2023-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 eckhard.hofmann@rub.de Eckhard Hofmann ? 'principal investigator/group leader' 0000-0003-4874-372X 3 raphael.stoll@rub.de Raphael Stoll ? 'principal investigator/group leader' 0000-0003-2890-8419 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kirschner, H.' 1 0000-0002-8314-1620 'Stoll, R.' 2 ? 'Hofmann, E.' 3 0000-0003-4874-372X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemmedchem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-7187 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first e202300538 _citation.page_last e202300538 _citation.title 'Structural Insights into Antibacterial Payload Release from Gold Nanoparticles Bound to E. coli Peptide Deformylase.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cmdc.202300538 _citation.pdbx_database_id_PubMed 38057137 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kirschner, H.' 1 0000-0002-8314-1620 primary 'John, M.' 2 ? primary 'Zhou, T.' 3 ? primary 'Bachmann, N.' 4 ? primary 'Schultz, A.' 5 ? primary 'Hofmann, E.' 6 0000-0003-4874-372X primary 'Bandow, J.E.' 7 ? primary 'Scherkenbeck, J.' 8 ? primary 'Metzler-Nolte, N.' 9 0000-0001-8111-9959 primary 'Stoll, R.' 10 0000-0003-2890-8419 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide deformylase' 19552.645 1 ? ? ? ? 2 non-polymer syn ;(2R)-2-[[methanoyl(oxidanyl)amino]methyl]-N-[(2S)-3-methyl-1-oxidanylidene-1-[2-(sulfanylmethyl)pyrrolidin-1-yl]butan-2-yl]heptanamide ; 401.564 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 113 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPEL LEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQK VEKLDRLKARA ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPEL LEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQK VEKLDRLKARA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2R)-2-[[methanoyl(oxidanyl)amino]methyl]-N-[(2S)-3-methyl-1-oxidanylidene-1-[2-(sulfanylmethyl)pyrrolidin-1-yl]butan-2-yl]heptanamide ; VLK 3 'ZINC ION' ZN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 SER n 1 5 VAL n 1 6 LEU n 1 7 GLN n 1 8 VAL n 1 9 LEU n 1 10 HIS n 1 11 ILE n 1 12 PRO n 1 13 ASP n 1 14 GLU n 1 15 ARG n 1 16 LEU n 1 17 ARG n 1 18 LYS n 1 19 VAL n 1 20 ALA n 1 21 LYS n 1 22 PRO n 1 23 VAL n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 ASN n 1 28 ALA n 1 29 GLU n 1 30 ILE n 1 31 GLN n 1 32 ARG n 1 33 ILE n 1 34 VAL n 1 35 ASP n 1 36 ASP n 1 37 MET n 1 38 PHE n 1 39 GLU n 1 40 THR n 1 41 MET n 1 42 TYR n 1 43 ALA n 1 44 GLU n 1 45 GLU n 1 46 GLY n 1 47 ILE n 1 48 GLY n 1 49 LEU n 1 50 ALA n 1 51 ALA n 1 52 THR n 1 53 GLN n 1 54 VAL n 1 55 ASP n 1 56 ILE n 1 57 HIS n 1 58 GLN n 1 59 ARG n 1 60 ILE n 1 61 ILE n 1 62 VAL n 1 63 ILE n 1 64 ASP n 1 65 VAL n 1 66 SER n 1 67 GLU n 1 68 ASN n 1 69 ARG n 1 70 ASP n 1 71 GLU n 1 72 ARG n 1 73 LEU n 1 74 VAL n 1 75 LEU n 1 76 ILE n 1 77 ASN n 1 78 PRO n 1 79 GLU n 1 80 LEU n 1 81 LEU n 1 82 GLU n 1 83 LYS n 1 84 SER n 1 85 GLY n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 ILE n 1 90 GLU n 1 91 GLU n 1 92 GLY n 1 93 CYS n 1 94 LEU n 1 95 SER n 1 96 ILE n 1 97 PRO n 1 98 GLU n 1 99 GLN n 1 100 ARG n 1 101 ALA n 1 102 LEU n 1 103 VAL n 1 104 PRO n 1 105 ARG n 1 106 ALA n 1 107 GLU n 1 108 LYS n 1 109 VAL n 1 110 LYS n 1 111 ILE n 1 112 ARG n 1 113 ALA n 1 114 LEU n 1 115 ASP n 1 116 ARG n 1 117 ASP n 1 118 GLY n 1 119 LYS n 1 120 PRO n 1 121 PHE n 1 122 GLU n 1 123 LEU n 1 124 GLU n 1 125 ALA n 1 126 ASP n 1 127 GLY n 1 128 LEU n 1 129 LEU n 1 130 ALA n 1 131 ILE n 1 132 CYS n 1 133 ILE n 1 134 GLN n 1 135 HIS n 1 136 GLU n 1 137 MET n 1 138 ASP n 1 139 HIS n 1 140 LEU n 1 141 VAL n 1 142 GLY n 1 143 LYS n 1 144 LEU n 1 145 PHE n 1 146 MET n 1 147 ASP n 1 148 TYR n 1 149 LEU n 1 150 SER n 1 151 PRO n 1 152 LEU n 1 153 LYS n 1 154 GLN n 1 155 GLN n 1 156 ARG n 1 157 ILE n 1 158 ARG n 1 159 GLN n 1 160 LYS n 1 161 VAL n 1 162 GLU n 1 163 LYS n 1 164 LEU n 1 165 ASP n 1 166 ARG n 1 167 LEU n 1 168 LYS n 1 169 ALA n 1 170 ARG n 1 171 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 171 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene def _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VLK non-polymer . ;(2R)-2-[[methanoyl(oxidanyl)amino]methyl]-N-[(2S)-3-methyl-1-oxidanylidene-1-[2-(sulfanylmethyl)pyrrolidin-1-yl]butan-2-yl]heptanamide ; ? 'C19 H35 N3 O4 S' 401.564 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 HIS 2 -1 ? ? ? A . n A 1 3 MET 3 0 ? ? ? A . n A 1 4 SER 4 1 1 SER SER A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 LEU 6 3 3 LEU LEU A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 LEU 9 6 6 LEU LEU A . n A 1 10 HIS 10 7 7 HIS HIS A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 PRO 12 9 9 PRO PRO A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 ARG 15 12 12 ARG ARG A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 ARG 17 14 14 ARG ARG A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 PRO 22 19 19 PRO PRO A . n A 1 23 VAL 23 20 20 VAL VAL A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 VAL 26 23 23 VAL VAL A . n A 1 27 ASN 27 24 24 ASN ASN A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 GLN 31 28 28 GLN GLN A . n A 1 32 ARG 32 29 29 ARG ARG A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 ASP 35 32 32 ASP ASP A . n A 1 36 ASP 36 33 33 ASP ASP A . n A 1 37 MET 37 34 34 MET MET A . n A 1 38 PHE 38 35 35 PHE PHE A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 MET 41 38 38 MET MET A . n A 1 42 TYR 42 39 39 TYR TYR A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 GLU 44 41 41 GLU GLU A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 GLY 48 45 45 GLY GLY A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 ALA 51 48 48 ALA ALA A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 GLN 53 50 50 GLN GLN A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 HIS 57 54 54 HIS HIS A . n A 1 58 GLN 58 55 55 GLN GLN A . n A 1 59 ARG 59 56 56 ARG ARG A . n A 1 60 ILE 60 57 57 ILE ILE A . n A 1 61 ILE 61 58 58 ILE ILE A . n A 1 62 VAL 62 59 59 VAL VAL A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 VAL 65 62 62 VAL VAL A . n A 1 66 SER 66 63 63 SER SER A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 ASN 68 65 65 ASN ASN A . n A 1 69 ARG 69 66 66 ARG ARG A . n A 1 70 ASP 70 67 67 ASP ASP A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 ARG 72 69 69 ARG ARG A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 VAL 74 71 71 VAL VAL A . n A 1 75 LEU 75 72 72 LEU LEU A . n A 1 76 ILE 76 73 73 ILE ILE A . n A 1 77 ASN 77 74 74 ASN ASN A . n A 1 78 PRO 78 75 75 PRO PRO A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 LEU 80 77 77 LEU LEU A . n A 1 81 LEU 81 78 78 LEU LEU A . n A 1 82 GLU 82 79 79 GLU GLU A . n A 1 83 LYS 83 80 80 LYS LYS A . n A 1 84 SER 84 81 81 SER SER A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 THR 87 84 84 THR THR A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 ILE 89 86 86 ILE ILE A . n A 1 90 GLU 90 87 87 GLU GLU A . n A 1 91 GLU 91 88 88 GLU GLU A . n A 1 92 GLY 92 89 89 GLY GLY A . n A 1 93 CYS 93 90 90 CYS CYS A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 SER 95 92 92 SER SER A . n A 1 96 ILE 96 93 93 ILE ILE A . n A 1 97 PRO 97 94 94 PRO PRO A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 GLN 99 96 96 GLN GLN A . n A 1 100 ARG 100 97 97 ARG ARG A . n A 1 101 ALA 101 98 98 ALA ALA A . n A 1 102 LEU 102 99 99 LEU LEU A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 PRO 104 101 101 PRO PRO A . n A 1 105 ARG 105 102 102 ARG ARG A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 LYS 108 105 105 LYS LYS A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 LYS 110 107 107 LYS LYS A . n A 1 111 ILE 111 108 108 ILE ILE A . n A 1 112 ARG 112 109 109 ARG ARG A . n A 1 113 ALA 113 110 110 ALA ALA A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 ASP 115 112 112 ASP ASP A . n A 1 116 ARG 116 113 113 ARG ARG A . n A 1 117 ASP 117 114 114 ASP ASP A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 LYS 119 116 116 LYS LYS A . n A 1 120 PRO 120 117 117 PRO PRO A . n A 1 121 PHE 121 118 118 PHE PHE A . n A 1 122 GLU 122 119 119 GLU GLU A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 GLU 124 121 121 GLU GLU A . n A 1 125 ALA 125 122 122 ALA ALA A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 GLY 127 124 124 GLY GLY A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 ALA 130 127 127 ALA ALA A . n A 1 131 ILE 131 128 128 ILE ILE A . n A 1 132 CYS 132 129 129 CYS CYS A . n A 1 133 ILE 133 130 130 ILE ILE A . n A 1 134 GLN 134 131 131 GLN GLN A . n A 1 135 HIS 135 132 132 HIS HIS A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 MET 137 134 134 MET MET A . n A 1 138 ASP 138 135 135 ASP ASP A . n A 1 139 HIS 139 136 136 HIS HIS A . n A 1 140 LEU 140 137 137 LEU LEU A . n A 1 141 VAL 141 138 138 VAL VAL A . n A 1 142 GLY 142 139 139 GLY GLY A . n A 1 143 LYS 143 140 140 LYS LYS A . n A 1 144 LEU 144 141 141 LEU LEU A . n A 1 145 PHE 145 142 142 PHE PHE A . n A 1 146 MET 146 143 143 MET MET A . n A 1 147 ASP 147 144 144 ASP ASP A . n A 1 148 TYR 148 145 145 TYR TYR A . n A 1 149 LEU 149 146 146 LEU LEU A . n A 1 150 SER 150 147 147 SER SER A . n A 1 151 PRO 151 148 148 PRO PRO A . n A 1 152 LEU 152 149 149 LEU LEU A . n A 1 153 LYS 153 150 150 LYS LYS A . n A 1 154 GLN 154 151 151 GLN GLN A . n A 1 155 GLN 155 152 152 GLN GLN A . n A 1 156 ARG 156 153 153 ARG ARG A . n A 1 157 ILE 157 154 154 ILE ILE A . n A 1 158 ARG 158 155 155 ARG ARG A . n A 1 159 GLN 159 156 156 GLN GLN A . n A 1 160 LYS 160 157 157 LYS LYS A . n A 1 161 VAL 161 158 158 VAL VAL A . n A 1 162 GLU 162 159 159 GLU GLU A . n A 1 163 LYS 163 160 160 LYS LYS A . n A 1 164 LEU 164 161 161 LEU LEU A . n A 1 165 ASP 165 162 162 ASP ASP A . n A 1 166 ARG 166 163 163 ARG ARG A . n A 1 167 LEU 167 164 164 LEU LEU A . n A 1 168 LYS 168 165 ? ? ? A . n A 1 169 ALA 169 166 ? ? ? A . n A 1 170 ARG 170 167 ? ? ? A . n A 1 171 ALA 171 168 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 VLK 1 201 201 VLK 205 A . C 3 ZN 1 202 1 ZN ZN A . D 4 HOH 1 301 76 HOH HOH A . D 4 HOH 2 302 143 HOH HOH A . D 4 HOH 3 303 79 HOH HOH A . D 4 HOH 4 304 64 HOH HOH A . D 4 HOH 5 305 93 HOH HOH A . D 4 HOH 6 306 140 HOH HOH A . D 4 HOH 7 307 136 HOH HOH A . D 4 HOH 8 308 132 HOH HOH A . D 4 HOH 9 309 137 HOH HOH A . D 4 HOH 10 310 39 HOH HOH A . D 4 HOH 11 311 53 HOH HOH A . D 4 HOH 12 312 58 HOH HOH A . D 4 HOH 13 313 36 HOH HOH A . D 4 HOH 14 314 23 HOH HOH A . D 4 HOH 15 315 123 HOH HOH A . D 4 HOH 16 316 90 HOH HOH A . D 4 HOH 17 317 98 HOH HOH A . D 4 HOH 18 318 41 HOH HOH A . D 4 HOH 19 319 44 HOH HOH A . D 4 HOH 20 320 26 HOH HOH A . D 4 HOH 21 321 73 HOH HOH A . D 4 HOH 22 322 43 HOH HOH A . D 4 HOH 23 323 48 HOH HOH A . D 4 HOH 24 324 40 HOH HOH A . D 4 HOH 25 325 88 HOH HOH A . D 4 HOH 26 326 30 HOH HOH A . D 4 HOH 27 327 49 HOH HOH A . D 4 HOH 28 328 125 HOH HOH A . D 4 HOH 29 329 42 HOH HOH A . D 4 HOH 30 330 22 HOH HOH A . D 4 HOH 31 331 25 HOH HOH A . D 4 HOH 32 332 105 HOH HOH A . D 4 HOH 33 333 28 HOH HOH A . D 4 HOH 34 334 5 HOH HOH A . D 4 HOH 35 335 45 HOH HOH A . D 4 HOH 36 336 38 HOH HOH A . D 4 HOH 37 337 50 HOH HOH A . D 4 HOH 38 338 144 HOH HOH A . D 4 HOH 39 339 55 HOH HOH A . D 4 HOH 40 340 68 HOH HOH A . D 4 HOH 41 341 31 HOH HOH A . D 4 HOH 42 342 119 HOH HOH A . D 4 HOH 43 343 37 HOH HOH A . D 4 HOH 44 344 3 HOH HOH A . D 4 HOH 45 345 52 HOH HOH A . D 4 HOH 46 346 74 HOH HOH A . D 4 HOH 47 347 67 HOH HOH A . D 4 HOH 48 348 51 HOH HOH A . D 4 HOH 49 349 75 HOH HOH A . D 4 HOH 50 350 4 HOH HOH A . D 4 HOH 51 351 54 HOH HOH A . D 4 HOH 52 352 32 HOH HOH A . D 4 HOH 53 353 10 HOH HOH A . D 4 HOH 54 354 15 HOH HOH A . D 4 HOH 55 355 66 HOH HOH A . D 4 HOH 56 356 12 HOH HOH A . D 4 HOH 57 357 47 HOH HOH A . D 4 HOH 58 358 60 HOH HOH A . D 4 HOH 59 359 24 HOH HOH A . D 4 HOH 60 360 80 HOH HOH A . D 4 HOH 61 361 11 HOH HOH A . D 4 HOH 62 362 77 HOH HOH A . D 4 HOH 63 363 17 HOH HOH A . D 4 HOH 64 364 110 HOH HOH A . D 4 HOH 65 365 69 HOH HOH A . D 4 HOH 66 366 27 HOH HOH A . D 4 HOH 67 367 104 HOH HOH A . D 4 HOH 68 368 59 HOH HOH A . D 4 HOH 69 369 102 HOH HOH A . D 4 HOH 70 370 34 HOH HOH A . D 4 HOH 71 371 16 HOH HOH A . D 4 HOH 72 372 65 HOH HOH A . D 4 HOH 73 373 6 HOH HOH A . D 4 HOH 74 374 111 HOH HOH A . D 4 HOH 75 375 57 HOH HOH A . D 4 HOH 76 376 9 HOH HOH A . D 4 HOH 77 377 20 HOH HOH A . D 4 HOH 78 378 71 HOH HOH A . D 4 HOH 79 379 21 HOH HOH A . D 4 HOH 80 380 13 HOH HOH A . D 4 HOH 81 381 2 HOH HOH A . D 4 HOH 82 382 33 HOH HOH A . D 4 HOH 83 383 100 HOH HOH A . D 4 HOH 84 384 8 HOH HOH A . D 4 HOH 85 385 46 HOH HOH A . D 4 HOH 86 386 142 HOH HOH A . D 4 HOH 87 387 141 HOH HOH A . D 4 HOH 88 388 19 HOH HOH A . D 4 HOH 89 389 18 HOH HOH A . D 4 HOH 90 390 117 HOH HOH A . D 4 HOH 91 391 139 HOH HOH A . D 4 HOH 92 392 61 HOH HOH A . D 4 HOH 93 393 99 HOH HOH A . D 4 HOH 94 394 114 HOH HOH A . D 4 HOH 95 395 14 HOH HOH A . D 4 HOH 96 396 84 HOH HOH A . D 4 HOH 97 397 138 HOH HOH A . D 4 HOH 98 398 63 HOH HOH A . D 4 HOH 99 399 83 HOH HOH A . D 4 HOH 100 400 86 HOH HOH A . D 4 HOH 101 401 35 HOH HOH A . D 4 HOH 102 402 106 HOH HOH A . D 4 HOH 103 403 62 HOH HOH A . D 4 HOH 104 404 89 HOH HOH A . D 4 HOH 105 405 108 HOH HOH A . D 4 HOH 106 406 56 HOH HOH A . D 4 HOH 107 407 95 HOH HOH A . D 4 HOH 108 408 107 HOH HOH A . D 4 HOH 109 409 97 HOH HOH A . D 4 HOH 110 410 133 HOH HOH A . D 4 HOH 111 411 70 HOH HOH A . D 4 HOH 112 412 134 HOH HOH A . D 4 HOH 113 413 135 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A VLK 201 ? C14 ? B VLK 1 C14 2 1 N 1 A VLK 201 ? C12 ? B VLK 1 C12 3 1 N 1 A VLK 201 ? C15 ? B VLK 1 C15 4 1 N 1 A VLK 201 ? C16 ? B VLK 1 C16 5 1 N 1 A VLK 201 ? C13 ? B VLK 1 C13 6 1 N 1 A VLK 201 ? S1 ? B VLK 1 S1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'VERSION Jan 10, 2022 BUILT=20220120' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 'VERSION Jan 10, 2022 BUILT=20220120' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8OFE _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.620 _cell.length_a_esd ? _cell.length_b 54.620 _cell.length_b_esd ? _cell.length_c 231.730 _cell.length_c_esd ? _cell.volume 598709.687 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OFE _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OFE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.17M Ammonium sulfate, 15% Glycerol, 25.5% PEG4000, 50mM Hepes pH7.4' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-08-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.919780 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.919780 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 29.895 _reflns.entry_id 8OFE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.4 _reflns.d_resolution_low 47.30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 76134 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 63.462 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.75 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.113 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.40 _reflns_shell.d_res_low 1.44 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.59 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5626 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 62.6145 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.86 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.61 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.83 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 36.04 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8OFE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.40 _refine.ls_d_res_low 43.79 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 75666 _refine.ls_number_reflns_R_free 3794 _refine.ls_number_reflns_R_work 71872 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.34 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1729 _refine.ls_R_factor_R_free 0.2042 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1713 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.9594 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1847 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.40 _refine_hist.d_res_low 43.79 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1450 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1315 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0128 ? 1377 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1907 ? 1857 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0852 ? 214 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0093 ? 247 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.5362 ? 557 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.40 1.42 . . 116 2262 85.66 . . . . 0.4767 . . . . . . . . . . . 0.5909 'X-RAY DIFFRACTION' 1.42 1.44 . . 138 2666 97.97 . . . . 0.3354 . . . . . . . . . . . 0.4031 'X-RAY DIFFRACTION' 1.44 1.46 . . 137 2643 99.68 . . . . 0.2579 . . . . . . . . . . . 0.3344 'X-RAY DIFFRACTION' 1.46 1.48 . . 148 2741 99.86 . . . . 0.2345 . . . . . . . . . . . 0.2751 'X-RAY DIFFRACTION' 1.48 1.50 . . 138 2633 99.82 . . . . 0.2240 . . . . . . . . . . . 0.2559 'X-RAY DIFFRACTION' 1.50 1.52 . . 149 2686 99.79 . . . . 0.2207 . . . . . . . . . . . 0.2286 'X-RAY DIFFRACTION' 1.52 1.55 . . 140 2600 99.93 . . . . 0.2138 . . . . . . . . . . . 0.2213 'X-RAY DIFFRACTION' 1.55 1.57 . . 143 2750 99.90 . . . . 0.2191 . . . . . . . . . . . 0.2795 'X-RAY DIFFRACTION' 1.57 1.60 . . 147 2698 99.93 . . . . 0.1923 . . . . . . . . . . . 0.2936 'X-RAY DIFFRACTION' 1.60 1.63 . . 140 2615 99.96 . . . . 0.1863 . . . . . . . . . . . 0.2278 'X-RAY DIFFRACTION' 1.63 1.67 . . 143 2695 100.00 . . . . 0.1701 . . . . . . . . . . . 0.2239 'X-RAY DIFFRACTION' 1.67 1.70 . . 142 2693 100.00 . . . . 0.1628 . . . . . . . . . . . 0.2014 'X-RAY DIFFRACTION' 1.70 1.74 . . 138 2643 99.89 . . . . 0.1581 . . . . . . . . . . . 0.1900 'X-RAY DIFFRACTION' 1.74 1.79 . . 139 2690 100.00 . . . . 0.1503 . . . . . . . . . . . 0.2106 'X-RAY DIFFRACTION' 1.79 1.83 . . 141 2692 99.96 . . . . 0.1498 . . . . . . . . . . . 0.2348 'X-RAY DIFFRACTION' 1.83 1.89 . . 138 2705 100.00 . . . . 0.1448 . . . . . . . . . . . 0.2151 'X-RAY DIFFRACTION' 1.89 1.95 . . 143 2696 100.00 . . . . 0.1569 . . . . . . . . . . . 0.2012 'X-RAY DIFFRACTION' 1.95 2.02 . . 137 2662 100.00 . . . . 0.1477 . . . . . . . . . . . 0.1739 'X-RAY DIFFRACTION' 2.02 2.10 . . 143 2706 100.00 . . . . 0.1411 . . . . . . . . . . . 0.1779 'X-RAY DIFFRACTION' 2.10 2.20 . . 140 2639 100.00 . . . . 0.1317 . . . . . . . . . . . 0.1552 'X-RAY DIFFRACTION' 2.20 2.31 . . 143 2670 100.00 . . . . 0.1450 . . . . . . . . . . . 0.1835 'X-RAY DIFFRACTION' 2.31 2.46 . . 147 2696 100.00 . . . . 0.1459 . . . . . . . . . . . 0.1958 'X-RAY DIFFRACTION' 2.46 2.65 . . 138 2658 100.00 . . . . 0.1658 . . . . . . . . . . . 0.1843 'X-RAY DIFFRACTION' 2.65 2.91 . . 143 2686 100.00 . . . . 0.1726 . . . . . . . . . . . 0.2166 'X-RAY DIFFRACTION' 2.91 3.33 . . 139 2666 100.00 . . . . 0.1751 . . . . . . . . . . . 0.1870 'X-RAY DIFFRACTION' 3.33 4.20 . . 146 2715 100.00 . . . . 0.1690 . . . . . . . . . . . 0.2215 'X-RAY DIFFRACTION' 4.20 43.79 . . 138 2666 99.75 . . . . 0.1943 . . . . . . . . . . . 0.1944 # _struct.entry_id 8OFE _struct.title 'E.coli Peptide Deformylase with bound inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OFE _struct_keywords.text 'Peptide Deformylase (EC 3.5.1.88), Inhibitor, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3SRA2_ECOLX _struct_ref.pdbx_db_accession C3SRA2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLE KSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVE KLDRLKARA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8OFE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3SRA2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 168 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8OFE GLY A 1 ? UNP C3SRA2 ? ? 'expression tag' -2 1 1 8OFE HIS A 2 ? UNP C3SRA2 ? ? 'expression tag' -1 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? LYS A 18 ? ASP A 10 LYS A 15 5 ? 6 HELX_P HELX_P2 AA2 ASN A 27 ? GLU A 44 ? ASN A 24 GLU A 41 1 ? 18 HELX_P HELX_P3 AA3 THR A 52 ? ASP A 55 ? THR A 49 ASP A 52 5 ? 4 HELX_P HELX_P4 AA4 GLY A 127 ? VAL A 141 ? GLY A 124 VAL A 138 1 ? 15 HELX_P HELX_P5 AA5 LEU A 144 ? LEU A 149 ? LEU A 141 LEU A 146 5 ? 6 HELX_P HELX_P6 AA6 SER A 150 ? ARG A 166 ? SER A 147 ARG A 163 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 93 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 90 A ZN 202 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc2 metalc ? ? A HIS 135 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 132 A ZN 202 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc3 metalc ? ? A HIS 139 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 136 A ZN 202 1_555 ? ? ? ? ? ? ? 2.169 ? ? metalc4 metalc ? ? B VLK . O1 ? ? ? 1_555 C ZN . ZN ? ? A VLK 201 A ZN 202 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc5 metalc ? ? B VLK . O2 ? ? ? 1_555 C ZN . ZN ? ? A VLK 201 A ZN 202 1_555 ? ? ? ? ? ? ? 2.140 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 115.4 ? 2 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 97.7 ? 3 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 106.2 ? 4 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O1 ? B VLK . ? A VLK 201 ? 1_555 86.7 ? 5 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O1 ? B VLK . ? A VLK 201 ? 1_555 112.1 ? 6 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O1 ? B VLK . ? A VLK 201 ? 1_555 135.0 ? 7 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O2 ? B VLK . ? A VLK 201 ? 1_555 147.6 ? 8 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O2 ? B VLK . ? A VLK 201 ? 1_555 95.2 ? 9 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O2 ? B VLK . ? A VLK 201 ? 1_555 82.7 ? 10 O1 ? B VLK . ? A VLK 201 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 O2 ? B VLK . ? A VLK 201 ? 1_555 71.4 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 11 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 8 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 12 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 9 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.50 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 48 ? ALA A 50 ? GLY A 45 ALA A 47 AA1 2 ILE A 60 ? ILE A 63 ? ILE A 57 ILE A 60 AA1 3 LEU A 73 ? SER A 84 ? LEU A 70 SER A 81 AA1 4 LYS A 108 ? LEU A 114 ? LYS A 105 LEU A 111 AA1 5 PRO A 120 ? ASP A 126 ? PRO A 117 ASP A 123 AA2 1 GLU A 90 ? GLU A 91 ? GLU A 87 GLU A 88 AA2 2 ALA A 101 ? LEU A 102 ? ALA A 98 LEU A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 49 ? N LEU A 46 O VAL A 62 ? O VAL A 59 AA1 2 3 N ILE A 63 ? N ILE A 60 O LEU A 73 ? O LEU A 70 AA1 3 4 N GLU A 79 ? N GLU A 76 O ARG A 112 ? O ARG A 109 AA1 4 5 N VAL A 109 ? N VAL A 106 O ALA A 125 ? O ALA A 122 AA2 1 2 N GLU A 91 ? N GLU A 88 O ALA A 101 ? O ALA A 98 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 54 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -95.39 _pdbx_validate_torsion.psi 52.80 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # _pdbx_entry_details.entry_id 8OFE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 412 ? 5.99 . 2 1 O ? A HOH 413 ? 6.21 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A HIS -1 ? A HIS 2 3 1 Y 1 A MET 0 ? A MET 3 4 1 Y 1 A LYS 165 ? A LYS 168 5 1 Y 1 A ALA 166 ? A ALA 169 6 1 Y 1 A ARG 167 ? A ARG 170 7 1 Y 1 A ALA 168 ? A ALA 171 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 VLK C1 C N N 364 VLK C2 C N N 365 VLK C6 C N R 366 VLK C5 C N N 367 VLK C4 C N N 368 VLK C3 C N N 369 VLK C11 C N N 370 VLK C10 C N S 371 VLK C8 C N N 372 VLK C18 C N N 373 VLK C17 C N N 374 VLK C19 C N N 375 VLK C7 C N N 376 VLK C9 C N N 377 VLK N1 N N N 378 VLK N2 N N N 379 VLK N3 N N N 380 VLK O1 O N N 381 VLK O2 O N N 382 VLK O3 O N N 383 VLK O4 O N N 384 VLK H1 H N N 385 VLK H2 H N N 386 VLK H3 H N N 387 VLK H5 H N N 388 VLK H4 H N N 389 VLK H12 H N N 390 VLK H10 H N N 391 VLK H11 H N N 392 VLK H8 H N N 393 VLK H9 H N N 394 VLK H6 H N N 395 VLK H7 H N N 396 VLK H18 H N N 397 VLK H16 H N N 398 VLK H31 H N N 399 VLK H30 H N N 400 VLK H32 H N N 401 VLK H29 H N N 402 VLK H35 H N N 403 VLK H33 H N N 404 VLK H34 H N N 405 VLK H14 H N N 406 VLK H13 H N N 407 VLK H17 H N N 408 VLK H15 H N N 409 VLK C14 C N N 410 VLK C12 C N N 411 VLK C15 C N N 412 VLK C16 C N N 413 VLK C13 C N N 414 VLK H19 H N N 415 VLK H20 H N N 416 VLK H21 H N N 417 VLK H22 H N N 418 VLK H23 H N N 419 VLK H24 H N N 420 VLK H25 H N N 421 VLK H27 H N N 422 VLK H28 H N N 423 VLK S1 S N N 424 VLK H26 H N N 425 ZN ZN ZN N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 VLK C18 C17 sing N N 348 VLK O3 C9 doub N N 349 VLK C17 C10 sing N N 350 VLK C17 C19 sing N N 351 VLK N3 C11 sing N N 352 VLK C10 C11 sing N N 353 VLK C10 N2 sing N N 354 VLK C9 N2 sing N N 355 VLK C9 C6 sing N N 356 VLK C11 O4 doub N N 357 VLK C7 C6 sing N N 358 VLK C7 N1 sing N N 359 VLK C6 C5 sing N N 360 VLK C5 C4 sing N N 361 VLK N1 C8 sing N N 362 VLK N1 O1 sing N N 363 VLK C8 O2 doub N N 364 VLK C4 C3 sing N N 365 VLK C3 C2 sing N N 366 VLK C1 C2 sing N N 367 VLK C1 H1 sing N N 368 VLK C1 H2 sing N N 369 VLK C1 H3 sing N N 370 VLK C2 H5 sing N N 371 VLK C2 H4 sing N N 372 VLK C6 H12 sing N N 373 VLK C5 H10 sing N N 374 VLK C5 H11 sing N N 375 VLK C4 H8 sing N N 376 VLK C4 H9 sing N N 377 VLK C3 H6 sing N N 378 VLK C3 H7 sing N N 379 VLK C10 H18 sing N N 380 VLK C8 H16 sing N N 381 VLK C18 H31 sing N N 382 VLK C18 H30 sing N N 383 VLK C18 H32 sing N N 384 VLK C17 H29 sing N N 385 VLK C19 H35 sing N N 386 VLK C19 H33 sing N N 387 VLK C19 H34 sing N N 388 VLK C7 H14 sing N N 389 VLK C7 H13 sing N N 390 VLK N2 H17 sing N N 391 VLK O1 H15 sing N N 392 VLK N3 C14 sing N N 393 VLK C14 C12 sing N N 394 VLK C12 C15 sing N N 395 VLK C15 C16 sing N N 396 VLK C16 N3 sing N N 397 VLK C14 C13 sing N N 398 VLK C14 H19 sing N N 399 VLK C12 H20 sing N N 400 VLK C12 H21 sing N N 401 VLK C15 H22 sing N N 402 VLK C15 H23 sing N N 403 VLK C16 H24 sing N N 404 VLK C16 H25 sing N N 405 VLK C13 H27 sing N N 406 VLK C13 H28 sing N N 407 VLK C13 S1 sing N N 408 VLK S1 H26 sing N N 409 # _pdbx_audit_support.funding_organization 'German Federal Ministry for Education and Research' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 16GW0224 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 VLK ? ? VLK ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1G2A _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8OFE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.018308 _atom_sites.fract_transf_matrix[1][2] 0.010570 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021141 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004315 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_