data_8OQG # _entry.id 8OQG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OQG pdb_00008oqg 10.2210/pdb8oqg/pdb WWPDB D_1292129195 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8OQG _pdbx_database_status.recvd_initial_deposition_date 2023-04-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Loreto, D.' 1 0000-0003-4897-8211 'Merlino, A.' 2 0000-0003-4964-1047 'Maity, B.' 3 0000-0001-9347-881X 'Ueno, T.' 4 0000-0001-9219-0726 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Inorg.Chem. _citation.journal_id_ASTM INOCAJ _citation.journal_id_CSD 0009 _citation.journal_id_ISSN 0020-1669 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 7515 _citation.page_last 7524 _citation.title 'Cross-Linked Crystals of Dirhodium Tetraacetate/RNase A Adduct Can Be Used as Heterogeneous Catalysts.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.inorgchem.3c00852 _citation.pdbx_database_id_PubMed 37144589 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Loreto, D.' 1 ? primary 'Maity, B.' 2 ? primary 'Morita, T.' 3 ? primary 'Nakamura, H.' 4 0000-0002-4511-2984 primary 'Merlino, A.' 5 0000-0002-1045-7720 primary 'Ueno, T.' 6 0000-0001-9219-0726 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8OQG _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.278 _cell.length_a_esd ? _cell.length_b 67.278 _cell.length_b_esd ? _cell.length_c 65.899 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OQG _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Ribonuclease pancreatic' 13708.326 1 4.6.1.18 ? ? ? 2 non-polymer syn 'dirhodium (II) tetraacetate' 446.019 1 ? ? ? ? 3 non-polymer syn 'dirhodium (II) oxide' 341.870 1 ? ? ? ? 4 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 127 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase 1,RNase A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_seq_one_letter_code_can ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 THR n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 LYS n 1 8 PHE n 1 9 GLU n 1 10 ARG n 1 11 GLN n 1 12 HIS n 1 13 MET n 1 14 ASP n 1 15 SER n 1 16 SER n 1 17 THR n 1 18 SER n 1 19 ALA n 1 20 ALA n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 ASN n 1 25 TYR n 1 26 CYS n 1 27 ASN n 1 28 GLN n 1 29 MET n 1 30 MET n 1 31 LYS n 1 32 SER n 1 33 ARG n 1 34 ASN n 1 35 LEU n 1 36 THR n 1 37 LYS n 1 38 ASP n 1 39 ARG n 1 40 CYS n 1 41 LYS n 1 42 PRO n 1 43 VAL n 1 44 ASN n 1 45 THR n 1 46 PHE n 1 47 VAL n 1 48 HIS n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 ALA n 1 53 ASP n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 VAL n 1 58 CYS n 1 59 SER n 1 60 GLN n 1 61 LYS n 1 62 ASN n 1 63 VAL n 1 64 ALA n 1 65 CYS n 1 66 LYS n 1 67 ASN n 1 68 GLY n 1 69 GLN n 1 70 THR n 1 71 ASN n 1 72 CYS n 1 73 TYR n 1 74 GLN n 1 75 SER n 1 76 TYR n 1 77 SER n 1 78 THR n 1 79 MET n 1 80 SER n 1 81 ILE n 1 82 THR n 1 83 ASP n 1 84 CYS n 1 85 ARG n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 SER n 1 90 SER n 1 91 LYS n 1 92 TYR n 1 93 PRO n 1 94 ASN n 1 95 CYS n 1 96 ALA n 1 97 TYR n 1 98 LYS n 1 99 THR n 1 100 THR n 1 101 GLN n 1 102 ALA n 1 103 ASN n 1 104 LYS n 1 105 HIS n 1 106 ILE n 1 107 ILE n 1 108 VAL n 1 109 ALA n 1 110 CYS n 1 111 GLU n 1 112 GLY n 1 113 ASN n 1 114 PRO n 1 115 TYR n 1 116 VAL n 1 117 PRO n 1 118 VAL n 1 119 HIS n 1 120 PHE n 1 121 ASP n 1 122 ALA n 1 123 SER n 1 124 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name cattle _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNAS1_BOVIN _struct_ref.pdbx_db_accession P61823 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _struct_ref.pdbx_align_begin 27 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8OQG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61823 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VVU non-polymer . 'dirhodium (II) tetraacetate' 'Rhodium(II) acetate' 'C8 H16 O8 Rh2 4' 446.019 VW5 non-polymer . 'dirhodium (II) oxide' ? 'H8 O8 Rh2 4' 341.870 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OQG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.5 M NaCl 3.3 M HCOONa 0.1 M Acetate buffer ; _exptl_crystal_grow.pdbx_pH_range 4.7-5.2 _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 273 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU HyPix-6000HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-07-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5406 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU PhotonJet-R' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5406 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8OQG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.60 _reflns.d_resolution_low 22.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23142 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.079 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1111 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.80 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 1.062 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.339 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.062 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.038 _refine.aniso_B[1][2] 0.019 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.038 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.124 _refine.B_iso_max ? _refine.B_iso_mean 21.270 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8OQG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.600 _refine.ls_d_res_low 22.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23142 _refine.ls_number_reflns_R_free 1164 _refine.ls_number_reflns_R_work 21978 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.836 _refine.ls_percent_reflns_R_free 5.030 _refine.ls_R_factor_all 0.183 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2015 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1823 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.079 _refine.pdbx_overall_ESU_R_Free 0.077 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.433 _refine.overall_SU_ML 0.074 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 951 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 127 _refine_hist.number_atoms_total 1106 _refine_hist.d_res_high 1.600 _refine_hist.d_res_low 22.02 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.012 1110 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 961 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 3.219 1.698 1523 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.542 1.593 2238 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.395 5.000 145 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 8.997 5.000 4 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.611 10.000 191 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.613 10.000 53 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.077 0.200 160 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1382 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 254 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.201 0.200 199 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.195 0.200 817 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 514 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 555 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.165 0.200 72 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.352 0.200 21 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.239 0.200 91 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.225 0.200 30 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.427 2.116 547 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.430 2.119 548 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.698 3.797 700 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.696 3.795 701 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.013 2.439 563 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.979 2.436 562 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.484 4.373 825 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.489 4.373 826 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 7.776 31.139 1241 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 7.237 27.956 1191 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.600 1.641 . . 101 1574 99.0538 . . . . 0.380 . . . . . . . . . . . 0.391 'X-RAY DIFFRACTION' 1.641 1.686 . . 85 1548 99.8777 . . . . 0.324 . . . . . . . . . . . 0.333 'X-RAY DIFFRACTION' 1.788 1.846 . . 71 1437 100.0000 . . . . 0.237 . . . . . . . . . . . 0.267 'X-RAY DIFFRACTION' 1.846 1.910 . . 94 1372 100.0000 . . . . 0.213 . . . . . . . . . . . 0.233 'X-RAY DIFFRACTION' 1.910 1.982 . . 49 1344 100.0000 . . . . 0.225 . . . . . . . . . . . 0.230 'X-RAY DIFFRACTION' 1.982 2.062 . . 42 1323 99.9268 . . . . 0.267 . . . . . . . . . . . 0.288 'X-RAY DIFFRACTION' 2.062 2.153 . . 59 1244 100.0000 . . . . 0.160 . . . . . . . . . . . 0.199 'X-RAY DIFFRACTION' 2.153 2.257 . . 67 1185 100.0000 . . . . 0.151 . . . . . . . . . . . 0.188 'X-RAY DIFFRACTION' 2.257 2.378 . . 60 1141 100.0000 . . . . 0.145 . . . . . . . . . . . 0.186 'X-RAY DIFFRACTION' 2.378 2.520 . . 49 1077 100.0000 . . . . 0.140 . . . . . . . . . . . 0.197 'X-RAY DIFFRACTION' 2.520 2.691 . . 31 1053 100.0000 . . . . 0.154 . . . . . . . . . . . 0.165 'X-RAY DIFFRACTION' 2.691 2.904 . . 53 929 99.7967 . . . . 0.172 . . . . . . . . . . . 0.245 'X-RAY DIFFRACTION' 2.904 3.175 . . 54 876 100.0000 . . . . 0.171 . . . . . . . . . . . 0.193 'X-RAY DIFFRACTION' 3.175 3.541 . . 38 809 100.0000 . . . . 0.139 . . . . . . . . . . . 0.163 'X-RAY DIFFRACTION' 3.541 4.071 . . 45 702 100.0000 . . . . 0.120 . . . . . . . . . . . 0.144 'X-RAY DIFFRACTION' 4.944 6.822 . . 38 478 100.0000 . . . . 0.157 . . . . . . . . . . . 0.157 # _struct.entry_id 8OQG _struct.title 'Cross-linked crystal of dirhodium tetraacetate/ribonuclease A adduct in the P3221 space group (high temperature data collection)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OQG _struct_keywords.text 'Metal/protein adduct, dirhodium tetraacettate, catalysis, porous material, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 3 ? MET A 13 ? THR A 3 MET A 13 1 ? 11 HELX_P HELX_P2 AA2 ASN A 24 ? ARG A 33 ? ASN A 24 ARG A 33 1 ? 10 HELX_P HELX_P3 AA3 SER A 50 ? VAL A 57 ? SER A 50 VAL A 57 1 ? 8 HELX_P HELX_P4 AA4 CYS A 58 ? GLN A 60 ? CYS A 58 GLN A 60 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 26 A CYS 84 1_555 ? ? ? ? ? ? ? 2.011 ? ? disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 40 A CYS 95 1_555 ? ? ? ? ? ? ? 2.007 ? ? disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 1.980 ? ? disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 2.013 ? ? metalc1 metalc ? ? A HIS 105 NE2 ? ? ? 1_555 B VVU . RH1 ? ? A HIS 105 A VVU 201 1_555 ? ? ? ? ? ? ? 2.245 ? ? metalc2 metalc ? ? A HIS 119 ND1 B ? ? 1_555 C VW5 . RH4 B ? A HIS 119 A VW5 202 1_555 ? ? ? ? ? ? ? 2.171 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 1 6.46 2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 -0.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 43 ? VAL A 47 ? VAL A 43 VAL A 47 AA1 2 MET A 79 ? GLU A 86 ? MET A 79 GLU A 86 AA1 3 TYR A 97 ? GLU A 111 ? TYR A 97 GLU A 111 AA1 4 CYS A 72 ? GLN A 74 ? CYS A 72 GLN A 74 AA1 5 LYS A 61 ? VAL A 63 ? LYS A 61 VAL A 63 AA2 1 VAL A 43 ? VAL A 47 ? VAL A 43 VAL A 47 AA2 2 MET A 79 ? GLU A 86 ? MET A 79 GLU A 86 AA2 3 TYR A 97 ? GLU A 111 ? TYR A 97 GLU A 111 AA2 4 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 46 ? N PHE A 46 O THR A 82 ? O THR A 82 AA1 2 3 N MET A 79 ? N MET A 79 O LYS A 104 ? O LYS A 104 AA1 3 4 O VAL A 108 ? O VAL A 108 N TYR A 73 ? N TYR A 73 AA1 4 5 O GLN A 74 ? O GLN A 74 N LYS A 61 ? N LYS A 61 AA2 1 2 N PHE A 46 ? N PHE A 46 O THR A 82 ? O THR A 82 AA2 2 3 N MET A 79 ? N MET A 79 O LYS A 104 ? O LYS A 104 AA2 3 4 N ALA A 109 ? N ALA A 109 O VAL A 118 ? O VAL A 118 # _atom_sites.entry_id 8OQG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014864 _atom_sites.fract_transf_matrix[1][2] 0.008582 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017163 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015175 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.2115 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 RH 45 45 19.2969 0.7515 14.3510 8.2176 4.7345 25.8749 1.2893 98.6062 5.2464 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.1842 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 VAL 124 124 124 VAL VAL A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email domenico.loreto@unina.it _pdbx_contact_author.name_first Domenico _pdbx_contact_author.name_last Loreto _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4897-8211 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 VVU 1 201 201 VVU YYT A . C 3 VW5 1 202 202 VW5 XRD A . D 4 FMT 1 203 203 FMT FMT A . E 5 CL 1 204 1 CL CL A . F 6 HOH 1 301 24 HOH HOH A . F 6 HOH 2 302 130 HOH HOH A . F 6 HOH 3 303 128 HOH HOH A . F 6 HOH 4 304 25 HOH HOH A . F 6 HOH 5 305 132 HOH HOH A . F 6 HOH 6 306 129 HOH HOH A . F 6 HOH 7 307 55 HOH HOH A . F 6 HOH 8 308 99 HOH HOH A . F 6 HOH 9 309 134 HOH HOH A . F 6 HOH 10 310 77 HOH HOH A . F 6 HOH 11 311 47 HOH HOH A . F 6 HOH 12 312 37 HOH HOH A . F 6 HOH 13 313 116 HOH HOH A . F 6 HOH 14 314 104 HOH HOH A . F 6 HOH 15 315 14 HOH HOH A . F 6 HOH 16 316 4 HOH HOH A . F 6 HOH 17 317 31 HOH HOH A . F 6 HOH 18 318 20 HOH HOH A . F 6 HOH 19 319 90 HOH HOH A . F 6 HOH 20 320 61 HOH HOH A . F 6 HOH 21 321 76 HOH HOH A . F 6 HOH 22 322 30 HOH HOH A . F 6 HOH 23 323 51 HOH HOH A . F 6 HOH 24 324 52 HOH HOH A . F 6 HOH 25 325 66 HOH HOH A . F 6 HOH 26 326 34 HOH HOH A . F 6 HOH 27 327 57 HOH HOH A . F 6 HOH 28 328 78 HOH HOH A . F 6 HOH 29 329 33 HOH HOH A . F 6 HOH 30 330 16 HOH HOH A . F 6 HOH 31 331 73 HOH HOH A . F 6 HOH 32 332 50 HOH HOH A . F 6 HOH 33 333 54 HOH HOH A . F 6 HOH 34 334 136 HOH HOH A . F 6 HOH 35 335 82 HOH HOH A . F 6 HOH 36 336 23 HOH HOH A . F 6 HOH 37 337 83 HOH HOH A . F 6 HOH 38 338 85 HOH HOH A . F 6 HOH 39 339 11 HOH HOH A . F 6 HOH 40 340 9 HOH HOH A . F 6 HOH 41 341 28 HOH HOH A . F 6 HOH 42 342 103 HOH HOH A . F 6 HOH 43 343 46 HOH HOH A . F 6 HOH 44 344 42 HOH HOH A . F 6 HOH 45 345 70 HOH HOH A . F 6 HOH 46 346 36 HOH HOH A . F 6 HOH 47 347 65 HOH HOH A . F 6 HOH 48 348 60 HOH HOH A . F 6 HOH 49 349 56 HOH HOH A . F 6 HOH 50 350 38 HOH HOH A . F 6 HOH 51 351 22 HOH HOH A . F 6 HOH 52 352 110 HOH HOH A . F 6 HOH 53 353 81 HOH HOH A . F 6 HOH 54 354 107 HOH HOH A . F 6 HOH 55 355 124 HOH HOH A . F 6 HOH 56 356 27 HOH HOH A . F 6 HOH 57 357 126 HOH HOH A . F 6 HOH 58 358 5 HOH HOH A . F 6 HOH 59 359 68 HOH HOH A . F 6 HOH 60 360 13 HOH HOH A . F 6 HOH 61 361 80 HOH HOH A . F 6 HOH 62 362 39 HOH HOH A . F 6 HOH 63 363 75 HOH HOH A . F 6 HOH 64 364 8 HOH HOH A . F 6 HOH 65 365 48 HOH HOH A . F 6 HOH 66 366 119 HOH HOH A . F 6 HOH 67 367 6 HOH HOH A . F 6 HOH 68 368 95 HOH HOH A . F 6 HOH 69 369 79 HOH HOH A . F 6 HOH 70 370 62 HOH HOH A . F 6 HOH 71 371 69 HOH HOH A . F 6 HOH 72 372 87 HOH HOH A . F 6 HOH 73 373 15 HOH HOH A . F 6 HOH 74 374 63 HOH HOH A . F 6 HOH 75 375 122 HOH HOH A . F 6 HOH 76 376 74 HOH HOH A . F 6 HOH 77 377 106 HOH HOH A . F 6 HOH 78 378 53 HOH HOH A . F 6 HOH 79 379 41 HOH HOH A . F 6 HOH 80 380 117 HOH HOH A . F 6 HOH 81 381 35 HOH HOH A . F 6 HOH 82 382 118 HOH HOH A . F 6 HOH 83 383 97 HOH HOH A . F 6 HOH 84 384 49 HOH HOH A . F 6 HOH 85 385 71 HOH HOH A . F 6 HOH 86 386 10 HOH HOH A . F 6 HOH 87 387 26 HOH HOH A . F 6 HOH 88 388 17 HOH HOH A . F 6 HOH 89 389 72 HOH HOH A . F 6 HOH 90 390 100 HOH HOH A . F 6 HOH 91 391 135 HOH HOH A . F 6 HOH 92 392 45 HOH HOH A . F 6 HOH 93 393 59 HOH HOH A . F 6 HOH 94 394 32 HOH HOH A . F 6 HOH 95 395 123 HOH HOH A . F 6 HOH 96 396 21 HOH HOH A . F 6 HOH 97 397 12 HOH HOH A . F 6 HOH 98 398 18 HOH HOH A . F 6 HOH 99 399 7 HOH HOH A . F 6 HOH 100 400 40 HOH HOH A . F 6 HOH 101 401 29 HOH HOH A . F 6 HOH 102 402 98 HOH HOH A . F 6 HOH 103 403 64 HOH HOH A . F 6 HOH 104 404 114 HOH HOH A . F 6 HOH 105 405 19 HOH HOH A . F 6 HOH 106 406 88 HOH HOH A . F 6 HOH 107 407 96 HOH HOH A . F 6 HOH 108 408 131 HOH HOH A . F 6 HOH 109 409 133 HOH HOH A . F 6 HOH 110 410 112 HOH HOH A . F 6 HOH 111 411 127 HOH HOH A . F 6 HOH 112 412 108 HOH HOH A . F 6 HOH 113 413 86 HOH HOH A . F 6 HOH 114 414 121 HOH HOH A . F 6 HOH 115 415 67 HOH HOH A . F 6 HOH 116 416 113 HOH HOH A . F 6 HOH 117 417 93 HOH HOH A . F 6 HOH 118 418 89 HOH HOH A . F 6 HOH 119 419 94 HOH HOH A . F 6 HOH 120 420 111 HOH HOH A . F 6 HOH 121 421 125 HOH HOH A . F 6 HOH 122 422 137 HOH HOH A . F 6 HOH 123 423 101 HOH HOH A . F 6 HOH 124 424 115 HOH HOH A . F 6 HOH 125 425 105 HOH HOH A . F 6 HOH 126 426 109 HOH HOH A . F 6 HOH 127 427 120 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 220 ? 1 MORE -6 ? 1 'SSA (A^2)' 7230 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O1 ? B VVU . ? A VVU 201 ? 1_555 94.9 ? 2 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O7 ? B VVU . ? A VVU 201 ? 1_555 94.8 ? 3 O1 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O7 ? B VVU . ? A VVU 201 ? 1_555 87.1 ? 4 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 RH2 ? B VVU . ? A VVU 201 ? 1_555 178.1 ? 5 O1 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 RH2 ? B VVU . ? A VVU 201 ? 1_555 84.1 ? 6 O7 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 RH2 ? B VVU . ? A VVU 201 ? 1_555 83.6 ? 7 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O0 ? B VVU . ? A VVU 201 ? 1_555 88.9 ? 8 O1 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O0 ? B VVU . ? A VVU 201 ? 1_555 90.9 ? 9 O7 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O0 ? B VVU . ? A VVU 201 ? 1_555 175.9 ? 10 RH2 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O0 ? B VVU . ? A VVU 201 ? 1_555 92.7 ? 11 NE2 ? A HIS 105 ? A HIS 105 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O3 ? B VVU . ? A VVU 201 ? 1_555 89.9 ? 12 O1 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O3 ? B VVU . ? A VVU 201 ? 1_555 175.0 ? 13 O7 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O3 ? B VVU . ? A VVU 201 ? 1_555 91.2 ? 14 RH2 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O3 ? B VVU . ? A VVU 201 ? 1_555 91.1 ? 15 O0 ? B VVU . ? A VVU 201 ? 1_555 RH1 ? B VVU . ? A VVU 201 ? 1_555 O3 ? B VVU . ? A VVU 201 ? 1_555 90.6 ? 16 ND1 B A HIS 119 ? A HIS 119 ? 1_555 RH4 B C VW5 . ? A VW5 202 ? 1_555 RH3 B C VW5 . ? A VW5 202 ? 1_555 169.7 ? 17 ND1 B A HIS 119 ? A HIS 119 ? 1_555 RH4 B C VW5 . ? A VW5 202 ? 1_555 O3 B C VW5 . ? A VW5 202 ? 1_555 92.8 ? 18 RH3 B C VW5 . ? A VW5 202 ? 1_555 RH4 B C VW5 . ? A VW5 202 ? 1_555 O3 B C VW5 . ? A VW5 202 ? 1_555 90.9 ? 19 ND1 B A HIS 119 ? A HIS 119 ? 1_555 RH4 B C VW5 . ? A VW5 202 ? 1_555 O2 B C VW5 . ? A VW5 202 ? 1_555 90.1 ? 20 RH3 B C VW5 . ? A VW5 202 ? 1_555 RH4 B C VW5 . ? A VW5 202 ? 1_555 O2 B C VW5 . ? A VW5 202 ? 1_555 86.3 ? 21 O3 B C VW5 . ? A VW5 202 ? 1_555 RH4 B C VW5 . ? A VW5 202 ? 1_555 O2 B C VW5 . ? A VW5 202 ? 1_555 177.2 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0405 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8OQG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 48 ? ? -109.16 56.65 2 1 GLN A 60 ? ? -102.20 -128.66 3 1 SER A 90 ? ? -28.45 128.21 4 1 ASN A 94 ? A -101.69 71.59 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 85 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.075 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ILE 81 ? CD1 A A ILE 81 CD1 2 1 N 1 A VW5 202 ? O8 ? C VW5 1 O8 3 1 N 1 A VW5 202 ? O7 ? C VW5 1 O7 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'University of Naples Federico II' Italy ? 1 'Compagnia di San Paolo Foundation' Italy ? 2 'Japan Society for the Promotion of Science (JSPS)' Japan 22H00347 3 'Japan Society for the Promotion of Science (JSPS)' Japan JP18H05421 4 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 VW5 ? ? VW5 ? ? 'SUBJECT OF INVESTIGATION' ? 2 VVU ? ? VVU ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'dirhodium (II) tetraacetate' VVU 3 'dirhodium (II) oxide' VW5 4 'FORMIC ACID' FMT 5 'CHLORIDE ION' CL 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5OGH _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #