data_8OR5 # _entry.id 8OR5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.376 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OR5 pdb_00008or5 10.2210/pdb8or5/pdb WWPDB D_1292129816 ? ? BMRB 34804 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of Notch1 TMD' _pdbx_database_related.db_id 34804 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8OR5 _pdbx_database_status.recvd_initial_deposition_date 2023-04-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guschtschin-Schmidt, N.' 1 0000-0002-6650-1188 'Muhle-Goll, C.' 2 0000-0002-9474-9041 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 435 _citation.language ? _citation.page_first 168218 _citation.page_last 168218 _citation.title 'Permissive Conformations of a Transmembrane Helix Allow Intramembrane Proteolysis by gamma-Secretase.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2023.168218 _citation.pdbx_database_id_PubMed 37536392 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ortner, M.' 1 ? primary 'Guschtschin-Schmidt, N.' 2 ? primary 'Stelzer, W.' 3 ? primary 'Muhle-Goll, C.' 4 ? primary 'Langosch, D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Notch 1 extracellular truncation' _entity.formula_weight 3365.254 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Notch1 transmembrane domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name NEXT # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KKKLHFMYVAAAAFVLLFFVGCGVLLSKKK _entity_poly.pdbx_seq_one_letter_code_can KKKLHFMYVAAAAFVLLFFVGCGVLLSKKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 LYS n 1 4 LEU n 1 5 HIS n 1 6 PHE n 1 7 MET n 1 8 TYR n 1 9 VAL n 1 10 ALA n 1 11 ALA n 1 12 ALA n 1 13 ALA n 1 14 PHE n 1 15 VAL n 1 16 LEU n 1 17 LEU n 1 18 PHE n 1 19 PHE n 1 20 VAL n 1 21 GLY n 1 22 CYS n 1 23 GLY n 1 24 VAL n 1 25 LEU n 1 26 LEU n 1 27 SER n 1 28 LYS n 1 29 LYS n 1 30 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 30 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NOTC1_HUMAN _struct_ref.pdbx_db_accession P46531 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LHFMYVAAAAFVLLFFVGCGVLLSRKR _struct_ref.pdbx_align_begin 1734 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8OR5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P46531 _struct_ref_seq.db_align_beg 1734 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1760 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1734 _struct_ref_seq.pdbx_auth_seq_align_end 1760 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8OR5 LYS A 1 ? UNP P46531 ? ? 'expression tag' 1731 1 1 8OR5 LYS A 2 ? UNP P46531 ? ? 'expression tag' 1732 2 1 8OR5 LYS A 3 ? UNP P46531 ? ? 'expression tag' 1733 3 1 8OR5 LYS A 28 ? UNP P46531 ARG 1758 conflict 1758 4 1 8OR5 LYS A 30 ? UNP P46531 ARG 1760 conflict 1760 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '2D 1H-1H TOCSY' 1 isotropic 3 1 1 '2D 1H-13C HSQC' 1 isotropic 4 1 1 '2D 1H-15N HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength . _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '500 uM Notch1 WT TMD, trifluoroethanol/water 80/20' _pdbx_nmr_sample_details.solvent_system 'trifluoroethanol/water 80/20' _pdbx_nmr_sample_details.label 'Notch1 WT' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8OR5 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8OR5 _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8OR5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS 1.2.1 'Brunger, Adams, Clore, Gros, Nilges and Read' 2 'structure calculation' ARIA 2.3.2 ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 'Vranken WF, Boucher W, Stevens TJ, Fogh RH, Pajon A, Llinas M, Ulrich EL, Markley JL, Ionides J, Laue ED.' 4 'peak picking' 'CcpNmr Analysis' 2.4.2 'Vranken WF, Boucher W, Stevens TJ, Fogh RH, Pajon A, Llinas M, Ulrich EL, Markley JL, Ionides J, Laue ED.' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OR5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8OR5 _struct.title 'Solution NMR structure of Notch1 TMD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OR5 _struct_keywords.text 'Notch1, gamma secretase, transmembrane, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 1 ? VAL A 15 ? LYS A 1731 VAL A 1745 1 ? 15 HELX_P HELX_P2 AA2 VAL A 15 ? GLY A 21 ? VAL A 1745 GLY A 1751 1 ? 7 HELX_P HELX_P3 AA3 CYS A 22 ? LYS A 29 ? CYS A 1752 LYS A 1759 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 8OR5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1731 1731 LYS LYS A . n A 1 2 LYS 2 1732 1732 LYS LYS A . n A 1 3 LYS 3 1733 1733 LYS LYS A . n A 1 4 LEU 4 1734 1734 LEU LEU A . n A 1 5 HIS 5 1735 1735 HIS HIS A . n A 1 6 PHE 6 1736 1736 PHE PHE A . n A 1 7 MET 7 1737 1737 MET MET A . n A 1 8 TYR 8 1738 1738 TYR TYR A . n A 1 9 VAL 9 1739 1739 VAL VAL A . n A 1 10 ALA 10 1740 1740 ALA ALA A . n A 1 11 ALA 11 1741 1741 ALA ALA A . n A 1 12 ALA 12 1742 1742 ALA ALA A . n A 1 13 ALA 13 1743 1743 ALA ALA A . n A 1 14 PHE 14 1744 1744 PHE PHE A . n A 1 15 VAL 15 1745 1745 VAL VAL A . n A 1 16 LEU 16 1746 1746 LEU LEU A . n A 1 17 LEU 17 1747 1747 LEU LEU A . n A 1 18 PHE 18 1748 1748 PHE PHE A . n A 1 19 PHE 19 1749 1749 PHE PHE A . n A 1 20 VAL 20 1750 1750 VAL VAL A . n A 1 21 GLY 21 1751 1751 GLY GLY A . n A 1 22 CYS 22 1752 1752 CYS CYS A . n A 1 23 GLY 23 1753 1753 GLY GLY A . n A 1 24 VAL 24 1754 1754 VAL VAL A . n A 1 25 LEU 25 1755 1755 LEU LEU A . n A 1 26 LEU 26 1756 1756 LEU LEU A . n A 1 27 SER 27 1757 1757 SER SER A . n A 1 28 LYS 28 1758 1758 LYS LYS A . n A 1 29 LYS 29 1759 1759 LYS LYS A . n A 1 30 LYS 30 1760 1760 LYS LYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email claudia.muhle-goll@kit.edu _pdbx_contact_author.name_first Claudia _pdbx_contact_author.name_last Muhle-Goll _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9474-9041 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-08-16 2 'Structure model' 1 1 2023-08-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation.journal_volume' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Notch1 WT TMD' _pdbx_nmr_exptl_sample.concentration 500 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 1736 ? ? -92.03 -61.79 2 2 PHE A 1736 ? ? -92.85 -61.49 3 3 PHE A 1736 ? ? -92.28 -61.74 4 4 PHE A 1736 ? ? -91.99 -60.70 5 6 PHE A 1736 ? ? -92.45 -61.65 6 7 PHE A 1736 ? ? -92.54 -61.22 7 10 PHE A 1736 ? ? -92.57 -61.22 8 10 LYS A 1759 ? ? 55.73 76.28 9 11 PHE A 1736 ? ? -92.25 -60.15 10 13 PHE A 1736 ? ? -91.64 -61.73 11 15 PHE A 1736 ? ? -92.24 -61.67 12 16 PHE A 1736 ? ? -92.27 -61.21 13 17 PHE A 1736 ? ? -91.38 -60.58 14 19 PHE A 1736 ? ? -92.40 -61.21 15 20 PHE A 1736 ? ? -92.22 -61.53 16 21 PHE A 1736 ? ? -92.18 -60.17 17 22 PHE A 1736 ? ? -92.22 -61.32 18 23 PHE A 1736 ? ? -92.66 -60.92 19 24 PHE A 1736 ? ? -92.75 -61.79 20 25 PHE A 1736 ? ? -92.42 -60.87 21 28 PHE A 1736 ? ? -92.42 -60.15 22 29 PHE A 1736 ? ? -92.11 -61.69 23 29 LYS A 1759 ? ? 49.53 87.30 24 30 PHE A 1736 ? ? -92.64 -61.34 25 33 PHE A 1736 ? ? -92.05 -61.31 26 36 PHE A 1736 ? ? -91.88 -61.18 27 37 PHE A 1736 ? ? -92.39 -61.49 28 37 LYS A 1759 ? ? 52.08 87.30 29 38 PHE A 1736 ? ? -92.64 -61.46 30 38 LYS A 1759 ? ? 52.73 77.62 31 39 PHE A 1736 ? ? -92.37 -61.17 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 GLY N N N N 55 GLY CA C N N 56 GLY C C N N 57 GLY O O N N 58 GLY OXT O N N 59 GLY H H N N 60 GLY H2 H N N 61 GLY HA2 H N N 62 GLY HA3 H N N 63 GLY HXT H N N 64 HIS N N N N 65 HIS CA C N S 66 HIS C C N N 67 HIS O O N N 68 HIS CB C N N 69 HIS CG C Y N 70 HIS ND1 N Y N 71 HIS CD2 C Y N 72 HIS CE1 C Y N 73 HIS NE2 N Y N 74 HIS OXT O N N 75 HIS H H N N 76 HIS H2 H N N 77 HIS HA H N N 78 HIS HB2 H N N 79 HIS HB3 H N N 80 HIS HD1 H N N 81 HIS HD2 H N N 82 HIS HE1 H N N 83 HIS HE2 H N N 84 HIS HXT H N N 85 LEU N N N N 86 LEU CA C N S 87 LEU C C N N 88 LEU O O N N 89 LEU CB C N N 90 LEU CG C N N 91 LEU CD1 C N N 92 LEU CD2 C N N 93 LEU OXT O N N 94 LEU H H N N 95 LEU H2 H N N 96 LEU HA H N N 97 LEU HB2 H N N 98 LEU HB3 H N N 99 LEU HG H N N 100 LEU HD11 H N N 101 LEU HD12 H N N 102 LEU HD13 H N N 103 LEU HD21 H N N 104 LEU HD22 H N N 105 LEU HD23 H N N 106 LEU HXT H N N 107 LYS N N N N 108 LYS CA C N S 109 LYS C C N N 110 LYS O O N N 111 LYS CB C N N 112 LYS CG C N N 113 LYS CD C N N 114 LYS CE C N N 115 LYS NZ N N N 116 LYS OXT O N N 117 LYS H H N N 118 LYS H2 H N N 119 LYS HA H N N 120 LYS HB2 H N N 121 LYS HB3 H N N 122 LYS HG2 H N N 123 LYS HG3 H N N 124 LYS HD2 H N N 125 LYS HD3 H N N 126 LYS HE2 H N N 127 LYS HE3 H N N 128 LYS HZ1 H N N 129 LYS HZ2 H N N 130 LYS HZ3 H N N 131 LYS HXT H N N 132 MET N N N N 133 MET CA C N S 134 MET C C N N 135 MET O O N N 136 MET CB C N N 137 MET CG C N N 138 MET SD S N N 139 MET CE C N N 140 MET OXT O N N 141 MET H H N N 142 MET H2 H N N 143 MET HA H N N 144 MET HB2 H N N 145 MET HB3 H N N 146 MET HG2 H N N 147 MET HG3 H N N 148 MET HE1 H N N 149 MET HE2 H N N 150 MET HE3 H N N 151 MET HXT H N N 152 PHE N N N N 153 PHE CA C N S 154 PHE C C N N 155 PHE O O N N 156 PHE CB C N N 157 PHE CG C Y N 158 PHE CD1 C Y N 159 PHE CD2 C Y N 160 PHE CE1 C Y N 161 PHE CE2 C Y N 162 PHE CZ C Y N 163 PHE OXT O N N 164 PHE H H N N 165 PHE H2 H N N 166 PHE HA H N N 167 PHE HB2 H N N 168 PHE HB3 H N N 169 PHE HD1 H N N 170 PHE HD2 H N N 171 PHE HE1 H N N 172 PHE HE2 H N N 173 PHE HZ H N N 174 PHE HXT H N N 175 SER N N N N 176 SER CA C N S 177 SER C C N N 178 SER O O N N 179 SER CB C N N 180 SER OG O N N 181 SER OXT O N N 182 SER H H N N 183 SER H2 H N N 184 SER HA H N N 185 SER HB2 H N N 186 SER HB3 H N N 187 SER HG H N N 188 SER HXT H N N 189 TYR N N N N 190 TYR CA C N S 191 TYR C C N N 192 TYR O O N N 193 TYR CB C N N 194 TYR CG C Y N 195 TYR CD1 C Y N 196 TYR CD2 C Y N 197 TYR CE1 C Y N 198 TYR CE2 C Y N 199 TYR CZ C Y N 200 TYR OH O N N 201 TYR OXT O N N 202 TYR H H N N 203 TYR H2 H N N 204 TYR HA H N N 205 TYR HB2 H N N 206 TYR HB3 H N N 207 TYR HD1 H N N 208 TYR HD2 H N N 209 TYR HE1 H N N 210 TYR HE2 H N N 211 TYR HH H N N 212 TYR HXT H N N 213 VAL N N N N 214 VAL CA C N S 215 VAL C C N N 216 VAL O O N N 217 VAL CB C N N 218 VAL CG1 C N N 219 VAL CG2 C N N 220 VAL OXT O N N 221 VAL H H N N 222 VAL H2 H N N 223 VAL HA H N N 224 VAL HB H N N 225 VAL HG11 H N N 226 VAL HG12 H N N 227 VAL HG13 H N N 228 VAL HG21 H N N 229 VAL HG22 H N N 230 VAL HG23 H N N 231 VAL HXT H N N 232 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 GLY N CA sing N N 52 GLY N H sing N N 53 GLY N H2 sing N N 54 GLY CA C sing N N 55 GLY CA HA2 sing N N 56 GLY CA HA3 sing N N 57 GLY C O doub N N 58 GLY C OXT sing N N 59 GLY OXT HXT sing N N 60 HIS N CA sing N N 61 HIS N H sing N N 62 HIS N H2 sing N N 63 HIS CA C sing N N 64 HIS CA CB sing N N 65 HIS CA HA sing N N 66 HIS C O doub N N 67 HIS C OXT sing N N 68 HIS CB CG sing N N 69 HIS CB HB2 sing N N 70 HIS CB HB3 sing N N 71 HIS CG ND1 sing Y N 72 HIS CG CD2 doub Y N 73 HIS ND1 CE1 doub Y N 74 HIS ND1 HD1 sing N N 75 HIS CD2 NE2 sing Y N 76 HIS CD2 HD2 sing N N 77 HIS CE1 NE2 sing Y N 78 HIS CE1 HE1 sing N N 79 HIS NE2 HE2 sing N N 80 HIS OXT HXT sing N N 81 LEU N CA sing N N 82 LEU N H sing N N 83 LEU N H2 sing N N 84 LEU CA C sing N N 85 LEU CA CB sing N N 86 LEU CA HA sing N N 87 LEU C O doub N N 88 LEU C OXT sing N N 89 LEU CB CG sing N N 90 LEU CB HB2 sing N N 91 LEU CB HB3 sing N N 92 LEU CG CD1 sing N N 93 LEU CG CD2 sing N N 94 LEU CG HG sing N N 95 LEU CD1 HD11 sing N N 96 LEU CD1 HD12 sing N N 97 LEU CD1 HD13 sing N N 98 LEU CD2 HD21 sing N N 99 LEU CD2 HD22 sing N N 100 LEU CD2 HD23 sing N N 101 LEU OXT HXT sing N N 102 LYS N CA sing N N 103 LYS N H sing N N 104 LYS N H2 sing N N 105 LYS CA C sing N N 106 LYS CA CB sing N N 107 LYS CA HA sing N N 108 LYS C O doub N N 109 LYS C OXT sing N N 110 LYS CB CG sing N N 111 LYS CB HB2 sing N N 112 LYS CB HB3 sing N N 113 LYS CG CD sing N N 114 LYS CG HG2 sing N N 115 LYS CG HG3 sing N N 116 LYS CD CE sing N N 117 LYS CD HD2 sing N N 118 LYS CD HD3 sing N N 119 LYS CE NZ sing N N 120 LYS CE HE2 sing N N 121 LYS CE HE3 sing N N 122 LYS NZ HZ1 sing N N 123 LYS NZ HZ2 sing N N 124 LYS NZ HZ3 sing N N 125 LYS OXT HXT sing N N 126 MET N CA sing N N 127 MET N H sing N N 128 MET N H2 sing N N 129 MET CA C sing N N 130 MET CA CB sing N N 131 MET CA HA sing N N 132 MET C O doub N N 133 MET C OXT sing N N 134 MET CB CG sing N N 135 MET CB HB2 sing N N 136 MET CB HB3 sing N N 137 MET CG SD sing N N 138 MET CG HG2 sing N N 139 MET CG HG3 sing N N 140 MET SD CE sing N N 141 MET CE HE1 sing N N 142 MET CE HE2 sing N N 143 MET CE HE3 sing N N 144 MET OXT HXT sing N N 145 PHE N CA sing N N 146 PHE N H sing N N 147 PHE N H2 sing N N 148 PHE CA C sing N N 149 PHE CA CB sing N N 150 PHE CA HA sing N N 151 PHE C O doub N N 152 PHE C OXT sing N N 153 PHE CB CG sing N N 154 PHE CB HB2 sing N N 155 PHE CB HB3 sing N N 156 PHE CG CD1 doub Y N 157 PHE CG CD2 sing Y N 158 PHE CD1 CE1 sing Y N 159 PHE CD1 HD1 sing N N 160 PHE CD2 CE2 doub Y N 161 PHE CD2 HD2 sing N N 162 PHE CE1 CZ doub Y N 163 PHE CE1 HE1 sing N N 164 PHE CE2 CZ sing Y N 165 PHE CE2 HE2 sing N N 166 PHE CZ HZ sing N N 167 PHE OXT HXT sing N N 168 SER N CA sing N N 169 SER N H sing N N 170 SER N H2 sing N N 171 SER CA C sing N N 172 SER CA CB sing N N 173 SER CA HA sing N N 174 SER C O doub N N 175 SER C OXT sing N N 176 SER CB OG sing N N 177 SER CB HB2 sing N N 178 SER CB HB3 sing N N 179 SER OG HG sing N N 180 SER OXT HXT sing N N 181 TYR N CA sing N N 182 TYR N H sing N N 183 TYR N H2 sing N N 184 TYR CA C sing N N 185 TYR CA CB sing N N 186 TYR CA HA sing N N 187 TYR C O doub N N 188 TYR C OXT sing N N 189 TYR CB CG sing N N 190 TYR CB HB2 sing N N 191 TYR CB HB3 sing N N 192 TYR CG CD1 doub Y N 193 TYR CG CD2 sing Y N 194 TYR CD1 CE1 sing Y N 195 TYR CD1 HD1 sing N N 196 TYR CD2 CE2 doub Y N 197 TYR CD2 HD2 sing N N 198 TYR CE1 CZ doub Y N 199 TYR CE1 HE1 sing N N 200 TYR CE2 CZ sing Y N 201 TYR CE2 HE2 sing N N 202 TYR CZ OH sing N N 203 TYR OH HH sing N N 204 TYR OXT HXT sing N N 205 VAL N CA sing N N 206 VAL N H sing N N 207 VAL N H2 sing N N 208 VAL CA C sing N N 209 VAL CA CB sing N N 210 VAL CA HA sing N N 211 VAL C O doub N N 212 VAL C OXT sing N N 213 VAL CB CG1 sing N N 214 VAL CB CG2 sing N N 215 VAL CB HB sing N N 216 VAL CG1 HG11 sing N N 217 VAL CG1 HG12 sing N N 218 VAL CG1 HG13 sing N N 219 VAL CG2 HG21 sing N N 220 VAL CG2 HG22 sing N N 221 VAL CG2 HG23 sing N N 222 VAL OXT HXT sing N N 223 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number FOR2290 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #