data_8OVK # _entry.id 8OVK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OVK pdb_00008ovk 10.2210/pdb8ovk/pdb WWPDB D_1292130110 ? ? EMDB EMD-17218 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8OVK _pdbx_database_status.recvd_initial_deposition_date 2023-04-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type EMDB 'Lipidic amyloid-beta(1-40) fibril - polymorph L1' EMD-17218 'associated EM volume' EMDB . EMD-17223 'other EM volume' PDB . 8ovm unspecified EMDB . EMD-17234 'other EM volume' PDB . 8owd unspecified EMDB . EMD-17235 'other EM volume' PDB . 8owe unspecified EMDB . EMD-17238 'other EM volume' PDB . 8owj unspecified EMDB . EMD-17239 'other EM volume' PDB . 8owk unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 gu.schroeder@fz-juelich.de Gunnar Schroeder F. 'principal investigator/group leader' 0000-0003-1803-5431 4 cigr@mpinat.mpg.de Christian Griesinger ? 'principal investigator/group leader' 0000-0002-1266-4344 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Frieg, B.' 1 ? 'Han, M.' 2 ? 'Giller, K.' 3 ? 'Dienemann, C.' 4 ? 'Riedel, D.' 5 ? 'Becker, S.' 6 ? 'Andreas, L.B.' 7 ? 'Griesinger, C.' 8 ? 'Schroeder, G.F.' 9 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 1297 _citation.page_last 1297 _citation.title 'Cryo-EM structures of lipidic fibrils of amyloid-beta (1-40).' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-023-43822-x _citation.pdbx_database_id_PubMed 38351005 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Frieg, B.' 1 0000-0002-7877-0262 primary 'Han, M.' 2 0009-0004-8007-5711 primary 'Giller, K.' 3 ? primary 'Dienemann, C.' 4 0000-0002-2172-5110 primary 'Riedel, D.' 5 ? primary 'Becker, S.' 6 0000-0003-2041-5740 primary 'Andreas, L.B.' 7 0000-0003-3216-9065 primary 'Griesinger, C.' 8 ? primary 'Schroder, G.F.' 9 0000-0003-1803-5431 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Amyloid-beta A4 protein' _entity.formula_weight 4335.852 _entity.pdbx_number_of_molecules 10 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_seq_one_letter_code_can DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H,I,J _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 GLU n 1 4 PHE n 1 5 ARG n 1 6 HIS n 1 7 ASP n 1 8 SER n 1 9 GLY n 1 10 TYR n 1 11 GLU n 1 12 VAL n 1 13 HIS n 1 14 HIS n 1 15 GLN n 1 16 LYS n 1 17 LEU n 1 18 VAL n 1 19 PHE n 1 20 PHE n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 VAL n 1 25 GLY n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 ILE n 1 33 GLY n 1 34 LEU n 1 35 MET n 1 36 VAL n 1 37 GLY n 1 38 GLY n 1 39 VAL n 1 40 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 40 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n B 1 1 ASP 1 1 1 ASP ASP B . n B 1 2 ALA 2 2 2 ALA ALA B . n B 1 3 GLU 3 3 3 GLU GLU B . n B 1 4 PHE 4 4 4 PHE PHE B . n B 1 5 ARG 5 5 5 ARG ARG B . n B 1 6 HIS 6 6 6 HIS HIS B . n B 1 7 ASP 7 7 7 ASP ASP B . n B 1 8 SER 8 8 8 SER SER B . n B 1 9 GLY 9 9 9 GLY GLY B . n B 1 10 TYR 10 10 10 TYR TYR B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 VAL 12 12 12 VAL VAL B . n B 1 13 HIS 13 13 13 HIS HIS B . n B 1 14 HIS 14 14 14 HIS HIS B . n B 1 15 GLN 15 15 15 GLN GLN B . n B 1 16 LYS 16 16 16 LYS LYS B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 PHE 19 19 19 PHE PHE B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 GLU 22 22 22 GLU GLU B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 VAL 24 24 24 VAL VAL B . n B 1 25 GLY 25 25 25 GLY GLY B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 ASN 27 27 27 ASN ASN B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLY 29 29 29 GLY GLY B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 ILE 31 31 31 ILE ILE B . n B 1 32 ILE 32 32 32 ILE ILE B . n B 1 33 GLY 33 33 33 GLY GLY B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 MET 35 35 35 MET MET B . n B 1 36 VAL 36 36 36 VAL VAL B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 VAL 40 40 40 VAL VAL B . n C 1 1 ASP 1 1 1 ASP ASP C . n C 1 2 ALA 2 2 2 ALA ALA C . n C 1 3 GLU 3 3 3 GLU GLU C . n C 1 4 PHE 4 4 4 PHE PHE C . n C 1 5 ARG 5 5 5 ARG ARG C . n C 1 6 HIS 6 6 6 HIS HIS C . n C 1 7 ASP 7 7 7 ASP ASP C . n C 1 8 SER 8 8 8 SER SER C . n C 1 9 GLY 9 9 9 GLY GLY C . n C 1 10 TYR 10 10 10 TYR TYR C . n C 1 11 GLU 11 11 11 GLU GLU C . n C 1 12 VAL 12 12 12 VAL VAL C . n C 1 13 HIS 13 13 13 HIS HIS C . n C 1 14 HIS 14 14 14 HIS HIS C . n C 1 15 GLN 15 15 15 GLN GLN C . n C 1 16 LYS 16 16 16 LYS LYS C . n C 1 17 LEU 17 17 17 LEU LEU C . n C 1 18 VAL 18 18 18 VAL VAL C . n C 1 19 PHE 19 19 19 PHE PHE C . n C 1 20 PHE 20 20 20 PHE PHE C . n C 1 21 ALA 21 21 21 ALA ALA C . n C 1 22 GLU 22 22 22 GLU GLU C . n C 1 23 ASP 23 23 23 ASP ASP C . n C 1 24 VAL 24 24 24 VAL VAL C . n C 1 25 GLY 25 25 25 GLY GLY C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 ASN 27 27 27 ASN ASN C . n C 1 28 LYS 28 28 28 LYS LYS C . n C 1 29 GLY 29 29 29 GLY GLY C . n C 1 30 ALA 30 30 30 ALA ALA C . n C 1 31 ILE 31 31 31 ILE ILE C . n C 1 32 ILE 32 32 32 ILE ILE C . n C 1 33 GLY 33 33 33 GLY GLY C . n C 1 34 LEU 34 34 34 LEU LEU C . n C 1 35 MET 35 35 35 MET MET C . n C 1 36 VAL 36 36 36 VAL VAL C . n C 1 37 GLY 37 37 37 GLY GLY C . n C 1 38 GLY 38 38 38 GLY GLY C . n C 1 39 VAL 39 39 39 VAL VAL C . n C 1 40 VAL 40 40 40 VAL VAL C . n D 1 1 ASP 1 1 1 ASP ASP D . n D 1 2 ALA 2 2 2 ALA ALA D . n D 1 3 GLU 3 3 3 GLU GLU D . n D 1 4 PHE 4 4 4 PHE PHE D . n D 1 5 ARG 5 5 5 ARG ARG D . n D 1 6 HIS 6 6 6 HIS HIS D . n D 1 7 ASP 7 7 7 ASP ASP D . n D 1 8 SER 8 8 8 SER SER D . n D 1 9 GLY 9 9 9 GLY GLY D . n D 1 10 TYR 10 10 10 TYR TYR D . n D 1 11 GLU 11 11 11 GLU GLU D . n D 1 12 VAL 12 12 12 VAL VAL D . n D 1 13 HIS 13 13 13 HIS HIS D . n D 1 14 HIS 14 14 14 HIS HIS D . n D 1 15 GLN 15 15 15 GLN GLN D . n D 1 16 LYS 16 16 16 LYS LYS D . n D 1 17 LEU 17 17 17 LEU LEU D . n D 1 18 VAL 18 18 18 VAL VAL D . n D 1 19 PHE 19 19 19 PHE PHE D . n D 1 20 PHE 20 20 20 PHE PHE D . n D 1 21 ALA 21 21 21 ALA ALA D . n D 1 22 GLU 22 22 22 GLU GLU D . n D 1 23 ASP 23 23 23 ASP ASP D . n D 1 24 VAL 24 24 24 VAL VAL D . n D 1 25 GLY 25 25 25 GLY GLY D . n D 1 26 SER 26 26 26 SER SER D . n D 1 27 ASN 27 27 27 ASN ASN D . n D 1 28 LYS 28 28 28 LYS LYS D . n D 1 29 GLY 29 29 29 GLY GLY D . n D 1 30 ALA 30 30 30 ALA ALA D . n D 1 31 ILE 31 31 31 ILE ILE D . n D 1 32 ILE 32 32 32 ILE ILE D . n D 1 33 GLY 33 33 33 GLY GLY D . n D 1 34 LEU 34 34 34 LEU LEU D . n D 1 35 MET 35 35 35 MET MET D . n D 1 36 VAL 36 36 36 VAL VAL D . n D 1 37 GLY 37 37 37 GLY GLY D . n D 1 38 GLY 38 38 38 GLY GLY D . n D 1 39 VAL 39 39 39 VAL VAL D . n D 1 40 VAL 40 40 40 VAL VAL D . n E 1 1 ASP 1 1 1 ASP ASP E . n E 1 2 ALA 2 2 2 ALA ALA E . n E 1 3 GLU 3 3 3 GLU GLU E . n E 1 4 PHE 4 4 4 PHE PHE E . n E 1 5 ARG 5 5 5 ARG ARG E . n E 1 6 HIS 6 6 6 HIS HIS E . n E 1 7 ASP 7 7 7 ASP ASP E . n E 1 8 SER 8 8 8 SER SER E . n E 1 9 GLY 9 9 9 GLY GLY E . n E 1 10 TYR 10 10 10 TYR TYR E . n E 1 11 GLU 11 11 11 GLU GLU E . n E 1 12 VAL 12 12 12 VAL VAL E . n E 1 13 HIS 13 13 13 HIS HIS E . n E 1 14 HIS 14 14 14 HIS HIS E . n E 1 15 GLN 15 15 15 GLN GLN E . n E 1 16 LYS 16 16 16 LYS LYS E . n E 1 17 LEU 17 17 17 LEU LEU E . n E 1 18 VAL 18 18 18 VAL VAL E . n E 1 19 PHE 19 19 19 PHE PHE E . n E 1 20 PHE 20 20 20 PHE PHE E . n E 1 21 ALA 21 21 21 ALA ALA E . n E 1 22 GLU 22 22 22 GLU GLU E . n E 1 23 ASP 23 23 23 ASP ASP E . n E 1 24 VAL 24 24 24 VAL VAL E . n E 1 25 GLY 25 25 25 GLY GLY E . n E 1 26 SER 26 26 26 SER SER E . n E 1 27 ASN 27 27 27 ASN ASN E . n E 1 28 LYS 28 28 28 LYS LYS E . n E 1 29 GLY 29 29 29 GLY GLY E . n E 1 30 ALA 30 30 30 ALA ALA E . n E 1 31 ILE 31 31 31 ILE ILE E . n E 1 32 ILE 32 32 32 ILE ILE E . n E 1 33 GLY 33 33 33 GLY GLY E . n E 1 34 LEU 34 34 34 LEU LEU E . n E 1 35 MET 35 35 35 MET MET E . n E 1 36 VAL 36 36 36 VAL VAL E . n E 1 37 GLY 37 37 37 GLY GLY E . n E 1 38 GLY 38 38 38 GLY GLY E . n E 1 39 VAL 39 39 39 VAL VAL E . n E 1 40 VAL 40 40 40 VAL VAL E . n F 1 1 ASP 1 1 1 ASP ASP F . n F 1 2 ALA 2 2 2 ALA ALA F . n F 1 3 GLU 3 3 3 GLU GLU F . n F 1 4 PHE 4 4 4 PHE PHE F . n F 1 5 ARG 5 5 5 ARG ARG F . n F 1 6 HIS 6 6 6 HIS HIS F . n F 1 7 ASP 7 7 7 ASP ASP F . n F 1 8 SER 8 8 8 SER SER F . n F 1 9 GLY 9 9 9 GLY GLY F . n F 1 10 TYR 10 10 10 TYR TYR F . n F 1 11 GLU 11 11 11 GLU GLU F . n F 1 12 VAL 12 12 12 VAL VAL F . n F 1 13 HIS 13 13 13 HIS HIS F . n F 1 14 HIS 14 14 14 HIS HIS F . n F 1 15 GLN 15 15 15 GLN GLN F . n F 1 16 LYS 16 16 16 LYS LYS F . n F 1 17 LEU 17 17 17 LEU LEU F . n F 1 18 VAL 18 18 18 VAL VAL F . n F 1 19 PHE 19 19 19 PHE PHE F . n F 1 20 PHE 20 20 20 PHE PHE F . n F 1 21 ALA 21 21 21 ALA ALA F . n F 1 22 GLU 22 22 22 GLU GLU F . n F 1 23 ASP 23 23 23 ASP ASP F . n F 1 24 VAL 24 24 24 VAL VAL F . n F 1 25 GLY 25 25 25 GLY GLY F . n F 1 26 SER 26 26 26 SER SER F . n F 1 27 ASN 27 27 27 ASN ASN F . n F 1 28 LYS 28 28 28 LYS LYS F . n F 1 29 GLY 29 29 29 GLY GLY F . n F 1 30 ALA 30 30 30 ALA ALA F . n F 1 31 ILE 31 31 31 ILE ILE F . n F 1 32 ILE 32 32 32 ILE ILE F . n F 1 33 GLY 33 33 33 GLY GLY F . n F 1 34 LEU 34 34 34 LEU LEU F . n F 1 35 MET 35 35 35 MET MET F . n F 1 36 VAL 36 36 36 VAL VAL F . n F 1 37 GLY 37 37 37 GLY GLY F . n F 1 38 GLY 38 38 38 GLY GLY F . n F 1 39 VAL 39 39 39 VAL VAL F . n F 1 40 VAL 40 40 40 VAL VAL F . n G 1 1 ASP 1 1 1 ASP ASP G . n G 1 2 ALA 2 2 2 ALA ALA G . n G 1 3 GLU 3 3 3 GLU GLU G . n G 1 4 PHE 4 4 4 PHE PHE G . n G 1 5 ARG 5 5 5 ARG ARG G . n G 1 6 HIS 6 6 6 HIS HIS G . n G 1 7 ASP 7 7 7 ASP ASP G . n G 1 8 SER 8 8 8 SER SER G . n G 1 9 GLY 9 9 9 GLY GLY G . n G 1 10 TYR 10 10 10 TYR TYR G . n G 1 11 GLU 11 11 11 GLU GLU G . n G 1 12 VAL 12 12 12 VAL VAL G . n G 1 13 HIS 13 13 13 HIS HIS G . n G 1 14 HIS 14 14 14 HIS HIS G . n G 1 15 GLN 15 15 15 GLN GLN G . n G 1 16 LYS 16 16 16 LYS LYS G . n G 1 17 LEU 17 17 17 LEU LEU G . n G 1 18 VAL 18 18 18 VAL VAL G . n G 1 19 PHE 19 19 19 PHE PHE G . n G 1 20 PHE 20 20 20 PHE PHE G . n G 1 21 ALA 21 21 21 ALA ALA G . n G 1 22 GLU 22 22 22 GLU GLU G . n G 1 23 ASP 23 23 23 ASP ASP G . n G 1 24 VAL 24 24 24 VAL VAL G . n G 1 25 GLY 25 25 25 GLY GLY G . n G 1 26 SER 26 26 26 SER SER G . n G 1 27 ASN 27 27 27 ASN ASN G . n G 1 28 LYS 28 28 28 LYS LYS G . n G 1 29 GLY 29 29 29 GLY GLY G . n G 1 30 ALA 30 30 30 ALA ALA G . n G 1 31 ILE 31 31 31 ILE ILE G . n G 1 32 ILE 32 32 32 ILE ILE G . n G 1 33 GLY 33 33 33 GLY GLY G . n G 1 34 LEU 34 34 34 LEU LEU G . n G 1 35 MET 35 35 35 MET MET G . n G 1 36 VAL 36 36 36 VAL VAL G . n G 1 37 GLY 37 37 37 GLY GLY G . n G 1 38 GLY 38 38 38 GLY GLY G . n G 1 39 VAL 39 39 39 VAL VAL G . n G 1 40 VAL 40 40 40 VAL VAL G . n H 1 1 ASP 1 1 1 ASP ASP H . n H 1 2 ALA 2 2 2 ALA ALA H . n H 1 3 GLU 3 3 3 GLU GLU H . n H 1 4 PHE 4 4 4 PHE PHE H . n H 1 5 ARG 5 5 5 ARG ARG H . n H 1 6 HIS 6 6 6 HIS HIS H . n H 1 7 ASP 7 7 7 ASP ASP H . n H 1 8 SER 8 8 8 SER SER H . n H 1 9 GLY 9 9 9 GLY GLY H . n H 1 10 TYR 10 10 10 TYR TYR H . n H 1 11 GLU 11 11 11 GLU GLU H . n H 1 12 VAL 12 12 12 VAL VAL H . n H 1 13 HIS 13 13 13 HIS HIS H . n H 1 14 HIS 14 14 14 HIS HIS H . n H 1 15 GLN 15 15 15 GLN GLN H . n H 1 16 LYS 16 16 16 LYS LYS H . n H 1 17 LEU 17 17 17 LEU LEU H . n H 1 18 VAL 18 18 18 VAL VAL H . n H 1 19 PHE 19 19 19 PHE PHE H . n H 1 20 PHE 20 20 20 PHE PHE H . n H 1 21 ALA 21 21 21 ALA ALA H . n H 1 22 GLU 22 22 22 GLU GLU H . n H 1 23 ASP 23 23 23 ASP ASP H . n H 1 24 VAL 24 24 24 VAL VAL H . n H 1 25 GLY 25 25 25 GLY GLY H . n H 1 26 SER 26 26 26 SER SER H . n H 1 27 ASN 27 27 27 ASN ASN H . n H 1 28 LYS 28 28 28 LYS LYS H . n H 1 29 GLY 29 29 29 GLY GLY H . n H 1 30 ALA 30 30 30 ALA ALA H . n H 1 31 ILE 31 31 31 ILE ILE H . n H 1 32 ILE 32 32 32 ILE ILE H . n H 1 33 GLY 33 33 33 GLY GLY H . n H 1 34 LEU 34 34 34 LEU LEU H . n H 1 35 MET 35 35 35 MET MET H . n H 1 36 VAL 36 36 36 VAL VAL H . n H 1 37 GLY 37 37 37 GLY GLY H . n H 1 38 GLY 38 38 38 GLY GLY H . n H 1 39 VAL 39 39 39 VAL VAL H . n H 1 40 VAL 40 40 40 VAL VAL H . n I 1 1 ASP 1 1 1 ASP ASP I . n I 1 2 ALA 2 2 2 ALA ALA I . n I 1 3 GLU 3 3 3 GLU GLU I . n I 1 4 PHE 4 4 4 PHE PHE I . n I 1 5 ARG 5 5 5 ARG ARG I . n I 1 6 HIS 6 6 6 HIS HIS I . n I 1 7 ASP 7 7 7 ASP ASP I . n I 1 8 SER 8 8 8 SER SER I . n I 1 9 GLY 9 9 9 GLY GLY I . n I 1 10 TYR 10 10 10 TYR TYR I . n I 1 11 GLU 11 11 11 GLU GLU I . n I 1 12 VAL 12 12 12 VAL VAL I . n I 1 13 HIS 13 13 13 HIS HIS I . n I 1 14 HIS 14 14 14 HIS HIS I . n I 1 15 GLN 15 15 15 GLN GLN I . n I 1 16 LYS 16 16 16 LYS LYS I . n I 1 17 LEU 17 17 17 LEU LEU I . n I 1 18 VAL 18 18 18 VAL VAL I . n I 1 19 PHE 19 19 19 PHE PHE I . n I 1 20 PHE 20 20 20 PHE PHE I . n I 1 21 ALA 21 21 21 ALA ALA I . n I 1 22 GLU 22 22 22 GLU GLU I . n I 1 23 ASP 23 23 23 ASP ASP I . n I 1 24 VAL 24 24 24 VAL VAL I . n I 1 25 GLY 25 25 25 GLY GLY I . n I 1 26 SER 26 26 26 SER SER I . n I 1 27 ASN 27 27 27 ASN ASN I . n I 1 28 LYS 28 28 28 LYS LYS I . n I 1 29 GLY 29 29 29 GLY GLY I . n I 1 30 ALA 30 30 30 ALA ALA I . n I 1 31 ILE 31 31 31 ILE ILE I . n I 1 32 ILE 32 32 32 ILE ILE I . n I 1 33 GLY 33 33 33 GLY GLY I . n I 1 34 LEU 34 34 34 LEU LEU I . n I 1 35 MET 35 35 35 MET MET I . n I 1 36 VAL 36 36 36 VAL VAL I . n I 1 37 GLY 37 37 37 GLY GLY I . n I 1 38 GLY 38 38 38 GLY GLY I . n I 1 39 VAL 39 39 39 VAL VAL I . n I 1 40 VAL 40 40 40 VAL VAL I . n J 1 1 ASP 1 1 1 ASP ASP J . n J 1 2 ALA 2 2 2 ALA ALA J . n J 1 3 GLU 3 3 3 GLU GLU J . n J 1 4 PHE 4 4 4 PHE PHE J . n J 1 5 ARG 5 5 5 ARG ARG J . n J 1 6 HIS 6 6 6 HIS HIS J . n J 1 7 ASP 7 7 7 ASP ASP J . n J 1 8 SER 8 8 8 SER SER J . n J 1 9 GLY 9 9 9 GLY GLY J . n J 1 10 TYR 10 10 10 TYR TYR J . n J 1 11 GLU 11 11 11 GLU GLU J . n J 1 12 VAL 12 12 12 VAL VAL J . n J 1 13 HIS 13 13 13 HIS HIS J . n J 1 14 HIS 14 14 14 HIS HIS J . n J 1 15 GLN 15 15 15 GLN GLN J . n J 1 16 LYS 16 16 16 LYS LYS J . n J 1 17 LEU 17 17 17 LEU LEU J . n J 1 18 VAL 18 18 18 VAL VAL J . n J 1 19 PHE 19 19 19 PHE PHE J . n J 1 20 PHE 20 20 20 PHE PHE J . n J 1 21 ALA 21 21 21 ALA ALA J . n J 1 22 GLU 22 22 22 GLU GLU J . n J 1 23 ASP 23 23 23 ASP ASP J . n J 1 24 VAL 24 24 24 VAL VAL J . n J 1 25 GLY 25 25 25 GLY GLY J . n J 1 26 SER 26 26 26 SER SER J . n J 1 27 ASN 27 27 27 ASN ASN J . n J 1 28 LYS 28 28 28 LYS LYS J . n J 1 29 GLY 29 29 29 GLY GLY J . n J 1 30 ALA 30 30 30 ALA ALA J . n J 1 31 ILE 31 31 31 ILE ILE J . n J 1 32 ILE 32 32 32 ILE ILE J . n J 1 33 GLY 33 33 33 GLY GLY J . n J 1 34 LEU 34 34 34 LEU LEU J . n J 1 35 MET 35 35 35 MET MET J . n J 1 36 VAL 36 36 36 VAL VAL J . n J 1 37 GLY 37 37 37 GLY GLY J . n J 1 38 GLY 38 38 38 GLY GLY J . n J 1 39 VAL 39 39 39 VAL VAL J . n J 1 40 VAL 40 40 40 VAL VAL J . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? 'Pavel Afonine' pafonine@lbl.gov ? ? ? ? Python/C++ https://www.phenix-online.org/ ? phenix.real_space_refine ? ? program 1.19.2_4158 1 ? refinement ? ? 'Paul D. Adams' pdadams@lbl.gov ? ? ? ? Python/C++ https://www.phenix-online.org/ ? PHENIX ? ? program 1.19.2_4158 2 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8OVK _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OVK _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OVK _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 70.45 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8OVK _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high . _refine.ls_d_res_low ? _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work ? _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.0119 ? 3120 ? f_bond_d ? ? 'ELECTRON MICROSCOPY' ? 1.8026 ? 4190 ? f_angle_d ? ? 'ELECTRON MICROSCOPY' ? 0.1089 ? 440 ? f_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.0112 ? 560 ? f_plane_restr ? ? 'ELECTRON MICROSCOPY' ? 14.9920 ? 1070 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'ELECTRON MICROSCOPY' d_2 ? ? 0.000549176059939 ? ? 1 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_3 ? ? 0.000548937927437 ? ? 2 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_4 ? ? 0.000562954865371 ? ? 3 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_5 ? ? 0.000560356967677 ? ? 4 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_6 ? ? 0.000390260693101 ? ? 5 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_7 ? ? 0.000565650356439 ? ? 6 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_8 ? ? 0.000544973584342 ? ? 7 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_9 ? ? 0.00056014746907 ? ? 8 'NCS constraints' ? A ? ? ? ens_1 'ELECTRON MICROSCOPY' d_10 ? ? 0.000584970647023 ? ? 9 'NCS constraints' ? A ? ? ? ens_1 # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] _struct_ncs_oper.details 1 given -0.999979625167 -0.00638351379226 -1.58447446576e-06 0.00638351379046 -0.999979625168 1.13669287577e-06 -1.59169827701e-06 1.12655520124e-06 0.999999999998 263.335301109 261.659431174 2.35406956139 ? 2 given 0.999918462707 0.0127698057151 2.94819113667e-07 -0.012769805715 0.999918462707 -1.72334373857e-07 -2.96995751386e-07 1.68555539376e-07 1.0 -1.6653862979 1.68674381601 4.70801901666 ? 3 given -0.999816522698 -0.0191551804872 5.39434350673e-07 0.019155180487 -0.999816522698 -3.45079670686e-07 5.45945440088e-07 -3.34683394051e-07 1.0 264.990024285 259.961823921 7.06196864379 ? 4 given 0.999673846278 0.0255382275664 5.23560991709e-07 -0.0255382275662 0.999673846278 -3.69162549949e-07 -5.32817987552e-07 3.55671326459e-07 1.0 -3.30914189772 3.39472738606 9.41602639345 ? 5 given -0.999490415397 -0.0319203622959 -6.57430584007e-08 0.0319203622959 -0.999490415397 4.10408542331e-08 -6.70195956865e-08 3.89213982031e-08 1.0 266.622672151 258.243587024 11.7700041629 ? 6 given 0.999266203188 0.0383021561541 -4.71191318447e-07 -0.0383021561539 0.999266203188 4.03227411581e-07 4.86290039044e-07 -3.84883881134e-07 1.0 -4.93079306626 5.12339590915 14.123984648 ? 7 given -0.999001321354 -0.0446806438328 3.35972975111e-07 0.0446806438327 -0.999001321354 -2.64649671855e-07 3.47462163804e-07 -2.49373883041e-07 1.0 268.233227167 256.504639909 16.4779853153 ? 8 given 0.998695612014 0.0510595196101 5.21538025175e-07 -0.0510595196099 0.998695612015 -4.05299906078e-07 -5.41552155743e-07 3.78141756726e-07 1.0 -6.53038743516 6.87277861203 18.832024414 ? 9 given -0.998349222146 -0.0574354475775 1.07220656569e-06 0.0574354475766 -0.998349222147 -8.30895194549e-07 1.11815942822e-06 -7.67940907168e-07 0.999999999999 269.821616456 254.745049496 21.1859477334 ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;chain "A" ; ens_1 d_2 ;chain "B" ; ens_1 d_3 ;chain "C" ; ens_1 d_4 ;chain "D" ; ens_1 d_5 ;chain "E" ; ens_1 d_6 ;chain "F" ; ens_1 d_7 ;chain "G" ; ens_1 d_8 ;chain "H" ; ens_1 d_9 ;chain "I" ; ens_1 d_10 ;chain "J" ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details ens_1 d_1 1 A ASP 1 . A VAL 40 . A ASP 1 A VAL 40 ? ? ens_1 d_2 1 B ASP 1 . B VAL 40 . B ASP 1 B VAL 40 ? ? ens_1 d_3 1 C ASP 1 . C VAL 40 . C ASP 1 C VAL 40 ? ? ens_1 d_4 1 D ASP 1 . D VAL 40 . D ASP 1 D VAL 40 ? ? ens_1 d_5 1 E ASP 1 . E VAL 40 . E ASP 1 E VAL 40 ? ? ens_1 d_6 1 F ASP 1 . F VAL 40 . F ASP 1 F VAL 40 ? ? ens_1 d_7 1 G ASP 1 . G VAL 40 . G ASP 1 G VAL 40 ? ? ens_1 d_8 1 H ASP 1 . H VAL 40 . H ASP 1 H VAL 40 ? ? ens_1 d_9 1 I ASP 1 . I VAL 40 . I ASP 1 I VAL 40 ? ? ens_1 d_10 1 J ASP 1 . J VAL 40 . J ASP 1 J VAL 40 ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # loop_ _struct_ncs_ens_gen.ens_id _struct_ncs_ens_gen.dom_id_1 _struct_ncs_ens_gen.dom_id_2 _struct_ncs_ens_gen.oper_id ens_1 d_2 d_1 1 ens_1 d_3 d_1 2 ens_1 d_4 d_1 3 ens_1 d_5 d_1 4 ens_1 d_6 d_1 5 ens_1 d_7 d_1 6 ens_1 d_8 d_1 7 ens_1 d_9 d_1 8 ens_1 d_10 d_1 9 # _struct.entry_id 8OVK _struct.title 'Lipidic amyloid-beta(1-40) fibril - polymorph L1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OVK _struct_keywords.text 'amyloid-beta, fibril, lipids, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 1 ? J N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B4DM00_HUMAN _struct_ref.pdbx_db_accession B4DM00 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV _struct_ref.pdbx_align_begin 430 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8OVK A 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 2 1 8OVK B 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 3 1 8OVK C 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 4 1 8OVK D 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 5 1 8OVK E 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 6 1 8OVK F 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 7 1 8OVK G 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 8 1 8OVK H 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 9 1 8OVK I 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 10 1 8OVK J 1 ? 40 ? B4DM00 430 ? 469 ? 1 40 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details decameric _pdbx_struct_assembly.oligomeric_count 10 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 5 ? AA4 ? 5 ? AA5 ? 5 ? AA6 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA5 1 2 ? parallel AA5 2 3 ? parallel AA5 3 4 ? parallel AA5 4 5 ? parallel AA6 1 2 ? parallel AA6 2 3 ? parallel AA6 3 4 ? parallel AA6 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 10 ? HIS A 13 ? TYR A 10 HIS A 13 AA1 2 TYR C 10 ? HIS C 13 ? TYR C 10 HIS C 13 AA1 3 TYR E 10 ? HIS E 13 ? TYR E 10 HIS E 13 AA1 4 TYR G 10 ? HIS G 13 ? TYR G 10 HIS G 13 AA1 5 TYR I 10 ? HIS I 13 ? TYR I 10 HIS I 13 AA2 1 LYS A 16 ? VAL A 24 ? LYS A 16 VAL A 24 AA2 2 LYS C 16 ? VAL C 24 ? LYS C 16 VAL C 24 AA2 3 LYS E 16 ? VAL E 24 ? LYS E 16 VAL E 24 AA2 4 LYS G 16 ? VAL G 24 ? LYS G 16 VAL G 24 AA2 5 LYS I 16 ? VAL I 24 ? LYS I 16 VAL I 24 AA3 1 ILE A 31 ? VAL A 39 ? ILE A 31 VAL A 39 AA3 2 ILE C 31 ? VAL C 39 ? ILE C 31 VAL C 39 AA3 3 ILE E 31 ? VAL E 39 ? ILE E 31 VAL E 39 AA3 4 ILE G 31 ? VAL G 39 ? ILE G 31 VAL G 39 AA3 5 ILE I 31 ? VAL I 39 ? ILE I 31 VAL I 39 AA4 1 TYR B 10 ? HIS B 13 ? TYR B 10 HIS B 13 AA4 2 TYR D 10 ? HIS D 13 ? TYR D 10 HIS D 13 AA4 3 TYR F 10 ? HIS F 13 ? TYR F 10 HIS F 13 AA4 4 TYR H 10 ? HIS H 13 ? TYR H 10 HIS H 13 AA4 5 TYR J 10 ? HIS J 13 ? TYR J 10 HIS J 13 AA5 1 LYS B 16 ? VAL B 24 ? LYS B 16 VAL B 24 AA5 2 LYS D 16 ? VAL D 24 ? LYS D 16 VAL D 24 AA5 3 LYS F 16 ? VAL F 24 ? LYS F 16 VAL F 24 AA5 4 LYS H 16 ? VAL H 24 ? LYS H 16 VAL H 24 AA5 5 LYS J 16 ? VAL J 24 ? LYS J 16 VAL J 24 AA6 1 ILE B 31 ? VAL B 39 ? ILE B 31 VAL B 39 AA6 2 ILE D 31 ? VAL D 39 ? ILE D 31 VAL D 39 AA6 3 ILE F 31 ? VAL F 39 ? ILE F 31 VAL F 39 AA6 4 ILE H 31 ? VAL H 39 ? ILE H 31 VAL H 39 AA6 5 ILE J 31 ? VAL J 39 ? ILE J 31 VAL J 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 13 ? N HIS A 13 O VAL C 12 ? O VAL C 12 AA1 2 3 N HIS C 13 ? N HIS C 13 O VAL E 12 ? O VAL E 12 AA1 3 4 N HIS E 13 ? N HIS E 13 O VAL G 12 ? O VAL G 12 AA1 4 5 N HIS G 13 ? N HIS G 13 O VAL I 12 ? O VAL I 12 AA2 1 2 N VAL A 18 ? N VAL A 18 O PHE C 19 ? O PHE C 19 AA2 2 3 N VAL C 18 ? N VAL C 18 O PHE E 19 ? O PHE E 19 AA2 3 4 N VAL E 18 ? N VAL E 18 O PHE G 19 ? O PHE G 19 AA2 4 5 N VAL G 18 ? N VAL G 18 O PHE I 19 ? O PHE I 19 AA3 1 2 N GLY A 37 ? N GLY A 37 O VAL C 36 ? O VAL C 36 AA3 2 3 N GLY C 37 ? N GLY C 37 O VAL E 36 ? O VAL E 36 AA3 3 4 N GLY E 37 ? N GLY E 37 O VAL G 36 ? O VAL G 36 AA3 4 5 N GLY G 37 ? N GLY G 37 O VAL I 36 ? O VAL I 36 AA4 1 2 N HIS B 13 ? N HIS B 13 O VAL D 12 ? O VAL D 12 AA4 2 3 N HIS D 13 ? N HIS D 13 O VAL F 12 ? O VAL F 12 AA4 3 4 N HIS F 13 ? N HIS F 13 O VAL H 12 ? O VAL H 12 AA4 4 5 N HIS H 13 ? N HIS H 13 O VAL J 12 ? O VAL J 12 AA5 1 2 N VAL B 18 ? N VAL B 18 O PHE D 19 ? O PHE D 19 AA5 2 3 N VAL D 18 ? N VAL D 18 O PHE F 19 ? O PHE F 19 AA5 3 4 N VAL F 18 ? N VAL F 18 O PHE H 19 ? O PHE H 19 AA5 4 5 N VAL H 18 ? N VAL H 18 O PHE J 19 ? O PHE J 19 AA6 1 2 N GLY B 37 ? N GLY B 37 O VAL D 36 ? O VAL D 36 AA6 2 3 N GLY D 37 ? N GLY D 37 O VAL F 36 ? O VAL F 36 AA6 3 4 N GLY F 37 ? N GLY F 37 O VAL H 36 ? O VAL H 36 AA6 4 5 N GLY H 37 ? N GLY H 37 O VAL J 36 ? O VAL J 36 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? -126.49 -64.36 2 1 GLU B 3 ? ? -126.52 -64.37 3 1 GLU C 3 ? ? -126.50 -64.36 4 1 GLU D 3 ? ? -126.53 -64.33 5 1 GLU E 3 ? ? -126.48 -64.40 6 1 GLU F 3 ? ? -126.51 -64.36 7 1 GLU G 3 ? ? -126.54 -64.41 8 1 GLU H 3 ? ? -126.51 -64.38 9 1 GLU I 3 ? ? -126.52 -64.39 10 1 GLU J 3 ? ? -126.49 -64.35 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8OVK _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_reconstruction.entry_id 8OVK _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.88 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 177981 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type HELICAL # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 6.5 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.name 'The L1 amyloid-beta(1-40) fibril in complex with lipids' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8OVK _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 500 _em_imaging.nominal_defocus_max 2500 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen ? # _em_vitrification.entry_id 8OVK _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8OVK _em_experiment.id 1 _em_experiment.reconstruction_method HELICAL _em_experiment.aggregation_state FILAMENT _em_experiment.entity_assembly_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 TYR N N N N 270 TYR CA C N S 271 TYR C C N N 272 TYR O O N N 273 TYR CB C N N 274 TYR CG C Y N 275 TYR CD1 C Y N 276 TYR CD2 C Y N 277 TYR CE1 C Y N 278 TYR CE2 C Y N 279 TYR CZ C Y N 280 TYR OH O N N 281 TYR OXT O N N 282 TYR H H N N 283 TYR H2 H N N 284 TYR HA H N N 285 TYR HB2 H N N 286 TYR HB3 H N N 287 TYR HD1 H N N 288 TYR HD2 H N N 289 TYR HE1 H N N 290 TYR HE2 H N N 291 TYR HH H N N 292 TYR HXT H N N 293 VAL N N N N 294 VAL CA C N S 295 VAL C C N N 296 VAL O O N N 297 VAL CB C N N 298 VAL CG1 C N N 299 VAL CG2 C N N 300 VAL OXT O N N 301 VAL H H N N 302 VAL H2 H N N 303 VAL HA H N N 304 VAL HB H N N 305 VAL HG11 H N N 306 VAL HG12 H N N 307 VAL HG13 H N N 308 VAL HG21 H N N 309 VAL HG22 H N N 310 VAL HG23 H N N 311 VAL HXT H N N 312 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 TYR N CA sing N N 258 TYR N H sing N N 259 TYR N H2 sing N N 260 TYR CA C sing N N 261 TYR CA CB sing N N 262 TYR CA HA sing N N 263 TYR C O doub N N 264 TYR C OXT sing N N 265 TYR CB CG sing N N 266 TYR CB HB2 sing N N 267 TYR CB HB3 sing N N 268 TYR CG CD1 doub Y N 269 TYR CG CD2 sing Y N 270 TYR CD1 CE1 sing Y N 271 TYR CD1 HD1 sing N N 272 TYR CD2 CE2 doub Y N 273 TYR CD2 HD2 sing N N 274 TYR CE1 CZ doub Y N 275 TYR CE1 HE1 sing N N 276 TYR CE2 CZ sing Y N 277 TYR CE2 HE2 sing N N 278 TYR CZ OH sing N N 279 TYR OH HH sing N N 280 TYR OXT HXT sing N N 281 VAL N CA sing N N 282 VAL N H sing N N 283 VAL N H2 sing N N 284 VAL CA C sing N N 285 VAL CA CB sing N N 286 VAL CA HA sing N N 287 VAL C O doub N N 288 VAL C OXT sing N N 289 VAL CB CG1 sing N N 290 VAL CB CG2 sing N N 291 VAL CB HB sing N N 292 VAL CG1 HG11 sing N N 293 VAL CG1 HG12 sing N N 294 VAL CG1 HG13 sing N N 295 VAL CG2 HG21 sing N N 296 VAL CG2 HG22 sing N N 297 VAL CG2 HG23 sing N N 298 VAL OXT HXT sing N N 299 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type NONE # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 469008 _em_entity_assembly_recombinant.organism 'Escherichia coli BL21(DE3)' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.details ? _em_helical_entity.axial_symmetry C1 _em_helical_entity.angular_rotation_per_subunit 179.63 _em_helical_entity.axial_rise_per_subunit 2.35 # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 40 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? ? ? ? ? 'MODEL REFINEMENT' ? 8 ? ? ? ? ? OTHER ? 9 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 11 1 ? ? ? ? CLASSIFICATION ? 12 1 ? ? ? ? RECONSTRUCTION ? 13 1 ? ? ? ? 'VOLUME SELECTION' ? 14 1 1 1 ? ? 'SERIES ALIGNMENT' ? 15 1 1 1 ? ? 'MOLECULAR REPLACEMENT' ? 16 1 1 1 ? ? 'LATTICE DISTORTION CORRECTION' ? 17 1 1 1 ? ? 'SYMMETRY DETERMINATION' ? 18 1 1 1 ? ? 'CRYSTALLOGRAPHY MERGING' ? 19 1 1 1 ? ? # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Max Planck Society' Germany ? 1 'Helmholtz Association' Germany ? 2 'German Research Foundation (DFG)' Germany ? 3 # _space_group.crystal_system triclinic _space_group.name_H-M_alt 'P 1' _space_group.IT_number 1 _space_group.name_Hall 'P 1' _space_group.id 1 # _atom_sites.entry_id 8OVK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_