data_8OXD # _entry.id 8OXD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8OXD pdb_00008oxd 10.2210/pdb8oxd/pdb WWPDB D_1292130232 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-11-13 ? 2 'Structure model' 1 1 2025-03-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8OXD _pdbx_database_status.recvd_initial_deposition_date 2023-05-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email robert.gilbert@magd.ox.ac.uk _pdbx_contact_author.name_first Robert _pdbx_contact_author.name_last Gilbert _pdbx_contact_author.name_mi 'J. C.' _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9336-5604 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ni, T.' 1 0000-0001-7268-0306 'Banerji, N.' 2 0000-0002-1179-3152 'Jackson, D.J.' 3 0000-0002-4133-9364 'Gilbert, R.J.C.' 4 0000-0001-9336-5604 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nature Communications' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of the murine LYVE-1 (lymphatic vessel endothelial receptor-1) hyaluronan binding domain in an unliganded state' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bano, F.' 1 0000-0003-0634-7091 primary 'Banerji, S.' 2 0000-0002-1179-3152 primary 'Ni, T.' 3 0000-0001-7268-0306 primary 'Green, D.E.' 4 0000-0002-6237-0889 primary 'DeAngelis, P.L.' 5 0000-0002-8843-1344 primary 'Paci, E.' 6 0000-0002-4891-2768 primary 'Lepsik, M.' 7 0000-0003-2607-8132 primary 'Jackson, D.J.' 8 0000-0002-4133-9364 primary 'Gilbert, R.J.C.' 9 0000-0001-9336-5604 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lymphatic vessel endothelial hyaluronic acid receptor 1' 16102.712 1 ? ? ? ? 2 branched man ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-beta-D-glucopyranuronic acid-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-beta-D-glucopyranuronic acid-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-beta-D-glucopyranuronic acid ; 1155.965 1 ? ? ? ? 3 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 3 ? ? ? ? 4 water nat water 18.015 91 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;LYVE-1,Cell surface retention sequence-binding protein 1,CRSBP-1,Extracellular link domain-containing protein 1,Hyaluronic acid receptor ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKA SFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIIHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKA SFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIIHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ARG n 1 4 CYS n 1 5 PHE n 1 6 SER n 1 7 LEU n 1 8 VAL n 1 9 LEU n 1 10 LEU n 1 11 LEU n 1 12 THR n 1 13 SER n 1 14 ILE n 1 15 TRP n 1 16 THR n 1 17 THR n 1 18 ARG n 1 19 LEU n 1 20 LEU n 1 21 VAL n 1 22 GLN n 1 23 GLY n 1 24 SER n 1 25 LEU n 1 26 ARG n 1 27 ALA n 1 28 GLU n 1 29 GLU n 1 30 LEU n 1 31 SER n 1 32 ILE n 1 33 GLN n 1 34 VAL n 1 35 SER n 1 36 CYS n 1 37 ARG n 1 38 ILE n 1 39 MET n 1 40 GLY n 1 41 ILE n 1 42 THR n 1 43 LEU n 1 44 VAL n 1 45 SER n 1 46 LYS n 1 47 LYS n 1 48 ALA n 1 49 ASN n 1 50 GLN n 1 51 GLN n 1 52 LEU n 1 53 ASN n 1 54 PHE n 1 55 THR n 1 56 GLU n 1 57 ALA n 1 58 LYS n 1 59 GLU n 1 60 ALA n 1 61 CYS n 1 62 ARG n 1 63 LEU n 1 64 LEU n 1 65 GLY n 1 66 LEU n 1 67 SER n 1 68 LEU n 1 69 ALA n 1 70 GLY n 1 71 LYS n 1 72 ASP n 1 73 GLN n 1 74 VAL n 1 75 GLU n 1 76 THR n 1 77 ALA n 1 78 LEU n 1 79 LYS n 1 80 ALA n 1 81 SER n 1 82 PHE n 1 83 GLU n 1 84 THR n 1 85 CYS n 1 86 SER n 1 87 TYR n 1 88 GLY n 1 89 TRP n 1 90 VAL n 1 91 GLY n 1 92 ASP n 1 93 GLY n 1 94 PHE n 1 95 VAL n 1 96 VAL n 1 97 ILE n 1 98 SER n 1 99 ARG n 1 100 ILE n 1 101 SER n 1 102 PRO n 1 103 ASN n 1 104 PRO n 1 105 LYS n 1 106 CYS n 1 107 GLY n 1 108 LYS n 1 109 ASN n 1 110 GLY n 1 111 VAL n 1 112 GLY n 1 113 VAL n 1 114 LEU n 1 115 ILE n 1 116 TRP n 1 117 LYS n 1 118 VAL n 1 119 PRO n 1 120 VAL n 1 121 SER n 1 122 ARG n 1 123 GLN n 1 124 PHE n 1 125 ALA n 1 126 ALA n 1 127 TYR n 1 128 CYS n 1 129 TYR n 1 130 ASN n 1 131 SER n 1 132 SER n 1 133 ASP n 1 134 THR n 1 135 TRP n 1 136 THR n 1 137 ASN n 1 138 SER n 1 139 CYS n 1 140 ILE n 1 141 PRO n 1 142 GLU n 1 143 ILE n 1 144 ILE n 1 145 HIS n 1 146 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LYVE1, CRSBP1, HAR, XLKD1, UNQ230/PRO263' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'CHO K1' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpAb1-3DGlcpNAcb1-4DGlcpAb1-3DGlcpNAcb1-4DGlcpAb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,6,5/[a2122A-1b_1-5][a2122h-1b_1-5_2*NCC/3=O]/1-2-1-2-1-2/a4-b1_b3-c1_c4-d1_d3-e1_e4-f1' WURCS PDB2Glycan 1.1.0 3 2 '[][D-1-deoxy-GlcpA]{[(4+1)][b-D-GlcpNAc]{[(3+1)][b-D-GlcpA]{[(4+1)][b-D-GlcpNAc]{[(3+1)][b-D-GlcpA]{[(4+1)][b-D-GlcpNAc]{}}}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 BDP O4 HO4 sing ? 2 2 3 BDP C1 O1 2 NAG O3 HO3 sing ? 3 2 4 NAG C1 O1 3 BDP O4 HO4 sing ? 4 2 5 BDP C1 O1 4 NAG O3 HO3 sing ? 5 2 6 NAG C1 O1 5 BDP O4 HO4 sing ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BDP 'D-saccharide, beta linking' . 'beta-D-glucopyranuronic acid' 'beta-D-glucuronic acid; D-glucuronic acid; glucuronic acid' 'C6 H10 O7' 194.139 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BDP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpAb BDP 'COMMON NAME' GMML 1.0 'b-D-glucopyranuronic acid' BDP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpA BDP 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcA NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 CYS 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 LEU 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 ILE 14 14 ? ? ? A . n A 1 15 TRP 15 15 ? ? ? A . n A 1 16 THR 16 16 ? ? ? A . n A 1 17 THR 17 17 ? ? ? A . n A 1 18 ARG 18 18 ? ? ? A . n A 1 19 LEU 19 19 ? ? ? A . n A 1 20 LEU 20 20 ? ? ? A . n A 1 21 VAL 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 GLY 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 TRP 116 116 116 TRP TRP A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 CYS 139 139 139 CYS CYS A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ILE 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n A 1 146 HIS 146 146 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BDP 1 C BDP 1 C BDP 1174 n B 2 NAG 2 C NAG 2 C NAG 1175 n B 2 BDP 3 C BDP 3 C BDP 1176 n B 2 NAG 4 C NAG 4 C NAG 1177 n B 2 BDP 5 C BDP 5 C BDP 1178 n B 2 NAG 6 C NAG 6 C NAG 1179 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BDP ? ? BDP ? ? 'SUBJECT OF INVESTIGATION' ? 2 NAG ? ? NAG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NAG 1 201 201 NAG NAG A . D 3 NAG 1 202 202 NAG NAG A . E 3 NAG 1 203 203 NAG NAG A . F 4 HOH 1 301 19 HOH HOH A . F 4 HOH 2 302 80 HOH HOH A . F 4 HOH 3 303 49 HOH HOH A . F 4 HOH 4 304 16 HOH HOH A . F 4 HOH 5 305 86 HOH HOH A . F 4 HOH 6 306 54 HOH HOH A . F 4 HOH 7 307 90 HOH HOH A . F 4 HOH 8 308 67 HOH HOH A . F 4 HOH 9 309 14 HOH HOH A . F 4 HOH 10 310 1 HOH HOH A . F 4 HOH 11 311 87 HOH HOH A . F 4 HOH 12 312 29 HOH HOH A . F 4 HOH 13 313 68 HOH HOH A . F 4 HOH 14 314 18 HOH HOH A . F 4 HOH 15 315 17 HOH HOH A . F 4 HOH 16 316 77 HOH HOH A . F 4 HOH 17 317 57 HOH HOH A . F 4 HOH 18 318 32 HOH HOH A . F 4 HOH 19 319 79 HOH HOH A . F 4 HOH 20 320 72 HOH HOH A . F 4 HOH 21 321 53 HOH HOH A . F 4 HOH 22 322 75 HOH HOH A . F 4 HOH 23 323 9 HOH HOH A . F 4 HOH 24 324 2 HOH HOH A . F 4 HOH 25 325 24 HOH HOH A . F 4 HOH 26 326 4 HOH HOH A . F 4 HOH 27 327 93 HOH HOH A . F 4 HOH 28 328 83 HOH HOH A . F 4 HOH 29 329 31 HOH HOH A . F 4 HOH 30 330 12 HOH HOH A . F 4 HOH 31 331 40 HOH HOH A . F 4 HOH 32 332 37 HOH HOH A . F 4 HOH 33 333 6 HOH HOH A . F 4 HOH 34 334 39 HOH HOH A . F 4 HOH 35 335 48 HOH HOH A . F 4 HOH 36 336 20 HOH HOH A . F 4 HOH 37 337 62 HOH HOH A . F 4 HOH 38 338 7 HOH HOH A . F 4 HOH 39 339 5 HOH HOH A . F 4 HOH 40 340 63 HOH HOH A . F 4 HOH 41 341 41 HOH HOH A . F 4 HOH 42 342 69 HOH HOH A . F 4 HOH 43 343 43 HOH HOH A . F 4 HOH 44 344 55 HOH HOH A . F 4 HOH 45 345 60 HOH HOH A . F 4 HOH 46 346 46 HOH HOH A . F 4 HOH 47 347 11 HOH HOH A . F 4 HOH 48 348 38 HOH HOH A . F 4 HOH 49 349 65 HOH HOH A . F 4 HOH 50 350 97 HOH HOH A . F 4 HOH 51 351 92 HOH HOH A . F 4 HOH 52 352 33 HOH HOH A . F 4 HOH 53 353 3 HOH HOH A . F 4 HOH 54 354 27 HOH HOH A . F 4 HOH 55 355 45 HOH HOH A . F 4 HOH 56 356 15 HOH HOH A . F 4 HOH 57 357 51 HOH HOH A . F 4 HOH 58 358 26 HOH HOH A . F 4 HOH 59 359 22 HOH HOH A . F 4 HOH 60 360 94 HOH HOH A . F 4 HOH 61 361 13 HOH HOH A . F 4 HOH 62 362 71 HOH HOH A . F 4 HOH 63 363 30 HOH HOH A . F 4 HOH 64 364 64 HOH HOH A . F 4 HOH 65 365 95 HOH HOH A . F 4 HOH 66 366 85 HOH HOH A . F 4 HOH 67 367 35 HOH HOH A . F 4 HOH 68 368 34 HOH HOH A . F 4 HOH 69 369 82 HOH HOH A . F 4 HOH 70 370 76 HOH HOH A . F 4 HOH 71 371 66 HOH HOH A . F 4 HOH 72 372 96 HOH HOH A . F 4 HOH 73 373 23 HOH HOH A . F 4 HOH 74 374 73 HOH HOH A . F 4 HOH 75 375 36 HOH HOH A . F 4 HOH 76 376 42 HOH HOH A . F 4 HOH 77 377 89 HOH HOH A . F 4 HOH 78 378 91 HOH HOH A . F 4 HOH 79 379 70 HOH HOH A . F 4 HOH 80 380 56 HOH HOH A . F 4 HOH 81 381 61 HOH HOH A . F 4 HOH 82 382 21 HOH HOH A . F 4 HOH 83 383 59 HOH HOH A . F 4 HOH 84 384 78 HOH HOH A . F 4 HOH 85 385 84 HOH HOH A . F 4 HOH 86 386 8 HOH HOH A . F 4 HOH 87 387 58 HOH HOH A . F 4 HOH 88 388 44 HOH HOH A . F 4 HOH 89 389 88 HOH HOH A . F 4 HOH 90 390 10 HOH HOH A . F 4 HOH 91 391 74 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id C _pdbx_unobs_or_zero_occ_atoms.auth_comp_id BDP _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id BDP _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O1 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21rc1_4899 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8OXD _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.590 _cell.length_a_esd ? _cell.length_b 53.260 _cell.length_b_esd ? _cell.length_c 53.740 _cell.length_c_esd ? _cell.volume 113314.197 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8OXD _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8OXD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 30.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 %w/v Polyethylene Glycol 3350, 0.1 M bis-Tris Propane pH 6.5, 0.2 M Sodium Malonate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9159 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9159 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 16.19 _reflns.entry_id 8OXD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.32 _reflns.d_resolution_low 53.30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 27202 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.084 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.32 _reflns_shell.d_res_low 1.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 13958 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.6 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 25.92 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8OXD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.32 _refine.ls_d_res_low 37.83 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 27199 _refine.ls_number_reflns_R_free 1385 _refine.ls_number_reflns_R_work 25814 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.36 _refine.ls_percent_reflns_R_free 5.09 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1748 _refine.ls_R_factor_R_free 0.2173 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1724 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.3016 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1569 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.32 _refine_hist.d_res_low 37.83 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1121 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 910 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 120 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0122 ? 1051 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2935 ? 1427 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0911 ? 189 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0058 ? 168 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.5603 ? 340 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.32 1.37 . . 138 2536 98.89 . . . . 0.3281 . . . . . . . . . . . 0.3229 'X-RAY DIFFRACTION' 1.37 1.42 . . 149 2459 96.95 . . . . 0.2731 . . . . . . . . . . . 0.3105 'X-RAY DIFFRACTION' 1.42 1.49 . . 148 2521 99.44 . . . . 0.2260 . . . . . . . . . . . 0.2891 'X-RAY DIFFRACTION' 1.49 1.57 . . 104 2581 99.48 . . . . 0.1868 . . . . . . . . . . . 0.2814 'X-RAY DIFFRACTION' 1.57 1.66 . . 128 2572 99.52 . . . . 0.1730 . . . . . . . . . . . 0.2198 'X-RAY DIFFRACTION' 1.66 1.79 . . 137 2577 99.78 . . . . 0.1566 . . . . . . . . . . . 0.2347 'X-RAY DIFFRACTION' 1.79 1.97 . . 158 2560 99.67 . . . . 0.1502 . . . . . . . . . . . 0.2027 'X-RAY DIFFRACTION' 1.97 2.26 . . 137 2594 99.85 . . . . 0.1589 . . . . . . . . . . . 0.1919 'X-RAY DIFFRACTION' 2.26 2.84 . . 123 2666 99.96 . . . . 0.1743 . . . . . . . . . . . 0.1845 'X-RAY DIFFRACTION' 2.84 37.83 . . 163 2748 99.93 . . . . 0.1619 . . . . . . . . . . . 0.2160 # _struct.entry_id 8OXD _struct.title ;Structure of the human LYVE-1 (lymphatic vessel endothelial receptor-1) hyaluronan binding domain bound with decasaccharide hyaluronan. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8OXD _struct_keywords.text 'Hyaluronan binding, cell migration, lymphatic system, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYVE1_HUMAN _struct_ref.pdbx_db_accession Q9Y5Y7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKA SFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEII ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8OXD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y5Y7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8OXD HIS A 145 ? UNP Q9Y5Y7 ? ? 'expression tag' 145 1 1 8OXD HIS A 146 ? UNP Q9Y5Y7 ? ? 'expression tag' 146 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2680 ? 1 MORE 23 ? 1 'SSA (A^2)' 6880 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details 'Sedimentation velocity analytical ultracentrigfugation' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 26 ? GLU A 28 ? ARG A 26 GLU A 28 5 ? 3 HELX_P HELX_P2 AA2 ASN A 53 ? LEU A 64 ? ASN A 53 LEU A 64 1 ? 12 HELX_P HELX_P3 AA3 GLY A 70 ? ALA A 80 ? GLY A 70 ALA A 80 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 139 SG ? ? A CYS 36 A CYS 139 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf2 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 128 SG ? ? A CYS 61 A CYS 128 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf3 disulf ? ? A CYS 85 SG ? ? ? 1_555 A CYS 106 SG ? ? A CYS 85 A CYS 106 1_555 ? ? ? ? ? ? ? 2.033 ? ? covale1 covale one ? A ASN 53 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 53 A NAG 202 1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation covale2 covale one ? A ASN 130 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 130 A NAG 201 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation covale3 covale one ? A ASN 137 ND2 ? ? ? 1_555 E NAG . C1 ? ? A ASN 137 A NAG 203 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation covale4 covale both ? B BDP . O4 ? ? ? 1_555 B NAG . C1 ? ? C BDP 1 C NAG 2 1_555 ? ? ? ? ? ? ? 1.394 ? ? covale5 covale both ? B NAG . O3 ? ? ? 1_555 B BDP . C1 ? ? C NAG 2 C BDP 3 1_555 ? ? ? ? ? ? ? 1.432 ? ? covale6 covale both ? B BDP . O4 ? ? ? 1_555 B NAG . C1 ? ? C BDP 3 C NAG 4 1_555 ? ? ? ? ? ? ? 1.427 ? ? covale7 covale both ? B NAG . O3 ? ? ? 1_555 B BDP . C1 ? ? C NAG 4 C BDP 5 1_555 ? ? ? ? ? ? ? 1.419 ? ? covale8 covale both ? B BDP . O4 ? ? ? 1_555 B NAG . C1 ? ? C BDP 5 C NAG 6 1_555 ? ? ? ? ? ? ? 1.432 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG C . ? ASN A 130 ? NAG A 201 ? 1_555 ASN A 130 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 NAG D . ? ASN A 53 ? NAG A 202 ? 1_555 ASN A 53 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 3 NAG E . ? ASN A 137 ? NAG A 203 ? 1_555 ASN A 137 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 4 CYS A 36 ? CYS A 139 ? CYS A 36 ? 1_555 CYS A 139 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 61 ? CYS A 128 ? CYS A 61 ? 1_555 CYS A 128 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 85 ? CYS A 106 ? CYS A 85 ? 1_555 CYS A 106 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 30 ? ILE A 32 ? LEU A 30 ILE A 32 AA1 2 ILE A 41 ? LYS A 46 ? ILE A 41 LYS A 46 AA1 3 ALA A 125 ? TYR A 129 ? ALA A 125 TYR A 129 AA1 4 SER A 67 ? LEU A 68 ? SER A 67 LEU A 68 AA2 1 LEU A 30 ? ILE A 32 ? LEU A 30 ILE A 32 AA2 2 ILE A 41 ? LYS A 46 ? ILE A 41 LYS A 46 AA2 3 ALA A 125 ? TYR A 129 ? ALA A 125 TYR A 129 AA2 4 GLY A 88 ? VAL A 90 ? GLY A 88 VAL A 90 AA2 5 PHE A 94 ? ARG A 99 ? PHE A 94 ARG A 99 AA2 6 GLY A 112 ? TRP A 116 ? GLY A 112 TRP A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 31 ? N SER A 31 O SER A 45 ? O SER A 45 AA1 2 3 N VAL A 44 ? N VAL A 44 O ALA A 126 ? O ALA A 126 AA1 3 4 O TYR A 129 ? O TYR A 129 N SER A 67 ? N SER A 67 AA2 1 2 N SER A 31 ? N SER A 31 O SER A 45 ? O SER A 45 AA2 2 3 N VAL A 44 ? N VAL A 44 O ALA A 126 ? O ALA A 126 AA2 3 4 O ALA A 125 ? O ALA A 125 N TRP A 89 ? N TRP A 89 AA2 4 5 N GLY A 88 ? N GLY A 88 O VAL A 96 ? O VAL A 96 AA2 5 6 N ARG A 99 ? N ARG A 99 O GLY A 112 ? O GLY A 112 # _pdbx_entry_details.entry_id 8OXD _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 142 ? ? O A HOH 301 ? ? 1.69 2 1 O A HOH 321 ? ? O A HOH 381 ? ? 1.76 3 1 O7 C NAG 6 ? ? O A HOH 381 ? ? 1.94 4 1 OE1 A GLN 123 ? ? O A HOH 302 ? ? 1.95 5 1 O A HOH 331 ? ? O A HOH 377 ? ? 1.99 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 302 ? ? 1_555 O A HOH 357 ? ? 4_445 1.99 2 1 O A HOH 302 ? ? 1_555 O A HOH 315 ? ? 4_445 2.11 3 1 OE1 A GLN 123 ? ? 1_555 O A HOH 315 ? ? 4_445 2.11 4 1 OE1 A GLN 123 ? ? 1_555 O A HOH 357 ? ? 4_445 2.11 5 1 O A VAL 111 ? ? 1_555 O A HOH 302 ? ? 4_545 2.15 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 51 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -97.42 _pdbx_validate_torsion.psi -151.22 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A CYS 4 ? A CYS 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A LEU 10 ? A LEU 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A ILE 14 ? A ILE 14 15 1 Y 1 A TRP 15 ? A TRP 15 16 1 Y 1 A THR 16 ? A THR 16 17 1 Y 1 A THR 17 ? A THR 17 18 1 Y 1 A ARG 18 ? A ARG 18 19 1 Y 1 A LEU 19 ? A LEU 19 20 1 Y 1 A LEU 20 ? A LEU 20 21 1 Y 1 A VAL 21 ? A VAL 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A GLY 23 ? A GLY 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A ILE 144 ? A ILE 144 26 1 Y 1 A HIS 145 ? A HIS 145 27 1 Y 1 A HIS 146 ? A HIS 146 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BDP C1 C N R 74 BDP C2 C N R 75 BDP C3 C N S 76 BDP C4 C N S 77 BDP C5 C N S 78 BDP C6 C N N 79 BDP O2 O N N 80 BDP O3 O N N 81 BDP O4 O N N 82 BDP O5 O N N 83 BDP O6A O N N 84 BDP O1 O N N 85 BDP O6B O N N 86 BDP H1 H N N 87 BDP H2 H N N 88 BDP H3 H N N 89 BDP H4 H N N 90 BDP H5 H N N 91 BDP HO2 H N N 92 BDP HO3 H N N 93 BDP HO4 H N N 94 BDP HO1 H N N 95 BDP HO6B H N N 96 CYS N N N N 97 CYS CA C N R 98 CYS C C N N 99 CYS O O N N 100 CYS CB C N N 101 CYS SG S N N 102 CYS OXT O N N 103 CYS H H N N 104 CYS H2 H N N 105 CYS HA H N N 106 CYS HB2 H N N 107 CYS HB3 H N N 108 CYS HG H N N 109 CYS HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 HIS N N N N 160 HIS CA C N S 161 HIS C C N N 162 HIS O O N N 163 HIS CB C N N 164 HIS CG C Y N 165 HIS ND1 N Y N 166 HIS CD2 C Y N 167 HIS CE1 C Y N 168 HIS NE2 N Y N 169 HIS OXT O N N 170 HIS H H N N 171 HIS H2 H N N 172 HIS HA H N N 173 HIS HB2 H N N 174 HIS HB3 H N N 175 HIS HD1 H N N 176 HIS HD2 H N N 177 HIS HE1 H N N 178 HIS HE2 H N N 179 HIS HXT H N N 180 HOH O O N N 181 HOH H1 H N N 182 HOH H2 H N N 183 ILE N N N N 184 ILE CA C N S 185 ILE C C N N 186 ILE O O N N 187 ILE CB C N S 188 ILE CG1 C N N 189 ILE CG2 C N N 190 ILE CD1 C N N 191 ILE OXT O N N 192 ILE H H N N 193 ILE H2 H N N 194 ILE HA H N N 195 ILE HB H N N 196 ILE HG12 H N N 197 ILE HG13 H N N 198 ILE HG21 H N N 199 ILE HG22 H N N 200 ILE HG23 H N N 201 ILE HD11 H N N 202 ILE HD12 H N N 203 ILE HD13 H N N 204 ILE HXT H N N 205 LEU N N N N 206 LEU CA C N S 207 LEU C C N N 208 LEU O O N N 209 LEU CB C N N 210 LEU CG C N N 211 LEU CD1 C N N 212 LEU CD2 C N N 213 LEU OXT O N N 214 LEU H H N N 215 LEU H2 H N N 216 LEU HA H N N 217 LEU HB2 H N N 218 LEU HB3 H N N 219 LEU HG H N N 220 LEU HD11 H N N 221 LEU HD12 H N N 222 LEU HD13 H N N 223 LEU HD21 H N N 224 LEU HD22 H N N 225 LEU HD23 H N N 226 LEU HXT H N N 227 LYS N N N N 228 LYS CA C N S 229 LYS C C N N 230 LYS O O N N 231 LYS CB C N N 232 LYS CG C N N 233 LYS CD C N N 234 LYS CE C N N 235 LYS NZ N N N 236 LYS OXT O N N 237 LYS H H N N 238 LYS H2 H N N 239 LYS HA H N N 240 LYS HB2 H N N 241 LYS HB3 H N N 242 LYS HG2 H N N 243 LYS HG3 H N N 244 LYS HD2 H N N 245 LYS HD3 H N N 246 LYS HE2 H N N 247 LYS HE3 H N N 248 LYS HZ1 H N N 249 LYS HZ2 H N N 250 LYS HZ3 H N N 251 LYS HXT H N N 252 MET N N N N 253 MET CA C N S 254 MET C C N N 255 MET O O N N 256 MET CB C N N 257 MET CG C N N 258 MET SD S N N 259 MET CE C N N 260 MET OXT O N N 261 MET H H N N 262 MET H2 H N N 263 MET HA H N N 264 MET HB2 H N N 265 MET HB3 H N N 266 MET HG2 H N N 267 MET HG3 H N N 268 MET HE1 H N N 269 MET HE2 H N N 270 MET HE3 H N N 271 MET HXT H N N 272 NAG C1 C N R 273 NAG C2 C N R 274 NAG C3 C N R 275 NAG C4 C N S 276 NAG C5 C N R 277 NAG C6 C N N 278 NAG C7 C N N 279 NAG C8 C N N 280 NAG N2 N N N 281 NAG O1 O N N 282 NAG O3 O N N 283 NAG O4 O N N 284 NAG O5 O N N 285 NAG O6 O N N 286 NAG O7 O N N 287 NAG H1 H N N 288 NAG H2 H N N 289 NAG H3 H N N 290 NAG H4 H N N 291 NAG H5 H N N 292 NAG H61 H N N 293 NAG H62 H N N 294 NAG H81 H N N 295 NAG H82 H N N 296 NAG H83 H N N 297 NAG HN2 H N N 298 NAG HO1 H N N 299 NAG HO3 H N N 300 NAG HO4 H N N 301 NAG HO6 H N N 302 PHE N N N N 303 PHE CA C N S 304 PHE C C N N 305 PHE O O N N 306 PHE CB C N N 307 PHE CG C Y N 308 PHE CD1 C Y N 309 PHE CD2 C Y N 310 PHE CE1 C Y N 311 PHE CE2 C Y N 312 PHE CZ C Y N 313 PHE OXT O N N 314 PHE H H N N 315 PHE H2 H N N 316 PHE HA H N N 317 PHE HB2 H N N 318 PHE HB3 H N N 319 PHE HD1 H N N 320 PHE HD2 H N N 321 PHE HE1 H N N 322 PHE HE2 H N N 323 PHE HZ H N N 324 PHE HXT H N N 325 PRO N N N N 326 PRO CA C N S 327 PRO C C N N 328 PRO O O N N 329 PRO CB C N N 330 PRO CG C N N 331 PRO CD C N N 332 PRO OXT O N N 333 PRO H H N N 334 PRO HA H N N 335 PRO HB2 H N N 336 PRO HB3 H N N 337 PRO HG2 H N N 338 PRO HG3 H N N 339 PRO HD2 H N N 340 PRO HD3 H N N 341 PRO HXT H N N 342 SER N N N N 343 SER CA C N S 344 SER C C N N 345 SER O O N N 346 SER CB C N N 347 SER OG O N N 348 SER OXT O N N 349 SER H H N N 350 SER H2 H N N 351 SER HA H N N 352 SER HB2 H N N 353 SER HB3 H N N 354 SER HG H N N 355 SER HXT H N N 356 THR N N N N 357 THR CA C N S 358 THR C C N N 359 THR O O N N 360 THR CB C N R 361 THR OG1 O N N 362 THR CG2 C N N 363 THR OXT O N N 364 THR H H N N 365 THR H2 H N N 366 THR HA H N N 367 THR HB H N N 368 THR HG1 H N N 369 THR HG21 H N N 370 THR HG22 H N N 371 THR HG23 H N N 372 THR HXT H N N 373 TRP N N N N 374 TRP CA C N S 375 TRP C C N N 376 TRP O O N N 377 TRP CB C N N 378 TRP CG C Y N 379 TRP CD1 C Y N 380 TRP CD2 C Y N 381 TRP NE1 N Y N 382 TRP CE2 C Y N 383 TRP CE3 C Y N 384 TRP CZ2 C Y N 385 TRP CZ3 C Y N 386 TRP CH2 C Y N 387 TRP OXT O N N 388 TRP H H N N 389 TRP H2 H N N 390 TRP HA H N N 391 TRP HB2 H N N 392 TRP HB3 H N N 393 TRP HD1 H N N 394 TRP HE1 H N N 395 TRP HE3 H N N 396 TRP HZ2 H N N 397 TRP HZ3 H N N 398 TRP HH2 H N N 399 TRP HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BDP C1 C2 sing N N 70 BDP C1 O5 sing N N 71 BDP C1 O1 sing N N 72 BDP C1 H1 sing N N 73 BDP C2 C3 sing N N 74 BDP C2 O2 sing N N 75 BDP C2 H2 sing N N 76 BDP C3 C4 sing N N 77 BDP C3 O3 sing N N 78 BDP C3 H3 sing N N 79 BDP C4 C5 sing N N 80 BDP C4 O4 sing N N 81 BDP C4 H4 sing N N 82 BDP C5 C6 sing N N 83 BDP C5 O5 sing N N 84 BDP C5 H5 sing N N 85 BDP C6 O6A doub N N 86 BDP C6 O6B sing N N 87 BDP O2 HO2 sing N N 88 BDP O3 HO3 sing N N 89 BDP O4 HO4 sing N N 90 BDP O1 HO1 sing N N 91 BDP O6B HO6B sing N N 92 CYS N CA sing N N 93 CYS N H sing N N 94 CYS N H2 sing N N 95 CYS CA C sing N N 96 CYS CA CB sing N N 97 CYS CA HA sing N N 98 CYS C O doub N N 99 CYS C OXT sing N N 100 CYS CB SG sing N N 101 CYS CB HB2 sing N N 102 CYS CB HB3 sing N N 103 CYS SG HG sing N N 104 CYS OXT HXT sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 NAG C1 C2 sing N N 260 NAG C1 O1 sing N N 261 NAG C1 O5 sing N N 262 NAG C1 H1 sing N N 263 NAG C2 C3 sing N N 264 NAG C2 N2 sing N N 265 NAG C2 H2 sing N N 266 NAG C3 C4 sing N N 267 NAG C3 O3 sing N N 268 NAG C3 H3 sing N N 269 NAG C4 C5 sing N N 270 NAG C4 O4 sing N N 271 NAG C4 H4 sing N N 272 NAG C5 C6 sing N N 273 NAG C5 O5 sing N N 274 NAG C5 H5 sing N N 275 NAG C6 O6 sing N N 276 NAG C6 H61 sing N N 277 NAG C6 H62 sing N N 278 NAG C7 C8 sing N N 279 NAG C7 N2 sing N N 280 NAG C7 O7 doub N N 281 NAG C8 H81 sing N N 282 NAG C8 H82 sing N N 283 NAG C8 H83 sing N N 284 NAG N2 HN2 sing N N 285 NAG O1 HO1 sing N N 286 NAG O3 HO3 sing N N 287 NAG O4 HO4 sing N N 288 NAG O6 HO6 sing N N 289 PHE N CA sing N N 290 PHE N H sing N N 291 PHE N H2 sing N N 292 PHE CA C sing N N 293 PHE CA CB sing N N 294 PHE CA HA sing N N 295 PHE C O doub N N 296 PHE C OXT sing N N 297 PHE CB CG sing N N 298 PHE CB HB2 sing N N 299 PHE CB HB3 sing N N 300 PHE CG CD1 doub Y N 301 PHE CG CD2 sing Y N 302 PHE CD1 CE1 sing Y N 303 PHE CD1 HD1 sing N N 304 PHE CD2 CE2 doub Y N 305 PHE CD2 HD2 sing N N 306 PHE CE1 CZ doub Y N 307 PHE CE1 HE1 sing N N 308 PHE CE2 CZ sing Y N 309 PHE CE2 HE2 sing N N 310 PHE CZ HZ sing N N 311 PHE OXT HXT sing N N 312 PRO N CA sing N N 313 PRO N CD sing N N 314 PRO N H sing N N 315 PRO CA C sing N N 316 PRO CA CB sing N N 317 PRO CA HA sing N N 318 PRO C O doub N N 319 PRO C OXT sing N N 320 PRO CB CG sing N N 321 PRO CB HB2 sing N N 322 PRO CB HB3 sing N N 323 PRO CG CD sing N N 324 PRO CG HG2 sing N N 325 PRO CG HG3 sing N N 326 PRO CD HD2 sing N N 327 PRO CD HD3 sing N N 328 PRO OXT HXT sing N N 329 SER N CA sing N N 330 SER N H sing N N 331 SER N H2 sing N N 332 SER CA C sing N N 333 SER CA CB sing N N 334 SER CA HA sing N N 335 SER C O doub N N 336 SER C OXT sing N N 337 SER CB OG sing N N 338 SER CB HB2 sing N N 339 SER CB HB3 sing N N 340 SER OG HG sing N N 341 SER OXT HXT sing N N 342 THR N CA sing N N 343 THR N H sing N N 344 THR N H2 sing N N 345 THR CA C sing N N 346 THR CA CB sing N N 347 THR CA HA sing N N 348 THR C O doub N N 349 THR C OXT sing N N 350 THR CB OG1 sing N N 351 THR CB CG2 sing N N 352 THR CB HB sing N N 353 THR OG1 HG1 sing N N 354 THR CG2 HG21 sing N N 355 THR CG2 HG22 sing N N 356 THR CG2 HG23 sing N N 357 THR OXT HXT sing N N 358 TRP N CA sing N N 359 TRP N H sing N N 360 TRP N H2 sing N N 361 TRP CA C sing N N 362 TRP CA CB sing N N 363 TRP CA HA sing N N 364 TRP C O doub N N 365 TRP C OXT sing N N 366 TRP CB CG sing N N 367 TRP CB HB2 sing N N 368 TRP CB HB3 sing N N 369 TRP CG CD1 doub Y N 370 TRP CG CD2 sing Y N 371 TRP CD1 NE1 sing Y N 372 TRP CD1 HD1 sing N N 373 TRP CD2 CE2 doub Y N 374 TRP CD2 CE3 sing Y N 375 TRP NE1 CE2 sing Y N 376 TRP NE1 HE1 sing N N 377 TRP CE2 CZ2 sing Y N 378 TRP CE3 CZ3 doub Y N 379 TRP CE3 HE3 sing N N 380 TRP CZ2 CH2 doub Y N 381 TRP CZ2 HZ2 sing N N 382 TRP CZ3 CH2 sing Y N 383 TRP CZ3 HZ3 sing N N 384 TRP CH2 HH2 sing N N 385 TRP OXT HXT sing N N 386 TYR N CA sing N N 387 TYR N H sing N N 388 TYR N H2 sing N N 389 TYR CA C sing N N 390 TYR CA CB sing N N 391 TYR CA HA sing N N 392 TYR C O doub N N 393 TYR C OXT sing N N 394 TYR CB CG sing N N 395 TYR CB HB2 sing N N 396 TYR CB HB3 sing N N 397 TYR CG CD1 doub Y N 398 TYR CG CD2 sing Y N 399 TYR CD1 CE1 sing Y N 400 TYR CD1 HD1 sing N N 401 TYR CD2 CE2 doub Y N 402 TYR CD2 HD2 sing N N 403 TYR CE1 CZ doub Y N 404 TYR CE1 HE1 sing N N 405 TYR CE2 CZ sing Y N 406 TYR CE2 HE2 sing N N 407 TYR CZ OH sing N N 408 TYR OH HH sing N N 409 TYR OXT HXT sing N N 410 VAL N CA sing N N 411 VAL N H sing N N 412 VAL N H2 sing N N 413 VAL CA C sing N N 414 VAL CA CB sing N N 415 VAL CA HA sing N N 416 VAL C O doub N N 417 VAL C OXT sing N N 418 VAL CB CG1 sing N N 419 VAL CB CG2 sing N N 420 VAL CB HB sing N N 421 VAL CG1 HG11 sing N N 422 VAL CG1 HG12 sing N N 423 VAL CG1 HG13 sing N N 424 VAL CG2 HG21 sing N N 425 VAL CG2 HG22 sing N N 426 VAL CG2 HG23 sing N N 427 VAL OXT HXT sing N N 428 # _em_software.category 'MODEL REFINEMENT' _em_software.details ? _em_software.id 1 _em_software.image_processing_id ? _em_software.fitting_id ? _em_software.imaging_id ? _em_software.name PHENIX _em_software.version 1.21rc1_4899 # _pdbx_audit_support.funding_organization 'Medical Research Council (MRC, United Kingdom)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BDP 1 n 2 NAG 2 n 2 BDP 3 n 2 NAG 4 n 2 BDP 5 n 2 NAG 6 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Previously solved apo structure of the same protein' # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8OXD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.025259 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018776 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018608 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #