data_8P0S # _entry.id 8P0S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.372 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8P0S pdb_00008p0s 10.2210/pdb8p0s/pdb WWPDB D_1292130382 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8P0S _pdbx_database_status.recvd_initial_deposition_date 2023-05-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dubey, B.N.' 1 ? 'Dvorsky, R.' 2 ? 'Gremer, L.' 3 ? 'Vetter, I.R.' 4 ? 'Schmitt, L.' 5 ? 'Groth, G.' 6 ? 'Ahmadian, M.R.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural and functional insights into the p160 Rho-associated coiled-coil-containing protein kinase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dubey, B.N.' 1 ? primary 'Amin, E.' 2 ? primary 'Dvorsky, R.' 3 ? primary 'Gremer, L.' 4 ? primary 'Moll, J.M.' 5 ? primary 'Wolff, M.' 6 ? primary 'Graewert, M.' 7 ? primary 'Tschapek, B.' 8 ? primary 'Vetter, I.R.' 9 ? primary 'Schmitt, L.' 10 ? primary 'Svergun, D.' 11 ? primary 'Raunser, R.' 12 ? primary 'Groth, G.' 13 ? primary 'Nagel-Steger, L.' 14 ? primary 'Ahmadian, M.R.' 15 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8P0S _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.260 _cell.length_a_esd ? _cell.length_b 87.070 _cell.length_b_esd ? _cell.length_c 148.220 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8P0S _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rho-associated protein kinase 1' 16014.300 2 2.7.11.1 ? ? 'GS is due to the cloning site' 2 non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE 154.251 1 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Renal carcinoma antigen NY-REN-35,Rho-associated,coiled-coil-containing protein kinase 1,coiled-coil-containing protein kinase I,ROCK-I,p160 ROCK-1,p160ROCK ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSADKSLQESLQKTIYKLEEQLHNE(MSE)QLKDE(MSE)EQKCRTSNIKLDKI(MSE)KELDEEGNQRRNLESTVSQIE KEK(MSE)LLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKLSQLQKQLEEA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINE YQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKLSQLQKQLEEA ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 ASP n 1 5 LYS n 1 6 SER n 1 7 LEU n 1 8 GLN n 1 9 GLU n 1 10 SER n 1 11 LEU n 1 12 GLN n 1 13 LYS n 1 14 THR n 1 15 ILE n 1 16 TYR n 1 17 LYS n 1 18 LEU n 1 19 GLU n 1 20 GLU n 1 21 GLN n 1 22 LEU n 1 23 HIS n 1 24 ASN n 1 25 GLU n 1 26 MSE n 1 27 GLN n 1 28 LEU n 1 29 LYS n 1 30 ASP n 1 31 GLU n 1 32 MSE n 1 33 GLU n 1 34 GLN n 1 35 LYS n 1 36 CYS n 1 37 ARG n 1 38 THR n 1 39 SER n 1 40 ASN n 1 41 ILE n 1 42 LYS n 1 43 LEU n 1 44 ASP n 1 45 LYS n 1 46 ILE n 1 47 MSE n 1 48 LYS n 1 49 GLU n 1 50 LEU n 1 51 ASP n 1 52 GLU n 1 53 GLU n 1 54 GLY n 1 55 ASN n 1 56 GLN n 1 57 ARG n 1 58 ARG n 1 59 ASN n 1 60 LEU n 1 61 GLU n 1 62 SER n 1 63 THR n 1 64 VAL n 1 65 SER n 1 66 GLN n 1 67 ILE n 1 68 GLU n 1 69 LYS n 1 70 GLU n 1 71 LYS n 1 72 MSE n 1 73 LEU n 1 74 LEU n 1 75 GLN n 1 76 HIS n 1 77 ARG n 1 78 ILE n 1 79 ASN n 1 80 GLU n 1 81 TYR n 1 82 GLN n 1 83 ARG n 1 84 LYS n 1 85 ALA n 1 86 GLU n 1 87 GLN n 1 88 GLU n 1 89 ASN n 1 90 GLU n 1 91 LYS n 1 92 ARG n 1 93 ARG n 1 94 ASN n 1 95 VAL n 1 96 GLU n 1 97 ASN n 1 98 GLU n 1 99 VAL n 1 100 SER n 1 101 THR n 1 102 LEU n 1 103 LYS n 1 104 ASP n 1 105 GLN n 1 106 LEU n 1 107 GLU n 1 108 ASP n 1 109 LEU n 1 110 LYS n 1 111 LYS n 1 112 VAL n 1 113 SER n 1 114 GLN n 1 115 ASN n 1 116 SER n 1 117 GLN n 1 118 LEU n 1 119 ALA n 1 120 ASN n 1 121 GLU n 1 122 LYS n 1 123 LEU n 1 124 SER n 1 125 GLN n 1 126 LEU n 1 127 GLN n 1 128 LYS n 1 129 GLN n 1 130 LEU n 1 131 GLU n 1 132 GLU n 1 133 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 133 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ROCK1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ROCK1_HUMAN _struct_ref.pdbx_db_accession Q13464 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQ RKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKLSQLQKQLEEA ; _struct_ref.pdbx_align_begin 420 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8P0S A 3 ? 133 ? Q13464 420 ? 550 ? 3 133 2 1 8P0S B 3 ? 133 ? Q13464 420 ? 550 ? 3 133 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8P0S GLY A 1 ? UNP Q13464 ? ? 'expression tag' 1 1 1 8P0S SER A 2 ? UNP Q13464 ? ? 'expression tag' 2 2 2 8P0S GLY B 1 ? UNP Q13464 ? ? 'expression tag' 1 3 2 8P0S SER B 2 ? UNP Q13464 ? ? 'expression tag' 2 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DTT non-polymer . 2,3-DIHYDROXY-1,4-DITHIOBUTANE 1,4-DITHIOTHREITOL 'C4 H10 O2 S2' 154.251 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8P0S _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '23% PEG 3350, 150 mM Tri-potassium citrate and 4% MPD (2-methyl-2,4-pentanediol)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER R 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-02-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979240 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979240 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8P0S _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 40.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 116242 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.82 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.57 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.3 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 30449 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.55 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8P0S _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 37.05 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16169 _refine.ls_number_reflns_R_free 809 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.31 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2224 _refine.ls_R_factor_R_free 0.2935 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2186 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.01 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.75 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.27 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2199 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 2232 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 37.05 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 2250 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.139 ? 2996 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 5.718 ? 297 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.055 ? 330 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 401 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.20 2.34 . . 131 2496 99.00 . . . . 0.2281 . . . . . . . . . . . 0.2838 'X-RAY DIFFRACTION' 2.34 2.52 . . 133 2529 99.00 . . . . 0.2335 . . . . . . . . . . . 0.3083 'X-RAY DIFFRACTION' 2.52 2.77 . . 134 2532 99.00 . . . . 0.2492 . . . . . . . . . . . 0.3293 'X-RAY DIFFRACTION' 2.77 3.17 . . 134 2543 100.00 . . . . 0.2586 . . . . . . . . . . . 0.3139 'X-RAY DIFFRACTION' 3.17 4.00 . . 136 2593 100.00 . . . . 0.1991 . . . . . . . . . . . 0.2882 'X-RAY DIFFRACTION' 4.00 37.05 . . 141 2667 99.00 . . . . 0.1993 . . . . . . . . . . . 0.2732 # _struct.entry_id 8P0S _struct.title 'Crystal structure HR1 domain of Rho-associated coiled-coil protein kinases (ROCK-HR1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8P0S _struct_keywords.text 'Coiled coil, HR1, Rho kinase, ROCK, PRK, PKN, Rhotekin, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? ALA A 133 ? GLY A 1 ALA A 133 1 ? 133 HELX_P HELX_P2 AA2 ALA B 3 ? LEU B 130 ? ALA B 3 LEU B 130 1 ? 128 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLU 25 C ? ? ? 1_555 A MSE 26 N ? ? A GLU 25 A MSE 26 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A MSE 26 C ? ? ? 1_555 A GLN 27 N ? ? A MSE 26 A GLN 27 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? A GLU 31 C ? ? ? 1_555 A MSE 32 N ? ? A GLU 31 A MSE 32 1_555 ? ? ? ? ? ? ? 1.316 ? ? covale4 covale both ? A MSE 32 C ? ? ? 1_555 A GLU 33 N ? ? A MSE 32 A GLU 33 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale5 covale both ? A ILE 46 C ? ? ? 1_555 A MSE 47 N ? ? A ILE 46 A MSE 47 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale6 covale both ? A MSE 47 C ? ? ? 1_555 A LYS 48 N ? ? A MSE 47 A LYS 48 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale7 covale both ? A LYS 71 C ? ? ? 1_555 A MSE 72 N ? ? A LYS 71 A MSE 72 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? A MSE 72 C ? ? ? 1_555 A LEU 73 N ? ? A MSE 72 A LEU 73 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale9 covale both ? B GLU 25 C ? ? ? 1_555 B MSE 26 N ? ? B GLU 25 B MSE 26 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale10 covale both ? B MSE 26 C ? ? ? 1_555 B GLN 27 N ? ? B MSE 26 B GLN 27 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale11 covale both ? B GLU 31 C ? ? ? 1_555 B MSE 32 N ? ? B GLU 31 B MSE 32 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale12 covale both ? B MSE 32 C ? ? ? 1_555 B GLU 33 N ? ? B MSE 32 B GLU 33 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale13 covale both ? B ILE 46 C ? ? ? 1_555 B MSE 47 N ? ? B ILE 46 B MSE 47 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale14 covale both ? B MSE 47 C ? ? ? 1_555 B LYS 48 N ? ? B MSE 47 B LYS 48 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale15 covale both ? B LYS 71 C ? ? ? 1_555 B MSE 72 N ? ? B LYS 71 B MSE 72 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale16 covale both ? B MSE 72 C ? ? ? 1_555 B LEU 73 N ? ? B MSE 72 B LEU 73 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 8P0S _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020721 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011485 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006747 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 MSE 26 26 26 MSE MSE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 MSE 32 32 32 MSE MSE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 MSE 47 47 47 MSE MSE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 MSE 72 72 72 MSE MSE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ALA 133 133 133 ALA ALA A . n B 1 1 GLY 1 1 ? ? ? B . n B 1 2 SER 2 2 2 SER SER B . n B 1 3 ALA 3 3 3 ALA ALA B . n B 1 4 ASP 4 4 4 ASP ASP B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 SER 6 6 6 SER SER B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 GLN 8 8 8 GLN GLN B . n B 1 9 GLU 9 9 9 GLU GLU B . n B 1 10 SER 10 10 10 SER SER B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 LYS 13 13 13 LYS LYS B . n B 1 14 THR 14 14 14 THR THR B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 TYR 16 16 16 TYR TYR B . n B 1 17 LYS 17 17 17 LYS LYS B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 GLU 20 20 20 GLU GLU B . n B 1 21 GLN 21 21 21 GLN GLN B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 HIS 23 23 23 HIS HIS B . n B 1 24 ASN 24 24 24 ASN ASN B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 MSE 26 26 26 MSE MSE B . n B 1 27 GLN 27 27 27 GLN GLN B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 ASP 30 30 30 ASP ASP B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 MSE 32 32 32 MSE MSE B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 GLN 34 34 34 GLN GLN B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 CYS 36 36 36 CYS CYS B . n B 1 37 ARG 37 37 37 ARG ARG B . n B 1 38 THR 38 38 38 THR THR B . n B 1 39 SER 39 39 39 SER SER B . n B 1 40 ASN 40 40 40 ASN ASN B . n B 1 41 ILE 41 41 41 ILE ILE B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 LEU 43 43 43 LEU LEU B . n B 1 44 ASP 44 44 44 ASP ASP B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 ILE 46 46 46 ILE ILE B . n B 1 47 MSE 47 47 47 MSE MSE B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 ASP 51 51 51 ASP ASP B . n B 1 52 GLU 52 52 52 GLU GLU B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 GLY 54 54 54 GLY GLY B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 GLN 56 56 56 GLN GLN B . n B 1 57 ARG 57 57 57 ARG ARG B . n B 1 58 ARG 58 58 58 ARG ARG B . n B 1 59 ASN 59 59 59 ASN ASN B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 SER 62 62 62 SER SER B . n B 1 63 THR 63 63 63 THR THR B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 SER 65 65 65 SER SER B . n B 1 66 GLN 66 66 66 GLN GLN B . n B 1 67 ILE 67 67 67 ILE ILE B . n B 1 68 GLU 68 68 68 GLU GLU B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 LYS 71 71 71 LYS LYS B . n B 1 72 MSE 72 72 72 MSE MSE B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 LEU 74 74 74 LEU LEU B . n B 1 75 GLN 75 75 75 GLN GLN B . n B 1 76 HIS 76 76 76 HIS HIS B . n B 1 77 ARG 77 77 77 ARG ARG B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 ASN 79 79 79 ASN ASN B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 TYR 81 81 81 TYR TYR B . n B 1 82 GLN 82 82 82 GLN GLN B . n B 1 83 ARG 83 83 83 ARG ARG B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 ALA 85 85 85 ALA ALA B . n B 1 86 GLU 86 86 86 GLU GLU B . n B 1 87 GLN 87 87 87 GLN GLN B . n B 1 88 GLU 88 88 88 GLU GLU B . n B 1 89 ASN 89 89 89 ASN ASN B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 ARG 92 92 92 ARG ARG B . n B 1 93 ARG 93 93 93 ARG ARG B . n B 1 94 ASN 94 94 94 ASN ASN B . n B 1 95 VAL 95 95 95 VAL VAL B . n B 1 96 GLU 96 96 96 GLU GLU B . n B 1 97 ASN 97 97 97 ASN ASN B . n B 1 98 GLU 98 98 98 GLU GLU B . n B 1 99 VAL 99 99 99 VAL VAL B . n B 1 100 SER 100 100 100 SER SER B . n B 1 101 THR 101 101 101 THR THR B . n B 1 102 LEU 102 102 102 LEU LEU B . n B 1 103 LYS 103 103 103 LYS LYS B . n B 1 104 ASP 104 104 104 ASP ASP B . n B 1 105 GLN 105 105 105 GLN GLN B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 GLU 107 107 107 GLU GLU B . n B 1 108 ASP 108 108 108 ASP ASP B . n B 1 109 LEU 109 109 109 LEU LEU B . n B 1 110 LYS 110 110 110 LYS LYS B . n B 1 111 LYS 111 111 111 LYS LYS B . n B 1 112 VAL 112 112 112 VAL VAL B . n B 1 113 SER 113 113 113 SER SER B . n B 1 114 GLN 114 114 114 GLN GLN B . n B 1 115 ASN 115 115 115 ASN ASN B . n B 1 116 SER 116 116 116 SER SER B . n B 1 117 GLN 117 117 117 GLN GLN B . n B 1 118 LEU 118 118 118 LEU LEU B . n B 1 119 ALA 119 119 119 ALA ALA B . n B 1 120 ASN 120 120 120 ASN ASN B . n B 1 121 GLU 121 121 121 GLU GLU B . n B 1 122 LYS 122 122 122 LYS LYS B . n B 1 123 LEU 123 123 123 LEU LEU B . n B 1 124 SER 124 124 124 SER SER B . n B 1 125 GLN 125 125 125 GLN GLN B . n B 1 126 LEU 126 126 126 LEU LEU B . n B 1 127 GLN 127 127 127 GLN GLN B . n B 1 128 LYS 128 128 128 LYS LYS B . n B 1 129 GLN 129 129 129 GLN GLN B . n B 1 130 LEU 130 130 130 LEU LEU B . n B 1 131 GLU 131 131 131 GLU GLU B . n B 1 132 GLU 132 132 132 GLU GLU B . n B 1 133 ALA 133 133 133 ALA ALA B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email reza.ahmadian@hhu.de _pdbx_contact_author.name_first Mohammad _pdbx_contact_author.name_last Ahmadian _pdbx_contact_author.name_mi Reza _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2034-8894 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 DTT 1 701 701 DTT DTT A . D 3 HOH 1 801 35 HOH HOH A . D 3 HOH 2 802 19 HOH HOH A . D 3 HOH 3 803 34 HOH HOH A . D 3 HOH 4 804 3 HOH HOH A . D 3 HOH 5 805 26 HOH HOH A . D 3 HOH 6 806 1 HOH HOH A . D 3 HOH 7 807 14 HOH HOH A . D 3 HOH 8 808 6 HOH HOH A . D 3 HOH 9 809 36 HOH HOH A . D 3 HOH 10 810 9 HOH HOH A . E 3 HOH 1 201 33 HOH HOH B . E 3 HOH 2 202 12 HOH HOH B . E 3 HOH 3 203 21 HOH HOH B . E 3 HOH 4 204 32 HOH HOH B . E 3 HOH 5 205 25 HOH HOH B . E 3 HOH 6 206 30 HOH HOH B . E 3 HOH 7 207 2 HOH HOH B . E 3 HOH 8 208 17 HOH HOH B . E 3 HOH 9 209 29 HOH HOH B . E 3 HOH 10 210 31 HOH HOH B . E 3 HOH 11 211 4 HOH HOH B . E 3 HOH 12 212 22 HOH HOH B . E 3 HOH 13 213 28 HOH HOH B . E 3 HOH 14 214 27 HOH HOH B . E 3 HOH 15 215 10 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 26 A MSE 26 ? MET 'modified residue' 2 A MSE 32 A MSE 32 ? MET 'modified residue' 3 A MSE 47 A MSE 47 ? MET 'modified residue' 4 A MSE 72 A MSE 72 ? MET 'modified residue' 5 B MSE 26 B MSE 26 ? MET 'modified residue' 6 B MSE 32 B MSE 32 ? MET 'modified residue' 7 B MSE 47 B MSE 47 ? MET 'modified residue' 8 B MSE 72 B MSE 72 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6670 ? 1 MORE -61 ? 1 'SSA (A^2)' 19650 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-06-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.19.2_4158:)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLVE ? ? ? . 4 # _pdbx_entry_details.entry_id 8P0S _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id B _pdbx_unobs_or_zero_occ_atoms.auth_comp_id ALA _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 133 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id ALA _pdbx_unobs_or_zero_occ_atoms.label_seq_id 133 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id B _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id B _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'German Research Foundation (DFG)' Germany ? 1 'German Federal Ministry for Education and Research' Germany 01GS08100 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 DTT ? ? DTT ? ? 'SUBJECT OF INVESTIGATION' ? 2 MSE ? ? MSE ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2,3-DIHYDROXY-1,4-DITHIOBUTANE DTT 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details MALS #