data_8P34 # _entry.id 8P34 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8P34 pdb_00008p34 10.2210/pdb8p34/pdb WWPDB D_1292130555 ? ? EMDB EMD-17383 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-07-05 2 'Structure model' 1 1 2023-07-19 3 'Structure model' 1 2 2024-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' em_3d_fitting_list 5 3 'Structure model' em_admin # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 3 'Structure model' '_em_3d_fitting_list.initial_refinement_model_id' 5 3 'Structure model' '_em_admin.last_update' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8P34 _pdbx_database_status.recvd_initial_deposition_date 2023-05-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Tau filaments extracted from human brain with the DeltaK281 mutation in MAPT' _pdbx_database_related.db_id EMD-17383 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 2 _pdbx_contact_author.email scheres@mrc-lmb.cam.ac.uk _pdbx_contact_author.name_first Sjors _pdbx_contact_author.name_last Scheres _pdbx_contact_author.name_mi H.W. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0462-6540 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schweighauser, M.' 1 0000-0002-1848-1610 'Garringer, H.J.' 2 ? 'Klingstedt, T.' 3 ? 'Masuda-Suzukake, M.' 4 ? 'Murrell, J.R.' 5 ? 'Vidal, R.' 6 ? 'Scheres, S.H.W.' 7 ? 'Goedert, M.' 8 ? 'Ghetti, B.' 9 ? 'Newell, K.L.' 10 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Neuropathol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1432-0533 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 146 _citation.language ? _citation.page_first 211 _citation.page_last 226 _citation.title ;Mutation ∆K281 in MAPT causes Pick's disease. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00401-023-02598-6 _citation.pdbx_database_id_PubMed 37351604 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schweighauser, M.' 1 ? primary 'Garringer, H.J.' 2 ? primary 'Klingstedt, T.' 3 ? primary 'Nilsson, K.P.R.' 4 ? primary 'Masuda-Suzukake, M.' 5 ? primary 'Murrell, J.R.' 6 ? primary 'Risacher, S.L.' 7 ? primary 'Vidal, R.' 8 ? primary 'Scheres, S.H.W.' 9 ? primary 'Goedert, M.' 10 ? primary 'Ghetti, B.' 11 ? primary 'Newell, K.L.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Microtubule-associated protein tau' _entity.formula_weight 10135.665 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Neurofibrillary tangle protein,Paired helical filament-tau,PHF-tau' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVP GGGNKKIETHKLTF ; _entity_poly.pdbx_seq_one_letter_code_can ;KNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVP GGGNKKIETHKLTF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ASN n 1 3 VAL n 1 4 LYS n 1 5 SER n 1 6 LYS n 1 7 ILE n 1 8 GLY n 1 9 SER n 1 10 THR n 1 11 GLU n 1 12 ASN n 1 13 LEU n 1 14 LYS n 1 15 HIS n 1 16 GLN n 1 17 PRO n 1 18 GLY n 1 19 GLY n 1 20 GLY n 1 21 LYS n 1 22 VAL n 1 23 GLN n 1 24 ILE n 1 25 VAL n 1 26 TYR n 1 27 LYS n 1 28 PRO n 1 29 VAL n 1 30 ASP n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 VAL n 1 35 THR n 1 36 SER n 1 37 LYS n 1 38 CYS n 1 39 GLY n 1 40 SER n 1 41 LEU n 1 42 GLY n 1 43 ASN n 1 44 ILE n 1 45 HIS n 1 46 HIS n 1 47 LYS n 1 48 PRO n 1 49 GLY n 1 50 GLY n 1 51 GLY n 1 52 GLN n 1 53 VAL n 1 54 GLU n 1 55 VAL n 1 56 LYS n 1 57 SER n 1 58 GLU n 1 59 LYS n 1 60 LEU n 1 61 ASP n 1 62 PHE n 1 63 LYS n 1 64 ASP n 1 65 ARG n 1 66 VAL n 1 67 GLN n 1 68 SER n 1 69 LYS n 1 70 ILE n 1 71 GLY n 1 72 SER n 1 73 LEU n 1 74 ASP n 1 75 ASN n 1 76 ILE n 1 77 THR n 1 78 HIS n 1 79 VAL n 1 80 PRO n 1 81 GLY n 1 82 GLY n 1 83 GLY n 1 84 ASN n 1 85 LYS n 1 86 LYS n 1 87 ILE n 1 88 GLU n 1 89 THR n 1 90 HIS n 1 91 LYS n 1 92 LEU n 1 93 THR n 1 94 PHE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 94 _entity_src_nat.common_name human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 254 254 LYS LYS A . n A 1 2 ASN 2 255 255 ASN ASN A . n A 1 3 VAL 3 256 256 VAL VAL A . n A 1 4 LYS 4 257 257 LYS LYS A . n A 1 5 SER 5 258 258 SER SER A . n A 1 6 LYS 6 259 259 LYS LYS A . n A 1 7 ILE 7 260 260 ILE ILE A . n A 1 8 GLY 8 261 261 GLY GLY A . n A 1 9 SER 9 262 262 SER SER A . n A 1 10 THR 10 263 263 THR THR A . n A 1 11 GLU 11 264 264 GLU GLU A . n A 1 12 ASN 12 265 265 ASN ASN A . n A 1 13 LEU 13 266 266 LEU LEU A . n A 1 14 LYS 14 267 267 LYS LYS A . n A 1 15 HIS 15 268 268 HIS HIS A . n A 1 16 GLN 16 269 269 GLN GLN A . n A 1 17 PRO 17 270 270 PRO PRO A . n A 1 18 GLY 18 271 271 GLY GLY A . n A 1 19 GLY 19 272 272 GLY GLY A . n A 1 20 GLY 20 273 273 GLY GLY A . n A 1 21 LYS 21 274 274 LYS LYS A . n A 1 22 VAL 22 306 306 VAL VAL A . n A 1 23 GLN 23 307 307 GLN GLN A . n A 1 24 ILE 24 308 308 ILE ILE A . n A 1 25 VAL 25 309 309 VAL VAL A . n A 1 26 TYR 26 310 310 TYR TYR A . n A 1 27 LYS 27 311 311 LYS LYS A . n A 1 28 PRO 28 312 312 PRO PRO A . n A 1 29 VAL 29 313 313 VAL VAL A . n A 1 30 ASP 30 314 314 ASP ASP A . n A 1 31 LEU 31 315 315 LEU LEU A . n A 1 32 SER 32 316 316 SER SER A . n A 1 33 LYS 33 317 317 LYS LYS A . n A 1 34 VAL 34 318 318 VAL VAL A . n A 1 35 THR 35 319 319 THR THR A . n A 1 36 SER 36 320 320 SER SER A . n A 1 37 LYS 37 321 321 LYS LYS A . n A 1 38 CYS 38 322 322 CYS CYS A . n A 1 39 GLY 39 323 323 GLY GLY A . n A 1 40 SER 40 324 324 SER SER A . n A 1 41 LEU 41 325 325 LEU LEU A . n A 1 42 GLY 42 326 326 GLY GLY A . n A 1 43 ASN 43 327 327 ASN ASN A . n A 1 44 ILE 44 328 328 ILE ILE A . n A 1 45 HIS 45 329 329 HIS HIS A . n A 1 46 HIS 46 330 330 HIS HIS A . n A 1 47 LYS 47 331 331 LYS LYS A . n A 1 48 PRO 48 332 332 PRO PRO A . n A 1 49 GLY 49 333 333 GLY GLY A . n A 1 50 GLY 50 334 334 GLY GLY A . n A 1 51 GLY 51 335 335 GLY GLY A . n A 1 52 GLN 52 336 336 GLN GLN A . n A 1 53 VAL 53 337 337 VAL VAL A . n A 1 54 GLU 54 338 338 GLU GLU A . n A 1 55 VAL 55 339 339 VAL VAL A . n A 1 56 LYS 56 340 340 LYS LYS A . n A 1 57 SER 57 341 341 SER SER A . n A 1 58 GLU 58 342 342 GLU GLU A . n A 1 59 LYS 59 343 343 LYS LYS A . n A 1 60 LEU 60 344 344 LEU LEU A . n A 1 61 ASP 61 345 345 ASP ASP A . n A 1 62 PHE 62 346 346 PHE PHE A . n A 1 63 LYS 63 347 347 LYS LYS A . n A 1 64 ASP 64 348 348 ASP ASP A . n A 1 65 ARG 65 349 349 ARG ARG A . n A 1 66 VAL 66 350 350 VAL VAL A . n A 1 67 GLN 67 351 351 GLN GLN A . n A 1 68 SER 68 352 352 SER SER A . n A 1 69 LYS 69 353 353 LYS LYS A . n A 1 70 ILE 70 354 354 ILE ILE A . n A 1 71 GLY 71 355 355 GLY GLY A . n A 1 72 SER 72 356 356 SER SER A . n A 1 73 LEU 73 357 357 LEU LEU A . n A 1 74 ASP 74 358 358 ASP ASP A . n A 1 75 ASN 75 359 359 ASN ASN A . n A 1 76 ILE 76 360 360 ILE ILE A . n A 1 77 THR 77 361 361 THR THR A . n A 1 78 HIS 78 362 362 HIS HIS A . n A 1 79 VAL 79 363 363 VAL VAL A . n A 1 80 PRO 80 364 364 PRO PRO A . n A 1 81 GLY 81 365 365 GLY GLY A . n A 1 82 GLY 82 366 366 GLY GLY A . n A 1 83 GLY 83 367 367 GLY GLY A . n A 1 84 ASN 84 368 368 ASN ASN A . n A 1 85 LYS 85 369 369 LYS LYS A . n A 1 86 LYS 86 370 370 LYS LYS A . n A 1 87 ILE 87 371 371 ILE ILE A . n A 1 88 GLU 88 372 372 GLU GLU A . n A 1 89 THR 89 373 373 THR THR A . n A 1 90 HIS 90 374 374 HIS HIS A . n A 1 91 LYS 91 375 375 LYS LYS A . n A 1 92 LEU 92 376 376 LEU LEU A . n A 1 93 THR 93 377 377 THR THR A . n A 1 94 PHE 94 378 378 PHE PHE A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8P34 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8P34 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8P34 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 53.833 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.847 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8P34 _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.61 _refine.ls_d_res_low 124.62 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 65422 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.00 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.38051 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.38051 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'PARAMETERS FOR MASK CACLULATION' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.106 _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id ? _refine.overall_SU_B 5.769 _refine.overall_SU_ML 0.119 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high . _refine_hist.d_res_low . _refine_hist.number_atoms_solvent ? _refine_hist.number_atoms_total 711 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein ? _refine_hist.pdbx_number_atoms_nucleic_acid ? _refine_hist.pdbx_number_atoms_ligand ? _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.006 0.012 722 ? r_bond_refined_d ? ? 'ELECTRON MICROSCOPY' ? 0.000 0.016 727 ? r_bond_other_d ? ? 'ELECTRON MICROSCOPY' ? 1.284 1.660 964 ? r_angle_refined_deg ? ? 'ELECTRON MICROSCOPY' ? 0.520 1.605 1696 ? r_angle_other_deg ? ? 'ELECTRON MICROSCOPY' ? 6.892 5.000 93 ? r_dihedral_angle_1_deg ? ? 'ELECTRON MICROSCOPY' ? 0.764 5.000 1 ? r_dihedral_angle_2_deg ? ? 'ELECTRON MICROSCOPY' ? 11.475 10.000 147 ? r_dihedral_angle_3_deg ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'ELECTRON MICROSCOPY' ? 0.067 0.200 107 ? r_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.005 0.020 804 ? r_gen_planes_refined ? ? 'ELECTRON MICROSCOPY' ? 0.002 0.020 136 ? r_gen_planes_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbd_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_nbtor_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_metal_ion_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_vdw_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_hbond_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'ELECTRON MICROSCOPY' ? 4.204 4.510 375 ? r_mcbond_it ? ? 'ELECTRON MICROSCOPY' ? 4.182 4.509 375 ? r_mcbond_other ? ? 'ELECTRON MICROSCOPY' ? 6.028 8.166 467 ? r_mcangle_it ? ? 'ELECTRON MICROSCOPY' ? 6.022 8.169 468 ? r_mcangle_other ? ? 'ELECTRON MICROSCOPY' ? 8.729 5.898 347 ? r_scbond_it ? ? 'ELECTRON MICROSCOPY' ? 8.716 5.908 348 ? r_scbond_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_scangle_it ? ? 'ELECTRON MICROSCOPY' ? 14.311 10.056 498 ? r_scangle_other ? ? 'ELECTRON MICROSCOPY' ? 17.785 42.26 654 ? r_long_range_B_refined ? ? 'ELECTRON MICROSCOPY' ? 17.772 42.31 655 ? r_long_range_B_other ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_rigid_bond_restr ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_free ? ? 'ELECTRON MICROSCOPY' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_ls_shell.d_res_high 2.610 _refine_ls_shell.d_res_low 2.678 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 0 _refine_ls_shell.number_reflns_R_work 4804 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 1.221 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.000 # _struct.entry_id 8P34 _struct.title 'Tau filaments extracted from human brain with the DeltaK281 mutation in MAPT' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8P34 _struct_keywords.text 'DeltaK281, Tau, Amyloid filament, Cross-beta-sheet, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TAU_HUMAN _struct_ref.pdbx_db_accession P10636 _struct_ref.pdbx_db_isoform P10636-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVP GGGNKKIETHKLTF ; _struct_ref.pdbx_align_begin 196 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8P34 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10636 _struct_ref_seq.db_align_beg 196 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 289 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 254 _struct_ref_seq.pdbx_auth_seq_align_end 378 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10620 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 342 ? ? -97.54 -80.50 2 1 ASN A 359 ? ? 63.80 63.53 3 1 LYS A 370 ? ? 64.45 65.64 # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8P34 _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space ? _em_3d_fitting.ref_protocol ? # _em_3d_fitting_list.id 1 _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.pdb_entry_id 6GX5 _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.pdb_chain_residue_range ? _em_3d_fitting_list.details ? _em_3d_fitting_list.chain_id ? _em_3d_fitting_list.chain_residue_range ? _em_3d_fitting_list.source_name PDB _em_3d_fitting_list.type 'experimental model' _em_3d_fitting_list.accession_code 6GX5 _em_3d_fitting_list.initial_refinement_model_id 1 # _em_3d_reconstruction.entry_id 8P34 _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.61 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 258445 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type HELICAL # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details '20 mM Tris-HCL, 100 mM NaCl' _em_buffer.pH 7.4 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source NATURAL _em_entity_assembly.type TISSUE _em_entity_assembly.name 'Tau filaments extracted from human brain with DeltaK281 mutation' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_imaging.entry_id 8P34 _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'FEI TITAN KRIOS AUTOGRID HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 300 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 1800 _em_imaging.nominal_defocus_max 2800 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure 'COMA FREE' _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material GOLD _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type 'Quantifoil R1.2/1.3' _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 8P34 _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity 100 _em_vitrification.temp ? _em_vitrification.chamber_temperature 277.15 _em_vitrification.instrument 'FEI VITROBOT MARK IV' _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8P34 _em_experiment.id 1 _em_experiment.reconstruction_method HELICAL _em_experiment.aggregation_state FILAMENT _em_experiment.entity_assembly_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TYR N N N N 285 TYR CA C N S 286 TYR C C N N 287 TYR O O N N 288 TYR CB C N N 289 TYR CG C Y N 290 TYR CD1 C Y N 291 TYR CD2 C Y N 292 TYR CE1 C Y N 293 TYR CE2 C Y N 294 TYR CZ C Y N 295 TYR OH O N N 296 TYR OXT O N N 297 TYR H H N N 298 TYR H2 H N N 299 TYR HA H N N 300 TYR HB2 H N N 301 TYR HB3 H N N 302 TYR HD1 H N N 303 TYR HD2 H N N 304 TYR HE1 H N N 305 TYR HE2 H N N 306 TYR HH H N N 307 TYR HXT H N N 308 VAL N N N N 309 VAL CA C N S 310 VAL C C N N 311 VAL O O N N 312 VAL CB C N N 313 VAL CG1 C N N 314 VAL CG2 C N N 315 VAL OXT O N N 316 VAL H H N N 317 VAL H2 H N N 318 VAL HA H N N 319 VAL HB H N N 320 VAL HG11 H N N 321 VAL HG12 H N N 322 VAL HG13 H N N 323 VAL HG21 H N N 324 VAL HG22 H N N 325 VAL HG23 H N N 326 VAL HXT H N N 327 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 HIS N CA sing N N 117 HIS N H sing N N 118 HIS N H2 sing N N 119 HIS CA C sing N N 120 HIS CA CB sing N N 121 HIS CA HA sing N N 122 HIS C O doub N N 123 HIS C OXT sing N N 124 HIS CB CG sing N N 125 HIS CB HB2 sing N N 126 HIS CB HB3 sing N N 127 HIS CG ND1 sing Y N 128 HIS CG CD2 doub Y N 129 HIS ND1 CE1 doub Y N 130 HIS ND1 HD1 sing N N 131 HIS CD2 NE2 sing Y N 132 HIS CD2 HD2 sing N N 133 HIS CE1 NE2 sing Y N 134 HIS CE1 HE1 sing N N 135 HIS NE2 HE2 sing N N 136 HIS OXT HXT sing N N 137 ILE N CA sing N N 138 ILE N H sing N N 139 ILE N H2 sing N N 140 ILE CA C sing N N 141 ILE CA CB sing N N 142 ILE CA HA sing N N 143 ILE C O doub N N 144 ILE C OXT sing N N 145 ILE CB CG1 sing N N 146 ILE CB CG2 sing N N 147 ILE CB HB sing N N 148 ILE CG1 CD1 sing N N 149 ILE CG1 HG12 sing N N 150 ILE CG1 HG13 sing N N 151 ILE CG2 HG21 sing N N 152 ILE CG2 HG22 sing N N 153 ILE CG2 HG23 sing N N 154 ILE CD1 HD11 sing N N 155 ILE CD1 HD12 sing N N 156 ILE CD1 HD13 sing N N 157 ILE OXT HXT sing N N 158 LEU N CA sing N N 159 LEU N H sing N N 160 LEU N H2 sing N N 161 LEU CA C sing N N 162 LEU CA CB sing N N 163 LEU CA HA sing N N 164 LEU C O doub N N 165 LEU C OXT sing N N 166 LEU CB CG sing N N 167 LEU CB HB2 sing N N 168 LEU CB HB3 sing N N 169 LEU CG CD1 sing N N 170 LEU CG CD2 sing N N 171 LEU CG HG sing N N 172 LEU CD1 HD11 sing N N 173 LEU CD1 HD12 sing N N 174 LEU CD1 HD13 sing N N 175 LEU CD2 HD21 sing N N 176 LEU CD2 HD22 sing N N 177 LEU CD2 HD23 sing N N 178 LEU OXT HXT sing N N 179 LYS N CA sing N N 180 LYS N H sing N N 181 LYS N H2 sing N N 182 LYS CA C sing N N 183 LYS CA CB sing N N 184 LYS CA HA sing N N 185 LYS C O doub N N 186 LYS C OXT sing N N 187 LYS CB CG sing N N 188 LYS CB HB2 sing N N 189 LYS CB HB3 sing N N 190 LYS CG CD sing N N 191 LYS CG HG2 sing N N 192 LYS CG HG3 sing N N 193 LYS CD CE sing N N 194 LYS CD HD2 sing N N 195 LYS CD HD3 sing N N 196 LYS CE NZ sing N N 197 LYS CE HE2 sing N N 198 LYS CE HE3 sing N N 199 LYS NZ HZ1 sing N N 200 LYS NZ HZ2 sing N N 201 LYS NZ HZ3 sing N N 202 LYS OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 SER N CA sing N N 244 SER N H sing N N 245 SER N H2 sing N N 246 SER CA C sing N N 247 SER CA CB sing N N 248 SER CA HA sing N N 249 SER C O doub N N 250 SER C OXT sing N N 251 SER CB OG sing N N 252 SER CB HB2 sing N N 253 SER CB HB3 sing N N 254 SER OG HG sing N N 255 SER OXT HXT sing N N 256 THR N CA sing N N 257 THR N H sing N N 258 THR N H2 sing N N 259 THR CA C sing N N 260 THR CA CB sing N N 261 THR CA HA sing N N 262 THR C O doub N N 263 THR C OXT sing N N 264 THR CB OG1 sing N N 265 THR CB CG2 sing N N 266 THR CB HB sing N N 267 THR OG1 HG1 sing N N 268 THR CG2 HG21 sing N N 269 THR CG2 HG22 sing N N 270 THR CG2 HG23 sing N N 271 THR OXT HXT sing N N 272 TYR N CA sing N N 273 TYR N H sing N N 274 TYR N H2 sing N N 275 TYR CA C sing N N 276 TYR CA CB sing N N 277 TYR CA HA sing N N 278 TYR C O doub N N 279 TYR C OXT sing N N 280 TYR CB CG sing N N 281 TYR CB HB2 sing N N 282 TYR CB HB3 sing N N 283 TYR CG CD1 doub Y N 284 TYR CG CD2 sing Y N 285 TYR CD1 CE1 sing Y N 286 TYR CD1 HD1 sing N N 287 TYR CD2 CE2 doub Y N 288 TYR CD2 HD2 sing N N 289 TYR CE1 CZ doub Y N 290 TYR CE1 HE1 sing N N 291 TYR CE2 CZ sing Y N 292 TYR CE2 HE2 sing N N 293 TYR CZ OH sing N N 294 TYR OH HH sing N N 295 TYR OXT HXT sing N N 296 VAL N CA sing N N 297 VAL N H sing N N 298 VAL N H2 sing N N 299 VAL CA C sing N N 300 VAL CA CB sing N N 301 VAL CA HA sing N N 302 VAL C O doub N N 303 VAL C OXT sing N N 304 VAL CB CG1 sing N N 305 VAL CB CG2 sing N N 306 VAL CB HB sing N N 307 VAL CG1 HG11 sing N N 308 VAL CG1 HG12 sing N N 309 VAL CG1 HG13 sing N N 310 VAL CG2 HG21 sing N N 311 VAL CG2 HG22 sing N N 312 VAL CG2 HG23 sing N N 313 VAL OXT HXT sing N N 314 # _em_admin.current_status REL _em_admin.deposition_date 2023-05-17 _em_admin.deposition_site PDBE _em_admin.entry_id 8P34 _em_admin.last_update 2024-07-24 _em_admin.map_release_date 2023-07-05 _em_admin.title 'Tau filaments extracted from human brain with the DeltaK281 mutation in MAPT' # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type NONE # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ Brain _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue 'Frontal cortex grey matter' # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.details ? _em_helical_entity.axial_symmetry C1 _em_helical_entity.angular_rotation_per_subunit -0.73 _em_helical_entity.axial_rise_per_subunit 4.89 # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time 1 _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 37.7 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images 41385 # _em_imaging_optics.chr_aberration_corrector ? _em_imaging_optics.energyfilter_lower ? _em_imaging_optics.energyfilter_slit_width ? _em_imaging_optics.energyfilter_name ? _em_imaging_optics.energyfilter_upper ? _em_imaging_optics.id 1 _em_imaging_optics.imaging_id 1 _em_imaging_optics.phase_plate OTHER _em_imaging_optics.sph_aberration_corrector ? _em_imaging_optics.details ? # _em_particle_selection.details ? _em_particle_selection.id 1 _em_particle_selection.image_processing_id 1 _em_particle_selection.method ? _em_particle_selection.num_particles_selected 1000880 _em_particle_selection.reference_model ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? RELION 4.0 'IMAGE ACQUISITION' ? 2 ? ? 1 EPU ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? 1 ? ? ? OTHER ? 8 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 9 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? CLASSIFICATION ? 11 1 ? ? ? ? RECONSTRUCTION ? 12 1 ? ? ? ? 'MODEL REFINEMENT' ? 13 ? 1 ? REFMAC 5.8.0403 # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'Medical Research Council (MRC, United Kingdom)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6GX5 # _atom_sites.entry_id 8P34 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #