data_8PRO # _entry.id 8PRO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8PRO pdb_00008pro 10.2210/pdb8pro/pdb WWPDB D_1292130558 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8PRO _pdbx_database_status.recvd_initial_deposition_date 2023-07-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email arnout.voet@kuleuven.be _pdbx_contact_author.name_first Arnout _pdbx_contact_author.name_last Voet _pdbx_contact_author.name_mi R.D. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3329-2703 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Vandebroek, L.' 1 0000-0001-6907-425X 'Voet, A.R.D.' 2 0000-0002-3329-2703 'Lee, X.Y.' 3 0000-0002-8077-6030 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The structure of v13Bagel2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vandebroek, L.' 1 0000-0001-6907-425X primary 'Voet, A.R.D.' 2 0000-0002-3329-2703 primary 'Lee, X.Y.' 3 0000-0002-8077-6030 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cell surface protein' 8637.474 1 ? ? ? ? 2 non-polymer syn 'P8W48O184 polyoxometalate' 12016.000 1 ? ? ? ? 3 water nat water 18.015 44 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFETGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFE _entity_poly.pdbx_seq_one_letter_code_can TGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFETGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'P8W48O184 polyoxometalate' IR0 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLY n 1 3 GLY n 1 4 SER n 1 5 VAL n 1 6 HIS n 1 7 SER n 1 8 SER n 1 9 PRO n 1 10 ALA n 1 11 ILE n 1 12 GLY n 1 13 GLN n 1 14 ASP n 1 15 GLY n 1 16 THR n 1 17 ILE n 1 18 TYR n 1 19 VAL n 1 20 GLY n 1 21 SER n 1 22 ASN n 1 23 ASP n 1 24 HIS n 1 25 TYR n 1 26 LEU n 1 27 TYR n 1 28 ALA n 1 29 ILE n 1 30 ASN n 1 31 PRO n 1 32 ASN n 1 33 GLY n 1 34 LYS n 1 35 LEU n 1 36 LYS n 1 37 TRP n 1 38 LYS n 1 39 PHE n 1 40 GLU n 1 41 THR n 1 42 GLY n 1 43 GLY n 1 44 SER n 1 45 VAL n 1 46 HIS n 1 47 SER n 1 48 SER n 1 49 PRO n 1 50 ALA n 1 51 ILE n 1 52 GLY n 1 53 GLN n 1 54 ASP n 1 55 GLY n 1 56 THR n 1 57 ILE n 1 58 TYR n 1 59 VAL n 1 60 GLY n 1 61 SER n 1 62 ASN n 1 63 ASP n 1 64 HIS n 1 65 TYR n 1 66 LEU n 1 67 TYR n 1 68 ALA n 1 69 ILE n 1 70 ASN n 1 71 PRO n 1 72 ASN n 1 73 GLY n 1 74 LYS n 1 75 LEU n 1 76 LYS n 1 77 TRP n 1 78 LYS n 1 79 PHE n 1 80 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 80 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DICTH_0179 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 35947 / DSM 3960 / H-6-12' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Dictyoglomus thermophilum H-6-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 309799 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IR0 non-polymer . 'P8W48O184 polyoxometalate' ? 'O184 P8 W48' 12016.000 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 GLU 80 80 80 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IR0 1 101 1 IR0 KPW A . C 3 HOH 1 201 26 HOH HOH A . C 3 HOH 2 202 11 HOH HOH A . C 3 HOH 3 203 27 HOH HOH A . C 3 HOH 4 204 1 HOH HOH A . C 3 HOH 5 205 19 HOH HOH A . C 3 HOH 6 206 7 HOH HOH A . C 3 HOH 7 207 38 HOH HOH A . C 3 HOH 8 208 17 HOH HOH A . C 3 HOH 9 209 2 HOH HOH A . C 3 HOH 10 210 23 HOH HOH A . C 3 HOH 11 211 43 HOH HOH A . C 3 HOH 12 212 29 HOH HOH A . C 3 HOH 13 213 35 HOH HOH A . C 3 HOH 14 214 22 HOH HOH A . C 3 HOH 15 215 36 HOH HOH A . C 3 HOH 16 216 13 HOH HOH A . C 3 HOH 17 217 25 HOH HOH A . C 3 HOH 18 218 31 HOH HOH A . C 3 HOH 19 219 14 HOH HOH A . C 3 HOH 20 220 20 HOH HOH A . C 3 HOH 21 221 12 HOH HOH A . C 3 HOH 22 222 6 HOH HOH A . C 3 HOH 23 223 34 HOH HOH A . C 3 HOH 24 224 21 HOH HOH A . C 3 HOH 25 225 4 HOH HOH A . C 3 HOH 26 226 16 HOH HOH A . C 3 HOH 27 227 24 HOH HOH A . C 3 HOH 28 228 33 HOH HOH A . C 3 HOH 29 229 8 HOH HOH A . C 3 HOH 30 230 40 HOH HOH A . C 3 HOH 31 231 28 HOH HOH A . C 3 HOH 32 232 9 HOH HOH A . C 3 HOH 33 233 3 HOH HOH A . C 3 HOH 34 234 32 HOH HOH A . C 3 HOH 35 235 37 HOH HOH A . C 3 HOH 36 236 15 HOH HOH A . C 3 HOH 37 237 18 HOH HOH A . C 3 HOH 38 238 10 HOH HOH A . C 3 HOH 39 239 44 HOH HOH A . C 3 HOH 40 240 30 HOH HOH A . C 3 HOH 41 241 5 HOH HOH A . C 3 HOH 42 242 42 HOH HOH A . C 3 HOH 43 243 39 HOH HOH A . C 3 HOH 44 244 41 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8PRO _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.848 _cell.length_a_esd ? _cell.length_b 54.848 _cell.length_b_esd ? _cell.length_c 118.430 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8PRO _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8PRO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Sodium acetate pH 4.6, 15% (w/v) PEG 20000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.972423 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.972423 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8PRO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 38.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18885 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.96 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.136 _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 3383 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 525 _reflns_shell.percent_possible_obs 99.9 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.4 _reflns_shell.pdbx_chi_squared 0.96 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 3.6 _reflns_shell.pdbx_Rrim_I_all 0.878 _reflns_shell.pdbx_Rpim_I_all 0.345 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.954 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.806 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8PRO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 38.78 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18885 _refine.ls_number_reflns_R_free 943 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.21 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1655 _refine.ls_R_factor_R_free 0.1820 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1647 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.28 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.16 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 38.78 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 896 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 612 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 240 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1311 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.513 ? 2758 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 5.365 ? 605 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.079 ? 122 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 122 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.70 1.79 . . 137 2556 99.00 . . . . 0.2378 . . . . . . . . . . . 0.2757 'X-RAY DIFFRACTION' 1.79 1.90 . . 113 2582 99.00 . . . . 0.2112 . . . . . . . . . . . 0.2910 'X-RAY DIFFRACTION' 1.90 2.05 . . 141 2552 99.00 . . . . 0.1896 . . . . . . . . . . . 0.2117 'X-RAY DIFFRACTION' 2.05 2.25 . . 153 2544 100.00 . . . . 0.1808 . . . . . . . . . . . 0.1987 'X-RAY DIFFRACTION' 2.25 2.58 . . 133 2569 100.00 . . . . 0.1638 . . . . . . . . . . . 0.1642 'X-RAY DIFFRACTION' 2.58 3.25 . . 121 2588 99.00 . . . . 0.1478 . . . . . . . . . . . 0.1884 'X-RAY DIFFRACTION' 3.25 38.78 . . 145 2551 99.00 . . . . 0.1444 . . . . . . . . . . . 0.1472 # _struct.entry_id 8PRO _struct.title 'The structure of nvBagel2 binding the P8W48O184 polyoxometalate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8PRO _struct_keywords.text 'Protein design, symmetric, assembly, self-assembly, beta-propeller, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B5YBJ6_DICT6 _struct_ref.pdbx_db_accession B5YBJ6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TGGSVHSSPAIGQDGTIYVGSDDHYLYAINPNGKLKWKFETGRPVHSSPAIGQDGTIYVGSMDHYLYAINPDGTLKWKFK ; _struct_ref.pdbx_align_begin 154 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8PRO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B5YBJ6 _struct_ref_seq.db_align_beg 154 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 233 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8PRO ASN A 22 ? UNP B5YBJ6 ASP 175 'engineered mutation' 22 1 1 8PRO GLY A 43 ? UNP B5YBJ6 ARG 196 'engineered mutation' 43 2 1 8PRO SER A 44 ? UNP B5YBJ6 PRO 197 'engineered mutation' 44 3 1 8PRO ASN A 62 ? UNP B5YBJ6 MET 215 'engineered mutation' 62 4 1 8PRO ASN A 72 ? UNP B5YBJ6 ASP 225 'engineered mutation' 72 5 1 8PRO LYS A 74 ? UNP B5YBJ6 THR 227 'engineered mutation' 74 6 1 8PRO GLU A 80 ? UNP B5YBJ6 LYS 233 'engineered mutation' 80 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 1 2 A,B,C 1 3 A,B,C 1 4 A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 2 'point symmetry operation' ? ? 0.0 1.0 0.0 0.0 -1.0 0.0 0.0 0.0 0.0 0.0 1.0 0.0 3 'point symmetry operation' ? ? 0.0 -1.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 0.0 1.0 0.0 4 'point symmetry operation' ? ? -1.0 0.0 0.0 0.0 0.0 -1.0 0.0 0.0 0.0 0.0 1.0 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 6 ND1 B ? ? 1_555 B IR0 . W12 B ? A HIS 6 A IR0 101 6_555 ? ? ? ? ? ? ? 3.143 ? ? metalc2 metalc ? ? A HIS 6 ND1 B ? ? 1_555 B IR0 . W16 B ? A HIS 6 A IR0 101 8_555 ? ? ? ? ? ? ? 3.269 ? ? metalc3 metalc ? ? A HIS 6 NE2 A ? ? 1_555 B IR0 . W4 A ? A HIS 6 A IR0 101 8_555 ? ? ? ? ? ? ? 2.917 ? ? metalc4 metalc ? ? A ASN 22 ND2 A ? ? 1_555 B IR0 . W43 A ? A ASN 22 A IR0 101 4_555 ? ? ? ? ? ? ? 3.044 ? ? metalc5 metalc ? ? A ASN 22 ND2 A ? ? 1_555 B IR0 . W38 A ? A ASN 22 A IR0 101 6_555 ? ? ? ? ? ? ? 3.078 ? ? metalc6 metalc ? ? A ASN 22 ND2 A ? ? 1_555 B IR0 . W34 A ? A ASN 22 A IR0 101 7_555 ? ? ? ? ? ? ? 2.791 ? ? metalc7 metalc ? ? A ASN 22 ND2 A ? ? 1_555 B IR0 . W4 A ? A ASN 22 A IR0 101 8_555 ? ? ? ? ? ? ? 3.230 ? ? metalc8 metalc ? ? A HIS 46 ND1 A ? ? 1_555 B IR0 . W16 A ? A HIS 46 A IR0 101 8_555 ? ? ? ? ? ? ? 2.982 ? ? metalc9 metalc ? ? A HIS 46 ND1 B ? ? 1_555 B IR0 . W4 B ? A HIS 46 A IR0 101 6_555 ? ? ? ? ? ? ? 2.894 ? ? metalc10 metalc ? ? A ASN 62 OD1 ? ? ? 1_555 B IR0 . W6 B ? A ASN 62 A IR0 101 7_555 ? ? ? ? ? ? ? 3.233 ? ? metalc11 metalc ? ? B IR0 . W38 B ? ? 1_555 C HOH . O ? ? A IR0 101 A HOH 201 1_555 ? ? ? ? ? ? ? 3.211 ? ? metalc12 metalc ? ? B IR0 . W46 B ? ? 1_555 C HOH . O ? ? A IR0 101 A HOH 201 1_555 ? ? ? ? ? ? ? 3.192 ? ? metalc13 metalc ? ? B IR0 . W35 B ? ? 1_555 C HOH . O ? ? A IR0 101 A HOH 201 4_555 ? ? ? ? ? ? ? 3.247 ? ? metalc14 metalc ? ? B IR0 . W38 B ? ? 1_555 C HOH . O ? ? A IR0 101 A HOH 201 8_555 ? ? ? ? ? ? ? 3.211 ? ? metalc15 metalc ? ? B IR0 . W46 B ? ? 1_555 C HOH . O ? ? A IR0 101 A HOH 201 8_555 ? ? ? ? ? ? ? 3.192 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O13 B B IR0 . ? A IR0 101 ? 6_555 173.5 ? 2 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O53 B B IR0 . ? A IR0 101 ? 6_555 103.6 ? 3 O13 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O53 B B IR0 . ? A IR0 101 ? 6_555 80.4 ? 4 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O61 B B IR0 . ? A IR0 101 ? 6_555 96.7 ? 5 O13 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O61 B B IR0 . ? A IR0 101 ? 6_555 78.7 ? 6 O53 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O61 B B IR0 . ? A IR0 101 ? 6_555 81.4 ? 7 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 94.9 ? 8 O13 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 80.2 ? 9 O53 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 158.5 ? 10 O61 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 85.8 ? 11 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O133 B B IR0 . ? A IR0 101 ? 6_555 97.4 ? 12 O13 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O133 B B IR0 . ? A IR0 101 ? 6_555 87.4 ? 13 O53 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O133 B B IR0 . ? A IR0 101 ? 6_555 93.4 ? 14 O61 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O133 B B IR0 . ? A IR0 101 ? 6_555 165.7 ? 15 O85 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O133 B B IR0 . ? A IR0 101 ? 6_555 94.9 ? 16 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O149 B B IR0 . ? A IR0 101 ? 6_555 3.8 ? 17 O13 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O149 B B IR0 . ? A IR0 101 ? 6_555 171.9 ? 18 O53 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O149 B B IR0 . ? A IR0 101 ? 6_555 101.0 ? 19 O61 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O149 B B IR0 . ? A IR0 101 ? 6_555 93.6 ? 20 O85 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O149 B B IR0 . ? A IR0 101 ? 6_555 96.9 ? 21 O133 B B IR0 . ? A IR0 101 ? 6_555 W12 B B IR0 . ? A IR0 101 ? 6_555 O149 B B IR0 . ? A IR0 101 ? 6_555 100.5 ? 22 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O16 B B IR0 . ? A IR0 101 ? 8_555 160.3 ? 23 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O54 B B IR0 . ? A IR0 101 ? 8_555 87.0 ? 24 O16 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O54 B B IR0 . ? A IR0 101 ? 8_555 78.2 ? 25 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O63 B B IR0 . ? A IR0 101 ? 8_555 112.3 ? 26 O16 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O63 B B IR0 . ? A IR0 101 ? 8_555 78.6 ? 27 O54 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O63 B B IR0 . ? A IR0 101 ? 8_555 81.8 ? 28 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O87 B B IR0 . ? A IR0 101 ? 8_555 115.8 ? 29 O16 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O87 B B IR0 . ? A IR0 101 ? 8_555 79.7 ? 30 O54 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O87 B B IR0 . ? A IR0 101 ? 8_555 157.3 ? 31 O63 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O87 B B IR0 . ? A IR0 101 ? 8_555 88.7 ? 32 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O134 B B IR0 . ? A IR0 101 ? 8_555 80.1 ? 33 O16 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O134 B B IR0 . ? A IR0 101 ? 8_555 87.3 ? 34 O54 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O134 B B IR0 . ? A IR0 101 ? 8_555 91.4 ? 35 O63 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O134 B B IR0 . ? A IR0 101 ? 8_555 165.3 ? 36 O87 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O134 B B IR0 . ? A IR0 101 ? 8_555 92.8 ? 37 ND1 B A HIS 6 ? A HIS 6 ? 1_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O151 B B IR0 . ? A IR0 101 ? 8_555 24.8 ? 38 O16 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O151 B B IR0 . ? A IR0 101 ? 8_555 173.7 ? 39 O54 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O151 B B IR0 . ? A IR0 101 ? 8_555 102.5 ? 40 O63 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O151 B B IR0 . ? A IR0 101 ? 8_555 95.2 ? 41 O87 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O151 B B IR0 . ? A IR0 101 ? 8_555 98.9 ? 42 O134 B B IR0 . ? A IR0 101 ? 8_555 W16 B B IR0 . ? A IR0 101 ? 8_555 O151 B B IR0 . ? A IR0 101 ? 8_555 99.0 ? 43 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O4 A B IR0 . ? A IR0 101 ? 8_555 152.5 ? 44 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O37 A B IR0 . ? A IR0 101 ? 8_555 109.2 ? 45 O4 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O37 A B IR0 . ? A IR0 101 ? 8_555 82.4 ? 46 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O45 A B IR0 . ? A IR0 101 ? 8_555 74.9 ? 47 O4 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O45 A B IR0 . ? A IR0 101 ? 8_555 82.1 ? 48 O37 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O45 A B IR0 . ? A IR0 101 ? 8_555 83.1 ? 49 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O85 A B IR0 . ? A IR0 101 ? 8_555 82.1 ? 50 O4 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O85 A B IR0 . ? A IR0 101 ? 8_555 82.5 ? 51 O37 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O85 A B IR0 . ? A IR0 101 ? 8_555 163.6 ? 52 O45 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O85 A B IR0 . ? A IR0 101 ? 8_555 88.8 ? 53 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O125 A B IR0 . ? A IR0 101 ? 8_555 116.6 ? 54 O4 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O125 A B IR0 . ? A IR0 101 ? 8_555 86.9 ? 55 O37 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O125 A B IR0 . ? A IR0 101 ? 8_555 92.0 ? 56 O45 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O125 A B IR0 . ? A IR0 101 ? 8_555 168.5 ? 57 O85 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O125 A B IR0 . ? A IR0 101 ? 8_555 93.4 ? 58 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O141 A B IR0 . ? A IR0 101 ? 8_555 15.3 ? 59 O4 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O141 A B IR0 . ? A IR0 101 ? 8_555 167.4 ? 60 O37 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O141 A B IR0 . ? A IR0 101 ? 8_555 101.1 ? 61 O45 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O141 A B IR0 . ? A IR0 101 ? 8_555 86.2 ? 62 O85 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O141 A B IR0 . ? A IR0 101 ? 8_555 92.5 ? 63 O125 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 O141 A B IR0 . ? A IR0 101 ? 8_555 105.0 ? 64 NE2 A A HIS 6 ? A HIS 6 ? 1_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 54.6 ? 65 O4 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 127.2 ? 66 O37 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 55.1 ? 67 O45 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 64.8 ? 68 O85 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 132.9 ? 69 O125 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 120.4 ? 70 O141 A B IR0 . ? A IR0 101 ? 8_555 W4 A B IR0 . ? A IR0 101 ? 8_555 ND2 A A ASN 22 ? A ASN 22 ? 1_555 50.0 ? 71 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O30 A B IR0 . ? A IR0 101 ? 4_555 133.6 ? 72 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O58 A B IR0 . ? A IR0 101 ? 4_555 61.0 ? 73 O30 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O58 A B IR0 . ? A IR0 101 ? 4_555 86.5 ? 74 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O74 A B IR0 . ? A IR0 101 ? 4_555 65.9 ? 75 O30 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O74 A B IR0 . ? A IR0 101 ? 4_555 81.1 ? 76 O58 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O74 A B IR0 . ? A IR0 101 ? 4_555 86.7 ? 77 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O98 A B IR0 . ? A IR0 101 ? 4_555 127.0 ? 78 O30 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O98 A B IR0 . ? A IR0 101 ? 4_555 84.8 ? 79 O58 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O98 A B IR0 . ? A IR0 101 ? 4_555 94.8 ? 80 O74 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O98 A B IR0 . ? A IR0 101 ? 4_555 165.7 ? 81 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O118 A B IR0 . ? A IR0 101 ? 4_555 133.3 ? 82 O30 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O118 A B IR0 . ? A IR0 101 ? 4_555 71.7 ? 83 O58 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O118 A B IR0 . ? A IR0 101 ? 4_555 157.9 ? 84 O74 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O118 A B IR0 . ? A IR0 101 ? 4_555 86.3 ? 85 O98 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O118 A B IR0 . ? A IR0 101 ? 4_555 87.0 ? 86 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O178 A B IR0 . ? A IR0 101 ? 4_555 50.3 ? 87 O30 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O178 A B IR0 . ? A IR0 101 ? 4_555 169.5 ? 88 O58 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O178 A B IR0 . ? A IR0 101 ? 4_555 102.6 ? 89 O74 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O178 A B IR0 . ? A IR0 101 ? 4_555 94.0 ? 90 O98 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O178 A B IR0 . ? A IR0 101 ? 4_555 99.5 ? 91 O118 A B IR0 . ? A IR0 101 ? 4_555 W43 A B IR0 . ? A IR0 101 ? 4_555 O178 A B IR0 . ? A IR0 101 ? 4_555 98.8 ? 92 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O27 A B IR0 . ? A IR0 101 ? 6_555 130.7 ? 93 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O48 A B IR0 . ? A IR0 101 ? 6_555 48.5 ? 94 O27 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O48 A B IR0 . ? A IR0 101 ? 6_555 87.3 ? 95 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O72 A B IR0 . ? A IR0 101 ? 6_555 74.3 ? 96 O27 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O72 A B IR0 . ? A IR0 101 ? 6_555 81.9 ? 97 O48 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O72 A B IR0 . ? A IR0 101 ? 6_555 84.6 ? 98 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O104 A B IR0 . ? A IR0 101 ? 6_555 115.2 ? 99 O27 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O104 A B IR0 . ? A IR0 101 ? 6_555 84.2 ? 100 O48 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O104 A B IR0 . ? A IR0 101 ? 6_555 94.2 ? 101 O72 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O104 A B IR0 . ? A IR0 101 ? 6_555 166.0 ? 102 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O115 A B IR0 . ? A IR0 101 ? 6_555 148.5 ? 103 O27 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O115 A B IR0 . ? A IR0 101 ? 6_555 71.6 ? 104 O48 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O115 A B IR0 . ? A IR0 101 ? 6_555 158.8 ? 105 O72 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O115 A B IR0 . ? A IR0 101 ? 6_555 90.2 ? 106 O104 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O115 A B IR0 . ? A IR0 101 ? 6_555 85.8 ? 107 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O176 A B IR0 . ? A IR0 101 ? 6_555 56.0 ? 108 O27 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O176 A B IR0 . ? A IR0 101 ? 6_555 171.1 ? 109 O48 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O176 A B IR0 . ? A IR0 101 ? 6_555 101.0 ? 110 O72 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O176 A B IR0 . ? A IR0 101 ? 6_555 95.7 ? 111 O104 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O176 A B IR0 . ? A IR0 101 ? 6_555 98.2 ? 112 O115 A B IR0 . ? A IR0 101 ? 6_555 W38 A B IR0 . ? A IR0 101 ? 6_555 O176 A B IR0 . ? A IR0 101 ? 6_555 99.9 ? 113 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O25 A B IR0 . ? A IR0 101 ? 7_555 153.0 ? 114 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O46 A B IR0 . ? A IR0 101 ? 7_555 79.0 ? 115 O25 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O46 A B IR0 . ? A IR0 101 ? 7_555 84.7 ? 116 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O70 A B IR0 . ? A IR0 101 ? 7_555 77.3 ? 117 O25 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O70 A B IR0 . ? A IR0 101 ? 7_555 80.2 ? 118 O46 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O70 A B IR0 . ? A IR0 101 ? 7_555 86.0 ? 119 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O102 A B IR0 . ? A IR0 101 ? 7_555 116.7 ? 120 O25 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O102 A B IR0 . ? A IR0 101 ? 7_555 85.4 ? 121 O46 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O102 A B IR0 . ? A IR0 101 ? 7_555 93.4 ? 122 O70 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O102 A B IR0 . ? A IR0 101 ? 7_555 165.6 ? 123 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O113 A B IR0 . ? A IR0 101 ? 7_555 121.8 ? 124 O25 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O113 A B IR0 . ? A IR0 101 ? 7_555 72.4 ? 125 O46 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O113 A B IR0 . ? A IR0 101 ? 7_555 157.0 ? 126 O70 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O113 A B IR0 . ? A IR0 101 ? 7_555 89.4 ? 127 O102 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O113 A B IR0 . ? A IR0 101 ? 7_555 85.5 ? 128 ND2 A A ASN 22 ? A ASN 22 ? 1_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O174 A B IR0 . ? A IR0 101 ? 7_555 21.1 ? 129 O25 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O174 A B IR0 . ? A IR0 101 ? 7_555 171.1 ? 130 O46 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O174 A B IR0 . ? A IR0 101 ? 7_555 95.8 ? 131 O70 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O174 A B IR0 . ? A IR0 101 ? 7_555 91.0 ? 132 O102 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O174 A B IR0 . ? A IR0 101 ? 7_555 103.4 ? 133 O113 A B IR0 . ? A IR0 101 ? 7_555 W34 A B IR0 . ? A IR0 101 ? 7_555 O174 A B IR0 . ? A IR0 101 ? 7_555 106.7 ? 134 ND1 A A HIS 46 ? A HIS 46 ? 1_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O16 A B IR0 . ? A IR0 101 ? 8_555 155.2 ? 135 ND1 A A HIS 46 ? A HIS 46 ? 1_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O54 A B IR0 . ? A IR0 101 ? 8_555 77.6 ? 136 O16 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O54 A B IR0 . ? A IR0 101 ? 8_555 78.9 ? 137 ND1 A A HIS 46 ? A HIS 46 ? 1_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O63 A B IR0 . ? A IR0 101 ? 8_555 104.6 ? 138 O16 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O63 A B IR0 . ? A IR0 101 ? 8_555 79.9 ? 139 O54 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O63 A B IR0 . ? A IR0 101 ? 8_555 82.2 ? 140 ND1 A A HIS 46 ? A HIS 46 ? 1_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O87 A B IR0 . ? A IR0 101 ? 8_555 118.7 ? 141 O16 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O87 A B IR0 . ? A IR0 101 ? 8_555 86.0 ? 142 O54 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O87 A B IR0 . ? A IR0 101 ? 8_555 158.8 ? 143 O63 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O87 A B IR0 . ? A IR0 101 ? 8_555 80.6 ? 144 ND1 A A HIS 46 ? A HIS 46 ? 1_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O134 A B IR0 . ? A IR0 101 ? 8_555 89.6 ? 145 O16 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O134 A B IR0 . ? A IR0 101 ? 8_555 85.6 ? 146 O54 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O134 A B IR0 . ? A IR0 101 ? 8_555 97.4 ? 147 O63 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O134 A B IR0 . ? A IR0 101 ? 8_555 165.3 ? 148 O87 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O134 A B IR0 . ? A IR0 101 ? 8_555 96.2 ? 149 ND1 A A HIS 46 ? A HIS 46 ? 1_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O151 A B IR0 . ? A IR0 101 ? 8_555 14.1 ? 150 O16 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O151 A B IR0 . ? A IR0 101 ? 8_555 167.0 ? 151 O54 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O151 A B IR0 . ? A IR0 101 ? 8_555 88.1 ? 152 O63 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O151 A B IR0 . ? A IR0 101 ? 8_555 97.0 ? 153 O87 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O151 A B IR0 . ? A IR0 101 ? 8_555 106.1 ? 154 O134 A B IR0 . ? A IR0 101 ? 8_555 W16 A B IR0 . ? A IR0 101 ? 8_555 O151 A B IR0 . ? A IR0 101 ? 8_555 97.6 ? 155 ND1 B A HIS 46 ? A HIS 46 ? 1_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O4 B B IR0 . ? A IR0 101 ? 6_555 168.0 ? 156 ND1 B A HIS 46 ? A HIS 46 ? 1_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O37 B B IR0 . ? A IR0 101 ? 6_555 108.2 ? 157 O4 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O37 B B IR0 . ? A IR0 101 ? 6_555 83.7 ? 158 ND1 B A HIS 46 ? A HIS 46 ? 1_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O45 B B IR0 . ? A IR0 101 ? 6_555 101.6 ? 159 O4 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O45 B B IR0 . ? A IR0 101 ? 6_555 81.5 ? 160 O37 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O45 B B IR0 . ? A IR0 101 ? 6_555 83.2 ? 161 ND1 B A HIS 46 ? A HIS 46 ? 1_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 80.0 ? 162 O4 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 88.7 ? 163 O37 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 167.4 ? 164 O45 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O85 B B IR0 . ? A IR0 101 ? 6_555 85.8 ? 165 ND1 B A HIS 46 ? A HIS 46 ? 1_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O125 B B IR0 . ? A IR0 101 ? 6_555 91.5 ? 166 O4 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O125 B B IR0 . ? A IR0 101 ? 6_555 85.6 ? 167 O37 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O125 B B IR0 . ? A IR0 101 ? 6_555 93.3 ? 168 O45 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O125 B B IR0 . ? A IR0 101 ? 6_555 166.9 ? 169 O85 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O125 B B IR0 . ? A IR0 101 ? 6_555 96.1 ? 170 ND1 B A HIS 46 ? A HIS 46 ? 1_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O141 B B IR0 . ? A IR0 101 ? 6_555 15.3 ? 171 O4 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O141 B B IR0 . ? A IR0 101 ? 6_555 173.1 ? 172 O37 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O141 B B IR0 . ? A IR0 101 ? 6_555 95.6 ? 173 O45 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O141 B B IR0 . ? A IR0 101 ? 6_555 91.6 ? 174 O85 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O141 B B IR0 . ? A IR0 101 ? 6_555 90.8 ? 175 O125 B B IR0 . ? A IR0 101 ? 6_555 W4 B B IR0 . ? A IR0 101 ? 6_555 O141 B B IR0 . ? A IR0 101 ? 6_555 101.3 ? 176 OD1 ? A ASN 62 ? A ASN 62 ? 1_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O40 A B IR0 . ? A IR0 101 ? 7_555 99.7 ? 177 OD1 ? A ASN 62 ? A ASN 62 ? 1_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O48 A B IR0 . ? A IR0 101 ? 7_555 86.0 ? 178 O40 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O48 A B IR0 . ? A IR0 101 ? 7_555 16.5 ? 179 OD1 ? A ASN 62 ? A ASN 62 ? 1_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O6 A B IR0 . ? A IR0 101 ? 7_555 111.2 ? 180 O40 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O6 A B IR0 . ? A IR0 101 ? 7_555 16.4 ? 181 O48 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O6 A B IR0 . ? A IR0 101 ? 7_555 25.4 ? 182 OD1 ? A ASN 62 ? A ASN 62 ? 1_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O88 A B IR0 . ? A IR0 101 ? 7_555 95.9 ? 183 O40 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O88 A B IR0 . ? A IR0 101 ? 7_555 5.5 ? 184 O48 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O88 A B IR0 . ? A IR0 101 ? 7_555 16.4 ? 185 O6 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O88 A B IR0 . ? A IR0 101 ? 7_555 21.8 ? 186 OD1 ? A ASN 62 ? A ASN 62 ? 1_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O128 A B IR0 . ? A IR0 101 ? 7_555 112.0 ? 187 O40 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O128 A B IR0 . ? A IR0 101 ? 7_555 18.1 ? 188 O48 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O128 A B IR0 . ? A IR0 101 ? 7_555 34.3 ? 189 O6 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O128 A B IR0 . ? A IR0 101 ? 7_555 24.1 ? 190 O88 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O128 A B IR0 . ? A IR0 101 ? 7_555 18.7 ? 191 OD1 ? A ASN 62 ? A ASN 62 ? 1_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O144 A B IR0 . ? A IR0 101 ? 7_555 88.7 ? 192 O40 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O144 A B IR0 . ? A IR0 101 ? 7_555 18.0 ? 193 O48 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O144 A B IR0 . ? A IR0 101 ? 7_555 23.5 ? 194 O6 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O144 A B IR0 . ? A IR0 101 ? 7_555 34.2 ? 195 O88 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O144 A B IR0 . ? A IR0 101 ? 7_555 12.6 ? 196 O128 A B IR0 . ? A IR0 101 ? 7_555 W6 B B IR0 . ? A IR0 101 ? 7_555 O144 A B IR0 . ? A IR0 101 ? 7_555 23.4 ? 197 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O27 A B IR0 . ? A IR0 101 ? 1_555 140.6 ? 198 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O48 A B IR0 . ? A IR0 101 ? 1_555 160.0 ? 199 O27 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O48 A B IR0 . ? A IR0 101 ? 1_555 19.6 ? 200 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O72 A B IR0 . ? A IR0 101 ? 1_555 150.3 ? 201 O27 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O72 A B IR0 . ? A IR0 101 ? 1_555 11.2 ? 202 O48 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O72 A B IR0 . ? A IR0 101 ? 1_555 9.9 ? 203 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 146.2 ? 204 O27 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 18.7 ? 205 O48 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 17.6 ? 206 O72 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 11.5 ? 207 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O115 A B IR0 . ? A IR0 101 ? 1_555 137.7 ? 208 O27 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O115 A B IR0 . ? A IR0 101 ? 1_555 15.2 ? 209 O48 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O115 A B IR0 . ? A IR0 101 ? 1_555 23.9 ? 210 O72 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O115 A B IR0 . ? A IR0 101 ? 1_555 14.7 ? 211 O104 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O115 A B IR0 . ? A IR0 101 ? 1_555 9.6 ? 212 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O176 A B IR0 . ? A IR0 101 ? 1_555 151.7 ? 213 O27 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O176 A B IR0 . ? A IR0 101 ? 1_555 24.8 ? 214 O48 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O176 A B IR0 . ? A IR0 101 ? 1_555 16.4 ? 215 O72 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O176 A B IR0 . ? A IR0 101 ? 1_555 15.0 ? 216 O104 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O176 A B IR0 . ? A IR0 101 ? 1_555 7.8 ? 217 O115 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O176 A B IR0 . ? A IR0 101 ? 1_555 17.4 ? 218 O ? C HOH . ? A HOH 201 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 0.0 ? 219 O27 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 140.6 ? 220 O48 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 160.0 ? 221 O72 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 150.3 ? 222 O104 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 146.2 ? 223 O115 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 137.7 ? 224 O176 A B IR0 . ? A IR0 101 ? 1_555 W38 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 151.7 ? 225 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O31 A B IR0 . ? A IR0 101 ? 1_555 72.0 ? 226 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O64 A B IR0 . ? A IR0 101 ? 1_555 80.1 ? 227 O31 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O64 A B IR0 . ? A IR0 101 ? 1_555 19.5 ? 228 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O80 A B IR0 . ? A IR0 101 ? 1_555 65.8 ? 229 O31 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O80 A B IR0 . ? A IR0 101 ? 1_555 18.3 ? 230 O64 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O80 A B IR0 . ? A IR0 101 ? 1_555 14.4 ? 231 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 70.6 ? 232 O31 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 11.4 ? 233 O64 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 11.4 ? 234 O80 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O104 A B IR0 . ? A IR0 101 ? 1_555 7.7 ? 235 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O119 A B IR0 . ? A IR0 101 ? 1_555 57.5 ? 236 O31 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O119 A B IR0 . ? A IR0 101 ? 1_555 16.4 ? 237 O64 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O119 A B IR0 . ? A IR0 101 ? 1_555 24.5 ? 238 O80 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O119 A B IR0 . ? A IR0 101 ? 1_555 12.2 ? 239 O104 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O119 A B IR0 . ? A IR0 101 ? 1_555 13.5 ? 240 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O184 A B IR0 . ? A IR0 101 ? 1_555 64.8 ? 241 O31 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O184 A B IR0 . ? A IR0 101 ? 1_555 26.1 ? 242 O64 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O184 A B IR0 . ? A IR0 101 ? 1_555 17.4 ? 243 O80 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O184 A B IR0 . ? A IR0 101 ? 1_555 7.8 ? 244 O104 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O184 A B IR0 . ? A IR0 101 ? 1_555 15.0 ? 245 O119 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O184 A B IR0 . ? A IR0 101 ? 1_555 17.9 ? 246 O ? C HOH . ? A HOH 201 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 0.0 ? 247 O31 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 72.0 ? 248 O64 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 80.1 ? 249 O80 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 65.8 ? 250 O104 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 70.6 ? 251 O119 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 57.5 ? 252 O184 A B IR0 . ? A IR0 101 ? 1_555 W46 B B IR0 . ? A IR0 101 ? 1_555 O ? C HOH . ? A HOH 201 ? 8_555 64.8 ? 253 O ? C HOH . ? A HOH 201 ? 4_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O26 A B IR0 . ? A IR0 101 ? 1_555 146.9 ? 254 O ? C HOH . ? A HOH 201 ? 4_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O42 A B IR0 . ? A IR0 101 ? 1_555 158.0 ? 255 O26 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O42 A B IR0 . ? A IR0 101 ? 1_555 21.8 ? 256 O ? C HOH . ? A HOH 201 ? 4_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O66 A B IR0 . ? A IR0 101 ? 1_555 151.1 ? 257 O26 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O66 A B IR0 . ? A IR0 101 ? 1_555 11.4 ? 258 O42 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O66 A B IR0 . ? A IR0 101 ? 1_555 11.3 ? 259 O ? C HOH . ? A HOH 201 ? 4_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O98 A B IR0 . ? A IR0 101 ? 1_555 138.7 ? 260 O26 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O98 A B IR0 . ? A IR0 101 ? 1_555 21.9 ? 261 O42 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O98 A B IR0 . ? A IR0 101 ? 1_555 19.7 ? 262 O66 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O98 A B IR0 . ? A IR0 101 ? 1_555 14.5 ? 263 O ? C HOH . ? A HOH 201 ? 4_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O114 A B IR0 . ? A IR0 101 ? 1_555 135.2 ? 264 O26 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O114 A B IR0 . ? A IR0 101 ? 1_555 16.3 ? 265 O42 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O114 A B IR0 . ? A IR0 101 ? 1_555 26.0 ? 266 O66 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O114 A B IR0 . ? A IR0 101 ? 1_555 16.0 ? 267 O98 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O114 A B IR0 . ? A IR0 101 ? 1_555 11.4 ? 268 O ? C HOH . ? A HOH 201 ? 4_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O170 A B IR0 . ? A IR0 101 ? 1_555 140.9 ? 269 O26 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O170 A B IR0 . ? A IR0 101 ? 1_555 26.4 ? 270 O42 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O170 A B IR0 . ? A IR0 101 ? 1_555 17.1 ? 271 O66 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O170 A B IR0 . ? A IR0 101 ? 1_555 16.5 ? 272 O98 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O170 A B IR0 . ? A IR0 101 ? 1_555 7.1 ? 273 O114 A B IR0 . ? A IR0 101 ? 1_555 W35 B B IR0 . ? A IR0 101 ? 1_555 O170 A B IR0 . ? A IR0 101 ? 1_555 18.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 10 ? ILE A 11 ? ALA A 10 ILE A 11 AA1 2 ILE A 17 ? GLY A 20 ? ILE A 17 GLY A 20 AA1 3 TYR A 25 ? ILE A 29 ? TYR A 25 ILE A 29 AA1 4 LEU A 35 ? GLU A 40 ? LEU A 35 GLU A 40 AA2 1 ALA A 50 ? ILE A 51 ? ALA A 50 ILE A 51 AA2 2 ILE A 57 ? GLY A 60 ? ILE A 57 GLY A 60 AA2 3 LEU A 66 ? ILE A 69 ? LEU A 66 ILE A 69 AA2 4 LEU A 75 ? PHE A 79 ? LEU A 75 PHE A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 10 ? N ALA A 10 O TYR A 18 ? O TYR A 18 AA1 2 3 N ILE A 17 ? N ILE A 17 O ILE A 29 ? O ILE A 29 AA1 3 4 N ALA A 28 ? N ALA A 28 O LYS A 36 ? O LYS A 36 AA2 1 2 N ALA A 50 ? N ALA A 50 O TYR A 58 ? O TYR A 58 AA2 2 3 N VAL A 59 ? N VAL A 59 O TYR A 67 ? O TYR A 67 AA2 3 4 N ALA A 68 ? N ALA A 68 O LYS A 76 ? O LYS A 76 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD1 A ASN 62 ? ? 1_555 O144 A IR0 101 ? B 7_555 2.14 2 1 N A THR 1 ? ? 1_555 O A HIS 64 ? ? 4_555 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 24 ? ? 86.71 1.21 2 1 HIS A 64 ? ? 85.99 6.00 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 201 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 8PRO _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 IR0 O3 O N N 169 IR0 O4 O N N 170 IR0 O1 O N N 171 IR0 O10 O N N 172 IR0 O11 O N N 173 IR0 O12 O N N 174 IR0 O13 O N N 175 IR0 O14 O N N 176 IR0 O15 O N N 177 IR0 O16 O N N 178 IR0 O17 O N N 179 IR0 O18 O N N 180 IR0 O19 O N N 181 IR0 O2 O N N 182 IR0 O20 O N N 183 IR0 O21 O N N 184 IR0 O22 O N N 185 IR0 O23 O N N 186 IR0 O24 O N N 187 IR0 O25 O N N 188 IR0 O26 O N N 189 IR0 O27 O N N 190 IR0 O28 O N N 191 IR0 O29 O N N 192 IR0 O30 O N N 193 IR0 O31 O N N 194 IR0 O32 O N N 195 IR0 O33 O N N 196 IR0 O34 O N N 197 IR0 O35 O N N 198 IR0 O36 O N N 199 IR0 O37 O N N 200 IR0 O38 O N N 201 IR0 O39 O N N 202 IR0 O40 O N N 203 IR0 O41 O N N 204 IR0 O42 O N N 205 IR0 O43 O N N 206 IR0 O44 O N N 207 IR0 O45 O N N 208 IR0 O46 O N N 209 IR0 O47 O N N 210 IR0 O48 O N N 211 IR0 O49 O N N 212 IR0 O5 O N N 213 IR0 O50 O N N 214 IR0 O51 O N N 215 IR0 O52 O N N 216 IR0 O53 O N N 217 IR0 O54 O N N 218 IR0 O55 O N N 219 IR0 O56 O N N 220 IR0 O57 O N N 221 IR0 O58 O N N 222 IR0 O59 O N N 223 IR0 O6 O N N 224 IR0 O60 O N N 225 IR0 O61 O N N 226 IR0 O62 O N N 227 IR0 O63 O N N 228 IR0 O64 O N N 229 IR0 O65 O N N 230 IR0 O66 O N N 231 IR0 O67 O N N 232 IR0 O68 O N N 233 IR0 O69 O N N 234 IR0 O7 O N N 235 IR0 O70 O N N 236 IR0 O71 O N N 237 IR0 O72 O N N 238 IR0 O73 O N N 239 IR0 O74 O N N 240 IR0 O75 O N N 241 IR0 O76 O N N 242 IR0 O77 O N N 243 IR0 O78 O N N 244 IR0 O79 O N N 245 IR0 O8 O N N 246 IR0 O80 O N N 247 IR0 O81 O N N 248 IR0 O82 O N N 249 IR0 O83 O N N 250 IR0 O84 O N N 251 IR0 O85 O N N 252 IR0 O86 O N N 253 IR0 O87 O N N 254 IR0 O88 O N N 255 IR0 O89 O N N 256 IR0 O9 O N N 257 IR0 O90 O N N 258 IR0 O91 O N N 259 IR0 O92 O N N 260 IR0 O93 O N N 261 IR0 O94 O N N 262 IR0 O95 O N N 263 IR0 O96 O N N 264 IR0 O97 O N N 265 IR0 O98 O N N 266 IR0 O99 O N N 267 IR0 P1 P N R 268 IR0 P2 P N R 269 IR0 P3 P N R 270 IR0 P4 P N R 271 IR0 P5 P N S 272 IR0 P6 P N S 273 IR0 P7 P N S 274 IR0 P8 P N S 275 IR0 W1 W N N 276 IR0 W10 W N N 277 IR0 W11 W N N 278 IR0 W12 W N N 279 IR0 W13 W N N 280 IR0 W14 W N N 281 IR0 W15 W N N 282 IR0 W16 W N N 283 IR0 W17 W N N 284 IR0 W18 W N N 285 IR0 W19 W N N 286 IR0 W2 W N N 287 IR0 W20 W N N 288 IR0 W21 W N N 289 IR0 W22 W N N 290 IR0 W23 W N N 291 IR0 W24 W N N 292 IR0 W25 W N N 293 IR0 W26 W N N 294 IR0 W27 W N N 295 IR0 W28 W N N 296 IR0 W29 W N N 297 IR0 W3 W N N 298 IR0 W30 W N N 299 IR0 W31 W N N 300 IR0 W32 W N N 301 IR0 W33 W N N 302 IR0 W34 W N N 303 IR0 W35 W N N 304 IR0 W36 W N N 305 IR0 W37 W N N 306 IR0 W38 W N N 307 IR0 W39 W N N 308 IR0 W4 W N N 309 IR0 W40 W N N 310 IR0 W41 W N N 311 IR0 W42 W N N 312 IR0 W43 W N N 313 IR0 W44 W N N 314 IR0 W45 W N N 315 IR0 W46 W N N 316 IR0 W47 W N N 317 IR0 W48 W N N 318 IR0 W5 W N N 319 IR0 W6 W N N 320 IR0 W7 W N N 321 IR0 W8 W N N 322 IR0 W9 W N N 323 IR0 O100 O N N 324 IR0 O101 O N N 325 IR0 O102 O N N 326 IR0 O103 O N N 327 IR0 O104 O N N 328 IR0 O105 O N N 329 IR0 O106 O N N 330 IR0 O107 O N N 331 IR0 O108 O N N 332 IR0 O109 O N N 333 IR0 O110 O N N 334 IR0 O111 O N N 335 IR0 O112 O N N 336 IR0 O113 O N N 337 IR0 O114 O N N 338 IR0 O115 O N N 339 IR0 O116 O N N 340 IR0 O117 O N N 341 IR0 O118 O N N 342 IR0 O119 O N N 343 IR0 O120 O N N 344 IR0 O121 O N N 345 IR0 O122 O N N 346 IR0 O123 O N N 347 IR0 O124 O N N 348 IR0 O125 O N N 349 IR0 O126 O N N 350 IR0 O127 O N N 351 IR0 O128 O N N 352 IR0 O129 O N N 353 IR0 O130 O N N 354 IR0 O131 O N N 355 IR0 O132 O N N 356 IR0 O133 O N N 357 IR0 O134 O N N 358 IR0 O135 O N N 359 IR0 O136 O N N 360 IR0 O137 O N N 361 IR0 O138 O N N 362 IR0 O139 O N N 363 IR0 O140 O N N 364 IR0 O141 O N N 365 IR0 O142 O N N 366 IR0 O143 O N N 367 IR0 O144 O N N 368 IR0 O145 O N N 369 IR0 O146 O N N 370 IR0 O147 O N N 371 IR0 O148 O N N 372 IR0 O149 O N N 373 IR0 O150 O N N 374 IR0 O151 O N N 375 IR0 O152 O N N 376 IR0 O153 O N N 377 IR0 O154 O N N 378 IR0 O155 O N N 379 IR0 O156 O N N 380 IR0 O157 O N N 381 IR0 O158 O N N 382 IR0 O159 O N N 383 IR0 O160 O N N 384 IR0 O161 O N N 385 IR0 O162 O N N 386 IR0 O163 O N N 387 IR0 O164 O N N 388 IR0 O165 O N N 389 IR0 O166 O N N 390 IR0 O167 O N N 391 IR0 O168 O N N 392 IR0 O169 O N N 393 IR0 O170 O N N 394 IR0 O171 O N N 395 IR0 O172 O N N 396 IR0 O173 O N N 397 IR0 O174 O N N 398 IR0 O175 O N N 399 IR0 O176 O N N 400 IR0 O177 O N N 401 IR0 O178 O N N 402 IR0 O179 O N N 403 IR0 O180 O N N 404 IR0 O181 O N N 405 IR0 O182 O N N 406 IR0 O183 O N N 407 IR0 O184 O N N 408 LEU N N N N 409 LEU CA C N S 410 LEU C C N N 411 LEU O O N N 412 LEU CB C N N 413 LEU CG C N N 414 LEU CD1 C N N 415 LEU CD2 C N N 416 LEU OXT O N N 417 LEU H H N N 418 LEU H2 H N N 419 LEU HA H N N 420 LEU HB2 H N N 421 LEU HB3 H N N 422 LEU HG H N N 423 LEU HD11 H N N 424 LEU HD12 H N N 425 LEU HD13 H N N 426 LEU HD21 H N N 427 LEU HD22 H N N 428 LEU HD23 H N N 429 LEU HXT H N N 430 LYS N N N N 431 LYS CA C N S 432 LYS C C N N 433 LYS O O N N 434 LYS CB C N N 435 LYS CG C N N 436 LYS CD C N N 437 LYS CE C N N 438 LYS NZ N N N 439 LYS OXT O N N 440 LYS H H N N 441 LYS H2 H N N 442 LYS HA H N N 443 LYS HB2 H N N 444 LYS HB3 H N N 445 LYS HG2 H N N 446 LYS HG3 H N N 447 LYS HD2 H N N 448 LYS HD3 H N N 449 LYS HE2 H N N 450 LYS HE3 H N N 451 LYS HZ1 H N N 452 LYS HZ2 H N N 453 LYS HZ3 H N N 454 LYS HXT H N N 455 MET N N N N 456 MET CA C N S 457 MET C C N N 458 MET O O N N 459 MET CB C N N 460 MET CG C N N 461 MET SD S N N 462 MET CE C N N 463 MET OXT O N N 464 MET H H N N 465 MET H2 H N N 466 MET HA H N N 467 MET HB2 H N N 468 MET HB3 H N N 469 MET HG2 H N N 470 MET HG3 H N N 471 MET HE1 H N N 472 MET HE2 H N N 473 MET HE3 H N N 474 MET HXT H N N 475 PHE N N N N 476 PHE CA C N S 477 PHE C C N N 478 PHE O O N N 479 PHE CB C N N 480 PHE CG C Y N 481 PHE CD1 C Y N 482 PHE CD2 C Y N 483 PHE CE1 C Y N 484 PHE CE2 C Y N 485 PHE CZ C Y N 486 PHE OXT O N N 487 PHE H H N N 488 PHE H2 H N N 489 PHE HA H N N 490 PHE HB2 H N N 491 PHE HB3 H N N 492 PHE HD1 H N N 493 PHE HD2 H N N 494 PHE HE1 H N N 495 PHE HE2 H N N 496 PHE HZ H N N 497 PHE HXT H N N 498 PRO N N N N 499 PRO CA C N S 500 PRO C C N N 501 PRO O O N N 502 PRO CB C N N 503 PRO CG C N N 504 PRO CD C N N 505 PRO OXT O N N 506 PRO H H N N 507 PRO HA H N N 508 PRO HB2 H N N 509 PRO HB3 H N N 510 PRO HG2 H N N 511 PRO HG3 H N N 512 PRO HD2 H N N 513 PRO HD3 H N N 514 PRO HXT H N N 515 SER N N N N 516 SER CA C N S 517 SER C C N N 518 SER O O N N 519 SER CB C N N 520 SER OG O N N 521 SER OXT O N N 522 SER H H N N 523 SER H2 H N N 524 SER HA H N N 525 SER HB2 H N N 526 SER HB3 H N N 527 SER HG H N N 528 SER HXT H N N 529 THR N N N N 530 THR CA C N S 531 THR C C N N 532 THR O O N N 533 THR CB C N R 534 THR OG1 O N N 535 THR CG2 C N N 536 THR OXT O N N 537 THR H H N N 538 THR H2 H N N 539 THR HA H N N 540 THR HB H N N 541 THR HG1 H N N 542 THR HG21 H N N 543 THR HG22 H N N 544 THR HG23 H N N 545 THR HXT H N N 546 TRP N N N N 547 TRP CA C N S 548 TRP C C N N 549 TRP O O N N 550 TRP CB C N N 551 TRP CG C Y N 552 TRP CD1 C Y N 553 TRP CD2 C Y N 554 TRP NE1 N Y N 555 TRP CE2 C Y N 556 TRP CE3 C Y N 557 TRP CZ2 C Y N 558 TRP CZ3 C Y N 559 TRP CH2 C Y N 560 TRP OXT O N N 561 TRP H H N N 562 TRP H2 H N N 563 TRP HA H N N 564 TRP HB2 H N N 565 TRP HB3 H N N 566 TRP HD1 H N N 567 TRP HE1 H N N 568 TRP HE3 H N N 569 TRP HZ2 H N N 570 TRP HZ3 H N N 571 TRP HH2 H N N 572 TRP HXT H N N 573 TYR N N N N 574 TYR CA C N S 575 TYR C C N N 576 TYR O O N N 577 TYR CB C N N 578 TYR CG C Y N 579 TYR CD1 C Y N 580 TYR CD2 C Y N 581 TYR CE1 C Y N 582 TYR CE2 C Y N 583 TYR CZ C Y N 584 TYR OH O N N 585 TYR OXT O N N 586 TYR H H N N 587 TYR H2 H N N 588 TYR HA H N N 589 TYR HB2 H N N 590 TYR HB3 H N N 591 TYR HD1 H N N 592 TYR HD2 H N N 593 TYR HE1 H N N 594 TYR HE2 H N N 595 TYR HH H N N 596 TYR HXT H N N 597 VAL N N N N 598 VAL CA C N S 599 VAL C C N N 600 VAL O O N N 601 VAL CB C N N 602 VAL CG1 C N N 603 VAL CG2 C N N 604 VAL OXT O N N 605 VAL H H N N 606 VAL H2 H N N 607 VAL HA H N N 608 VAL HB H N N 609 VAL HG11 H N N 610 VAL HG12 H N N 611 VAL HG13 H N N 612 VAL HG21 H N N 613 VAL HG22 H N N 614 VAL HG23 H N N 615 VAL HXT H N N 616 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 IR0 O3 P2 sing N N 160 IR0 O3 W3 sing N N 161 IR0 O4 P2 sing N N 162 IR0 O4 W4 sing N N 163 IR0 O1 P1 sing N N 164 IR0 O1 W1 sing N N 165 IR0 O10 P5 sing N N 166 IR0 O10 W10 sing N N 167 IR0 O11 P7 sing N N 168 IR0 O11 W13 sing N N 169 IR0 O12 P6 sing N N 170 IR0 O12 W11 sing N N 171 IR0 O13 P6 sing N N 172 IR0 O13 W12 sing N N 173 IR0 O14 P8 sing N N 174 IR0 O14 W15 sing N N 175 IR0 O15 P7 sing N N 176 IR0 O15 W14 sing N N 177 IR0 O16 P8 sing N N 178 IR0 O16 W16 sing N N 179 IR0 O17 P1 sing N N 180 IR0 O17 W17 sing N N 181 IR0 O17 W18 sing N N 182 IR0 O18 P2 sing N N 183 IR0 O18 W19 sing N N 184 IR0 O18 W20 sing N N 185 IR0 O19 P3 sing N N 186 IR0 O19 W21 sing N N 187 IR0 O19 W22 sing N N 188 IR0 O2 P1 sing N N 189 IR0 O2 W2 sing N N 190 IR0 O20 P4 sing N N 191 IR0 O20 W23 sing N N 192 IR0 O20 W24 sing N N 193 IR0 O21 P5 sing N N 194 IR0 O21 W25 sing N N 195 IR0 O21 W26 sing N N 196 IR0 O22 P7 sing N N 197 IR0 O22 W27 sing N N 198 IR0 O22 W31 sing N N 199 IR0 O23 P6 sing N N 200 IR0 O23 W28 sing N N 201 IR0 O23 W29 sing N N 202 IR0 O24 P8 sing N N 203 IR0 O24 W30 sing N N 204 IR0 O24 W32 sing N N 205 IR0 O25 P1 sing N N 206 IR0 O25 W33 sing N N 207 IR0 O25 W34 sing N N 208 IR0 O26 P2 sing N N 209 IR0 O26 W35 sing N N 210 IR0 O26 W36 sing N N 211 IR0 O27 P3 sing N N 212 IR0 O27 W37 sing N N 213 IR0 O27 W38 sing N N 214 IR0 O28 P4 sing N N 215 IR0 O28 W39 sing N N 216 IR0 O28 W40 sing N N 217 IR0 O29 P5 sing N N 218 IR0 O29 W41 sing N N 219 IR0 O29 W42 sing N N 220 IR0 O30 P6 sing N N 221 IR0 O30 W43 sing N N 222 IR0 O30 W44 sing N N 223 IR0 O31 P7 sing N N 224 IR0 O31 W45 sing N N 225 IR0 O31 W46 sing N N 226 IR0 O32 P8 sing N N 227 IR0 O32 W47 sing N N 228 IR0 O32 W48 sing N N 229 IR0 O33 W1 sing N N 230 IR0 O33 W17 sing N N 231 IR0 O34 W19 sing N N 232 IR0 O34 W3 sing N N 233 IR0 O35 W21 sing N N 234 IR0 O35 W5 sing N N 235 IR0 O36 W23 sing N N 236 IR0 O36 W7 sing N N 237 IR0 O37 W20 sing N N 238 IR0 O37 W4 sing N N 239 IR0 O38 W18 sing N N 240 IR0 O38 W2 sing N N 241 IR0 O39 W24 sing N N 242 IR0 O39 W8 sing N N 243 IR0 O40 W22 sing N N 244 IR0 O40 W6 sing N N 245 IR0 O41 W1 sing N N 246 IR0 O41 W33 sing N N 247 IR0 O42 W3 sing N N 248 IR0 O42 W35 sing N N 249 IR0 O43 W37 sing N N 250 IR0 O43 W5 sing N N 251 IR0 O44 W39 sing N N 252 IR0 O44 W7 sing N N 253 IR0 O45 W36 sing N N 254 IR0 O45 W4 sing N N 255 IR0 O46 W2 sing N N 256 IR0 O46 W34 sing N N 257 IR0 O47 W40 sing N N 258 IR0 O47 W8 sing N N 259 IR0 O48 W38 sing N N 260 IR0 O48 W6 sing N N 261 IR0 O49 W25 sing N N 262 IR0 O49 W9 sing N N 263 IR0 O5 P3 sing N N 264 IR0 O5 W5 sing N N 265 IR0 O50 W13 sing N N 266 IR0 O50 W27 sing N N 267 IR0 O51 W11 sing N N 268 IR0 O51 W28 sing N N 269 IR0 O52 W15 sing N N 270 IR0 O52 W30 sing N N 271 IR0 O53 W12 sing N N 272 IR0 O53 W29 sing N N 273 IR0 O54 W16 sing N N 274 IR0 O54 W32 sing N N 275 IR0 O55 W10 sing N N 276 IR0 O55 W26 sing N N 277 IR0 O56 W14 sing N N 278 IR0 O56 W31 sing N N 279 IR0 O57 W41 sing N N 280 IR0 O57 W9 sing N N 281 IR0 O58 W11 sing N N 282 IR0 O58 W43 sing N N 283 IR0 O59 W13 sing N N 284 IR0 O59 W45 sing N N 285 IR0 O6 P3 sing N N 286 IR0 O6 W6 sing N N 287 IR0 O60 W15 sing N N 288 IR0 O60 W47 sing N N 289 IR0 O61 W12 sing N N 290 IR0 O61 W44 sing N N 291 IR0 O62 W10 sing N N 292 IR0 O62 W42 sing N N 293 IR0 O63 W16 sing N N 294 IR0 O63 W48 sing N N 295 IR0 O64 W14 sing N N 296 IR0 O64 W46 sing N N 297 IR0 O65 W17 sing N N 298 IR0 O65 W33 sing N N 299 IR0 O66 W19 sing N N 300 IR0 O66 W35 sing N N 301 IR0 O67 W21 sing N N 302 IR0 O67 W37 sing N N 303 IR0 O68 W23 sing N N 304 IR0 O68 W39 sing N N 305 IR0 O69 W20 sing N N 306 IR0 O69 W36 sing N N 307 IR0 O7 P4 sing N N 308 IR0 O7 W7 sing N N 309 IR0 O70 W18 sing N N 310 IR0 O70 W34 sing N N 311 IR0 O71 W24 sing N N 312 IR0 O71 W40 sing N N 313 IR0 O72 W22 sing N N 314 IR0 O72 W38 sing N N 315 IR0 O73 W25 sing N N 316 IR0 O73 W41 sing N N 317 IR0 O74 W28 sing N N 318 IR0 O74 W43 sing N N 319 IR0 O75 W27 sing N N 320 IR0 O75 W45 sing N N 321 IR0 O76 W30 sing N N 322 IR0 O76 W47 sing N N 323 IR0 O77 W29 sing N N 324 IR0 O77 W44 sing N N 325 IR0 O78 W26 sing N N 326 IR0 O78 W42 sing N N 327 IR0 O79 W32 sing N N 328 IR0 O79 W48 sing N N 329 IR0 O8 P4 sing N N 330 IR0 O8 W8 sing N N 331 IR0 O80 W31 sing N N 332 IR0 O80 W46 sing N N 333 IR0 O81 W1 sing N N 334 IR0 O81 W9 sing N N 335 IR0 O82 W11 sing N N 336 IR0 O82 W3 sing N N 337 IR0 O83 W13 sing N N 338 IR0 O83 W5 sing N N 339 IR0 O84 W15 sing N N 340 IR0 O84 W7 sing N N 341 IR0 O85 W12 sing N N 342 IR0 O85 W4 sing N N 343 IR0 O86 W10 sing N N 344 IR0 O86 W2 sing N N 345 IR0 O87 W16 sing N N 346 IR0 O87 W8 sing N N 347 IR0 O88 W14 sing N N 348 IR0 O88 W6 sing N N 349 IR0 O89 W17 sing N N 350 IR0 O89 W27 sing N N 351 IR0 O9 P5 sing N N 352 IR0 O9 W9 sing N N 353 IR0 O90 W23 sing N N 354 IR0 O90 W25 sing N N 355 IR0 O91 W19 sing N N 356 IR0 O91 W30 sing N N 357 IR0 O92 W21 sing N N 358 IR0 O92 W28 sing N N 359 IR0 O93 W20 sing N N 360 IR0 O93 W32 sing N N 361 IR0 O94 W22 sing N N 362 IR0 O94 W29 sing N N 363 IR0 O95 W18 sing N N 364 IR0 O95 W31 sing N N 365 IR0 O96 W24 sing N N 366 IR0 O96 W26 sing N N 367 IR0 O97 W33 sing N N 368 IR0 O97 W41 sing N N 369 IR0 O98 W35 sing N N 370 IR0 O98 W43 sing N N 371 IR0 O99 W37 sing N N 372 IR0 O99 W45 sing N N 373 IR0 W1 O121 sing N N 374 IR0 W1 O137 sing N N 375 IR0 W10 O135 sing N N 376 IR0 W10 O150 sing N N 377 IR0 W11 O131 sing N N 378 IR0 W11 O146 sing N N 379 IR0 W12 O133 sing N N 380 IR0 W12 O149 sing N N 381 IR0 W13 O130 sing N N 382 IR0 W13 O147 sing N N 383 IR0 W14 O136 sing N N 384 IR0 W14 O152 sing N N 385 IR0 W15 O132 sing N N 386 IR0 W15 O148 sing N N 387 IR0 W16 O134 sing N N 388 IR0 W16 O151 sing N N 389 IR0 W17 O105 sing N N 390 IR0 W17 O153 sing N N 391 IR0 W18 O105 sing N N 392 IR0 W18 O158 sing N N 393 IR0 W19 O106 sing N N 394 IR0 W19 O154 sing N N 395 IR0 W2 O126 sing N N 396 IR0 W2 O142 sing N N 397 IR0 W20 O106 sing N N 398 IR0 W20 O157 sing N N 399 IR0 W21 O107 sing N N 400 IR0 W21 O155 sing N N 401 IR0 W22 O107 sing N N 402 IR0 W22 O160 sing N N 403 IR0 W23 O108 sing N N 404 IR0 W23 O156 sing N N 405 IR0 W24 O108 sing N N 406 IR0 W24 O159 sing N N 407 IR0 W25 O109 sing N N 408 IR0 W25 O161 sing N N 409 IR0 W26 O109 sing N N 410 IR0 W26 O166 sing N N 411 IR0 W27 O111 sing N N 412 IR0 W27 O163 sing N N 413 IR0 W28 O110 sing N N 414 IR0 W28 O162 sing N N 415 IR0 W29 O110 sing N N 416 IR0 W29 O165 sing N N 417 IR0 W3 O122 sing N N 418 IR0 W3 O138 sing N N 419 IR0 W30 O112 sing N N 420 IR0 W30 O164 sing N N 421 IR0 W31 O111 sing N N 422 IR0 W31 O168 sing N N 423 IR0 W32 O112 sing N N 424 IR0 W32 O167 sing N N 425 IR0 W33 O113 sing N N 426 IR0 W33 O169 sing N N 427 IR0 W34 O102 sing N N 428 IR0 W34 O113 sing N N 429 IR0 W34 O174 sing N N 430 IR0 W35 O114 sing N N 431 IR0 W35 O170 sing N N 432 IR0 W36 O101 sing N N 433 IR0 W36 O114 sing N N 434 IR0 W36 O173 sing N N 435 IR0 W37 O115 sing N N 436 IR0 W37 O171 sing N N 437 IR0 W38 O104 sing N N 438 IR0 W38 O115 sing N N 439 IR0 W38 O176 sing N N 440 IR0 W39 O100 sing N N 441 IR0 W39 O116 sing N N 442 IR0 W39 O172 sing N N 443 IR0 W4 O125 sing N N 444 IR0 W4 O141 sing N N 445 IR0 W40 O103 sing N N 446 IR0 W40 O116 sing N N 447 IR0 W40 O175 sing N N 448 IR0 W41 O117 sing N N 449 IR0 W41 O177 sing N N 450 IR0 W42 O102 sing N N 451 IR0 W42 O117 sing N N 452 IR0 W42 O182 sing N N 453 IR0 W43 O118 sing N N 454 IR0 W43 O178 sing N N 455 IR0 W44 O101 sing N N 456 IR0 W44 O118 sing N N 457 IR0 W44 O181 sing N N 458 IR0 W45 O119 sing N N 459 IR0 W45 O179 sing N N 460 IR0 W46 O104 sing N N 461 IR0 W46 O119 sing N N 462 IR0 W46 O184 sing N N 463 IR0 W47 O100 sing N N 464 IR0 W47 O120 sing N N 465 IR0 W47 O180 sing N N 466 IR0 W48 O103 sing N N 467 IR0 W48 O120 sing N N 468 IR0 W48 O183 sing N N 469 IR0 W5 O123 sing N N 470 IR0 W5 O139 sing N N 471 IR0 W6 O128 sing N N 472 IR0 W6 O144 sing N N 473 IR0 W7 O124 sing N N 474 IR0 W7 O140 sing N N 475 IR0 W8 O127 sing N N 476 IR0 W8 O143 sing N N 477 IR0 W9 O129 sing N N 478 IR0 W9 O145 sing N N 479 LEU N CA sing N N 480 LEU N H sing N N 481 LEU N H2 sing N N 482 LEU CA C sing N N 483 LEU CA CB sing N N 484 LEU CA HA sing N N 485 LEU C O doub N N 486 LEU C OXT sing N N 487 LEU CB CG sing N N 488 LEU CB HB2 sing N N 489 LEU CB HB3 sing N N 490 LEU CG CD1 sing N N 491 LEU CG CD2 sing N N 492 LEU CG HG sing N N 493 LEU CD1 HD11 sing N N 494 LEU CD1 HD12 sing N N 495 LEU CD1 HD13 sing N N 496 LEU CD2 HD21 sing N N 497 LEU CD2 HD22 sing N N 498 LEU CD2 HD23 sing N N 499 LEU OXT HXT sing N N 500 LYS N CA sing N N 501 LYS N H sing N N 502 LYS N H2 sing N N 503 LYS CA C sing N N 504 LYS CA CB sing N N 505 LYS CA HA sing N N 506 LYS C O doub N N 507 LYS C OXT sing N N 508 LYS CB CG sing N N 509 LYS CB HB2 sing N N 510 LYS CB HB3 sing N N 511 LYS CG CD sing N N 512 LYS CG HG2 sing N N 513 LYS CG HG3 sing N N 514 LYS CD CE sing N N 515 LYS CD HD2 sing N N 516 LYS CD HD3 sing N N 517 LYS CE NZ sing N N 518 LYS CE HE2 sing N N 519 LYS CE HE3 sing N N 520 LYS NZ HZ1 sing N N 521 LYS NZ HZ2 sing N N 522 LYS NZ HZ3 sing N N 523 LYS OXT HXT sing N N 524 MET N CA sing N N 525 MET N H sing N N 526 MET N H2 sing N N 527 MET CA C sing N N 528 MET CA CB sing N N 529 MET CA HA sing N N 530 MET C O doub N N 531 MET C OXT sing N N 532 MET CB CG sing N N 533 MET CB HB2 sing N N 534 MET CB HB3 sing N N 535 MET CG SD sing N N 536 MET CG HG2 sing N N 537 MET CG HG3 sing N N 538 MET SD CE sing N N 539 MET CE HE1 sing N N 540 MET CE HE2 sing N N 541 MET CE HE3 sing N N 542 MET OXT HXT sing N N 543 PHE N CA sing N N 544 PHE N H sing N N 545 PHE N H2 sing N N 546 PHE CA C sing N N 547 PHE CA CB sing N N 548 PHE CA HA sing N N 549 PHE C O doub N N 550 PHE C OXT sing N N 551 PHE CB CG sing N N 552 PHE CB HB2 sing N N 553 PHE CB HB3 sing N N 554 PHE CG CD1 doub Y N 555 PHE CG CD2 sing Y N 556 PHE CD1 CE1 sing Y N 557 PHE CD1 HD1 sing N N 558 PHE CD2 CE2 doub Y N 559 PHE CD2 HD2 sing N N 560 PHE CE1 CZ doub Y N 561 PHE CE1 HE1 sing N N 562 PHE CE2 CZ sing Y N 563 PHE CE2 HE2 sing N N 564 PHE CZ HZ sing N N 565 PHE OXT HXT sing N N 566 PRO N CA sing N N 567 PRO N CD sing N N 568 PRO N H sing N N 569 PRO CA C sing N N 570 PRO CA CB sing N N 571 PRO CA HA sing N N 572 PRO C O doub N N 573 PRO C OXT sing N N 574 PRO CB CG sing N N 575 PRO CB HB2 sing N N 576 PRO CB HB3 sing N N 577 PRO CG CD sing N N 578 PRO CG HG2 sing N N 579 PRO CG HG3 sing N N 580 PRO CD HD2 sing N N 581 PRO CD HD3 sing N N 582 PRO OXT HXT sing N N 583 SER N CA sing N N 584 SER N H sing N N 585 SER N H2 sing N N 586 SER CA C sing N N 587 SER CA CB sing N N 588 SER CA HA sing N N 589 SER C O doub N N 590 SER C OXT sing N N 591 SER CB OG sing N N 592 SER CB HB2 sing N N 593 SER CB HB3 sing N N 594 SER OG HG sing N N 595 SER OXT HXT sing N N 596 THR N CA sing N N 597 THR N H sing N N 598 THR N H2 sing N N 599 THR CA C sing N N 600 THR CA CB sing N N 601 THR CA HA sing N N 602 THR C O doub N N 603 THR C OXT sing N N 604 THR CB OG1 sing N N 605 THR CB CG2 sing N N 606 THR CB HB sing N N 607 THR OG1 HG1 sing N N 608 THR CG2 HG21 sing N N 609 THR CG2 HG22 sing N N 610 THR CG2 HG23 sing N N 611 THR OXT HXT sing N N 612 TRP N CA sing N N 613 TRP N H sing N N 614 TRP N H2 sing N N 615 TRP CA C sing N N 616 TRP CA CB sing N N 617 TRP CA HA sing N N 618 TRP C O doub N N 619 TRP C OXT sing N N 620 TRP CB CG sing N N 621 TRP CB HB2 sing N N 622 TRP CB HB3 sing N N 623 TRP CG CD1 doub Y N 624 TRP CG CD2 sing Y N 625 TRP CD1 NE1 sing Y N 626 TRP CD1 HD1 sing N N 627 TRP CD2 CE2 doub Y N 628 TRP CD2 CE3 sing Y N 629 TRP NE1 CE2 sing Y N 630 TRP NE1 HE1 sing N N 631 TRP CE2 CZ2 sing Y N 632 TRP CE3 CZ3 doub Y N 633 TRP CE3 HE3 sing N N 634 TRP CZ2 CH2 doub Y N 635 TRP CZ2 HZ2 sing N N 636 TRP CZ3 CH2 sing Y N 637 TRP CZ3 HZ3 sing N N 638 TRP CH2 HH2 sing N N 639 TRP OXT HXT sing N N 640 TYR N CA sing N N 641 TYR N H sing N N 642 TYR N H2 sing N N 643 TYR CA C sing N N 644 TYR CA CB sing N N 645 TYR CA HA sing N N 646 TYR C O doub N N 647 TYR C OXT sing N N 648 TYR CB CG sing N N 649 TYR CB HB2 sing N N 650 TYR CB HB3 sing N N 651 TYR CG CD1 doub Y N 652 TYR CG CD2 sing Y N 653 TYR CD1 CE1 sing Y N 654 TYR CD1 HD1 sing N N 655 TYR CD2 CE2 doub Y N 656 TYR CD2 HD2 sing N N 657 TYR CE1 CZ doub Y N 658 TYR CE1 HE1 sing N N 659 TYR CE2 CZ sing Y N 660 TYR CE2 HE2 sing N N 661 TYR CZ OH sing N N 662 TYR OH HH sing N N 663 TYR OXT HXT sing N N 664 VAL N CA sing N N 665 VAL N H sing N N 666 VAL N H2 sing N N 667 VAL CA C sing N N 668 VAL CA CB sing N N 669 VAL CA HA sing N N 670 VAL C O doub N N 671 VAL C OXT sing N N 672 VAL CB CG1 sing N N 673 VAL CB CG2 sing N N 674 VAL CB HB sing N N 675 VAL CG1 HG11 sing N N 676 VAL CG1 HG12 sing N N 677 VAL CG1 HG13 sing N N 678 VAL CG2 HG21 sing N N 679 VAL CG2 HG22 sing N N 680 VAL CG2 HG23 sing N N 681 VAL OXT HXT sing N N 682 # _pdbx_audit_support.funding_organization 'Research Foundation - Flanders (FWO)' _pdbx_audit_support.country Belgium _pdbx_audit_support.grant_number 1235722N _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IR0 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IR0 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 8PRO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018232 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018232 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008444 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P W # loop_