data_8PVC # _entry.id 8PVC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.382 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8PVC pdb_00008pvc 10.2210/pdb8pvc/pdb WWPDB D_1292131847 ? ? EMDB EMD-17961 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Structure of mouse heavy-chain apoferritin determined by cryoEM at 100 keV' _pdbx_database_related.db_id EMD-17961 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8PVC _pdbx_database_status.recvd_initial_deposition_date 2023-07-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McMullan, G.' 1 ? 'Naydenova, K.' 2 ? 'Mihaylov, D.' 3 ? 'Peet, M.J.' 4 ? 'Wilson, H.' 5 ? 'Yamashita, K.' 6 ? 'Dickerson, J.L.' 7 ? 'Chen, S.' 8 ? 'Cannone, G.' 9 ? 'Lee, Y.' 10 ? 'Hutchings, K.A.' 11 ? 'Gittins, O.' 12 ? 'Sobhy, M.' 13 ? 'Wells, T.' 14 ? 'El-Gomati, M.M.' 15 ? 'Dalby, J.' 16 ? 'Meffert, M.' 17 ? 'Schulze-Briese, C.' 18 ? 'Henderson, R.' 19 ? 'Russo, C.J.' 20 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 120 _citation.language ? _citation.page_first e2312905120 _citation.page_last e2312905120 _citation.title 'Structure determination by cryoEM at 100 keV.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2312905120 _citation.pdbx_database_id_PubMed 38011573 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McMullan, G.' 1 0000-0001-5449-8850 primary 'Naydenova, K.' 2 0000-0001-5533-5930 primary 'Mihaylov, D.' 3 ? primary 'Yamashita, K.' 4 0000-0002-5442-7582 primary 'Peet, M.J.' 5 0000-0002-0162-0063 primary 'Wilson, H.' 6 0000-0001-9411-2246 primary 'Dickerson, J.L.' 7 0000-0001-5049-4000 primary 'Chen, S.' 8 0000-0002-9472-4397 primary 'Cannone, G.' 9 0000-0002-4381-2522 primary 'Lee, Y.' 10 0000-0002-8040-3648 primary 'Hutchings, K.A.' 11 0000-0001-5760-3193 primary 'Gittins, O.' 12 0000-0002-3818-3952 primary 'Sobhy, M.A.' 13 0000-0002-1964-9497 primary 'Wells, T.' 14 0009-0009-0575-5318 primary 'El-Gomati, M.M.' 15 0000-0002-7782-6965 primary 'Dalby, J.' 16 0009-0007-9046-8609 primary 'Meffert, M.' 17 0000-0001-5637-9791 primary 'Schulze-Briese, C.' 18 0000-0002-8850-3926 primary 'Henderson, R.' 19 0000-0003-1444-0528 primary 'Russo, C.J.' 20 0000-0002-4442-744X # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8PVC _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8PVC _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 21097.631 1 1.16.3.1 ? ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMG APEAGMAEYLFDKHTLGHGDES ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMG APEAGMAEYLFDKHTLGHGDES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 ALA n 1 5 SER n 1 6 PRO n 1 7 SER n 1 8 GLN n 1 9 VAL n 1 10 ARG n 1 11 GLN n 1 12 ASN n 1 13 TYR n 1 14 HIS n 1 15 GLN n 1 16 ASP n 1 17 ALA n 1 18 GLU n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 ASN n 1 23 ARG n 1 24 GLN n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 TYR n 1 31 ALA n 1 32 SER n 1 33 TYR n 1 34 VAL n 1 35 TYR n 1 36 LEU n 1 37 SER n 1 38 MET n 1 39 SER n 1 40 CYS n 1 41 TYR n 1 42 PHE n 1 43 ASP n 1 44 ARG n 1 45 ASP n 1 46 ASP n 1 47 VAL n 1 48 ALA n 1 49 LEU n 1 50 LYS n 1 51 ASN n 1 52 PHE n 1 53 ALA n 1 54 LYS n 1 55 TYR n 1 56 PHE n 1 57 LEU n 1 58 HIS n 1 59 GLN n 1 60 SER n 1 61 HIS n 1 62 GLU n 1 63 GLU n 1 64 ARG n 1 65 GLU n 1 66 HIS n 1 67 ALA n 1 68 GLU n 1 69 LYS n 1 70 LEU n 1 71 MET n 1 72 LYS n 1 73 LEU n 1 74 GLN n 1 75 ASN n 1 76 GLN n 1 77 ARG n 1 78 GLY n 1 79 GLY n 1 80 ARG n 1 81 ILE n 1 82 PHE n 1 83 LEU n 1 84 GLN n 1 85 ASP n 1 86 ILE n 1 87 LYS n 1 88 LYS n 1 89 PRO n 1 90 ASP n 1 91 ARG n 1 92 ASP n 1 93 ASP n 1 94 TRP n 1 95 GLU n 1 96 SER n 1 97 GLY n 1 98 LEU n 1 99 ASN n 1 100 ALA n 1 101 MET n 1 102 GLU n 1 103 CYS n 1 104 ALA n 1 105 LEU n 1 106 HIS n 1 107 LEU n 1 108 GLU n 1 109 LYS n 1 110 SER n 1 111 VAL n 1 112 ASN n 1 113 GLN n 1 114 SER n 1 115 LEU n 1 116 LEU n 1 117 GLU n 1 118 LEU n 1 119 HIS n 1 120 LYS n 1 121 LEU n 1 122 ALA n 1 123 THR n 1 124 ASP n 1 125 LYS n 1 126 ASN n 1 127 ASP n 1 128 PRO n 1 129 HIS n 1 130 LEU n 1 131 CYS n 1 132 ASP n 1 133 PHE n 1 134 ILE n 1 135 GLU n 1 136 THR n 1 137 TYR n 1 138 TYR n 1 139 LEU n 1 140 SER n 1 141 GLU n 1 142 GLN n 1 143 VAL n 1 144 LYS n 1 145 SER n 1 146 ILE n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 ASP n 1 152 HIS n 1 153 VAL n 1 154 THR n 1 155 ASN n 1 156 LEU n 1 157 ARG n 1 158 LYS n 1 159 MET n 1 160 GLY n 1 161 ALA n 1 162 PRO n 1 163 GLU n 1 164 ALA n 1 165 GLY n 1 166 MET n 1 167 ALA n 1 168 GLU n 1 169 TYR n 1 170 LEU n 1 171 PHE n 1 172 ASP n 1 173 LYS n 1 174 HIS n 1 175 THR n 1 176 LEU n 1 177 GLY n 1 178 HIS n 1 179 GLY n 1 180 ASP n 1 181 GLU n 1 182 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 182 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Fth1, Fth' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_MOUSE _struct_ref.pdbx_db_accession P09528 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMG APEAGMAEYLFDKHTLGHGDES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8PVC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09528 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 181 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8PVC _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.vector[2] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[3] _struct_ncs_oper.details 1 given 1 0 0 0 0 1 0 0 0 0 1 0 ? 2 generate 6.123234e-17 -1 0 276.54 1 6.123234e-17 0 0 0 0 1 0 ? 3 generate -1 -1.2246468e-16 0 276.54 1.2246468e-16 -1 0 276.54 0 0 1 0 ? 4 generate -1.8369702e-16 1 0 2.84217094e-14 -1 -1.8369702e-16 0 276.54 0 0 1 0 ? 5 generate 6.123234e-17 0 1 0 0 1 0 0 -1 0 6.123234e-17 276.54 ? 6 generate -1 0 1.2246468e-16 276.54 0 1 0 0 -1.2246468e-16 0 -1 276.54 ? 7 generate -1.8369702e-16 0 -1 276.54 0 1 0 0 1 0 -1.8369702e-16 2.84217094e-14 ? 8 generate 1.11022302e-16 -1 1.11022302e-16 276.54 1.11022302e-16 1.11022302e-16 1 0 -1 -1.11022302e-16 1.11022302e-16 276.54 ? 9 generate -3.33066907e-16 -2.77555756e-16 -1 276.54 -1 -3.33066907e-16 2.77555756e-16 276.54 -2.77555756e-16 1 -3.33066907e-16 8.52651283e-14 ? 10 generate 1.11022302e-16 -1.11022302e-16 1 2.84217094e-14 1 1.11022302e-16 -1.11022302e-16 2.84217094e-14 -1.11022302e-16 1 1.11022302e-16 2.84217094e-14 ? 11 generate -3.33066907e-16 1 2.77555756e-16 2.84217094e-14 2.77555756e-16 -3.33066907e-16 1 0 1 2.77555756e-16 -3.33066907e-16 2.84217094e-14 ? 12 generate 2.22044605e-16 -1 0 276.54 -1 2.22044605e-16 0 276.54 0 0 -1 276.54 ? 13 generate 2.22044605e-16 1 0 -5.68434189e-14 1 2.22044605e-16 0 -5.68434189e-14 0 0 -1 276.54 ? 14 generate 1.11022302e-16 -1 -1.11022302e-16 276.54 1.11022302e-16 1.11022302e-16 -1 276.54 1 1.11022302e-16 1.11022302e-16 -2.84217094e-14 ? 15 generate -3.33066907e-16 -2.77555756e-16 1 8.52651283e-14 -1 -3.33066907e-16 -2.77555756e-16 276.54 2.77555756e-16 -1 -3.33066907e-16 276.54 ? 16 generate 1.11022302e-16 -1.11022302e-16 -1 276.54 1 1.11022302e-16 1.11022302e-16 -2.84217094e-14 1.11022302e-16 -1 1.11022302e-16 276.54 ? 17 generate -3.33066907e-16 1 -2.77555756e-16 8.52651283e-14 2.77555756e-16 -3.33066907e-16 -1 276.54 -1 -2.77555756e-16 -3.33066907e-16 276.54 ? 18 generate 2.22044605e-16 0 -1 276.54 0 -1 0 276.54 -1 0 2.22044605e-16 276.54 ? 19 generate 2.22044605e-16 0 1 -5.68434189e-14 0 -1 0 276.54 1 0 2.22044605e-16 -5.68434189e-14 ? 20 generate 1 0 0 0 0 -1 -1.2246468e-16 276.54 0 1.2246468e-16 -1 276.54 ? 21 generate -1 0 0 276.54 0 2.22044605e-16 1 -8.52651283e-14 0 1 2.22044605e-16 -5.68434189e-14 ? 22 generate 1 0 0 0 0 6.123234e-17 -1 276.54 0 1 6.123234e-17 0 ? 23 generate 1 0 0 0 0 -1.8369702e-16 1 2.84217094e-14 0 -1 -1.8369702e-16 276.54 ? 24 generate -1 0 0 276.54 0 2.22044605e-16 -1 276.54 0 -1 2.22044605e-16 276.54 ? # _struct.entry_id 8PVC _struct.title 'Structure of mouse heavy-chain apoferritin determined by cryoEM at 100 keV' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8PVC _struct_keywords.text 'Iron storage, metal binding protein' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 14 ? ASP A 43 ? HIS A 13 ASP A 42 1 ? 30 HELX_P HELX_P2 AA2 LEU A 49 ? ARG A 77 ? LEU A 48 ARG A 76 1 ? 29 HELX_P HELX_P3 AA3 SER A 96 ? LYS A 125 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 127 ? TYR A 138 ? ASP A 126 TYR A 137 1 ? 12 HELX_P HELX_P5 AA5 TYR A 138 ? GLY A 160 ? TYR A 137 GLY A 159 1 ? 23 HELX_P HELX_P6 AA6 ALA A 164 ? THR A 175 ? ALA A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 28 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 27 A ZN 202 1_555 ? ? ? ? ? ? ? 2.016 ? ? metalc2 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 62 A ZN 202 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc3 metalc ? ? A HIS 66 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 65 A ZN 202 1_555 ? ? ? ? ? ? ? 2.208 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 161 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 162 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.99 # _atom_sites.entry_id 8PVC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.0 _atom_sites.fract_transf_matrix[1][2] 0.0 _atom_sites.fract_transf_matrix[1][3] 0.0 _atom_sites.fract_transf_matrix[2][1] 0.0 _atom_sites.fract_transf_matrix[2][2] 1.0 _atom_sites.fract_transf_matrix[2][3] 0.0 _atom_sites.fract_transf_matrix[3][1] 0.0 _atom_sites.fract_transf_matrix[3][2] 0.0 _atom_sites.fract_transf_matrix[3][3] 1.0 _atom_sites.fract_transf_vector[1] 0.0 _atom_sites.fract_transf_vector[2] 0.0 _atom_sites.fract_transf_vector[3] 0.0 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 THR 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 ALA 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 GLN 8 7 7 GLN GLN A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 GLN 11 10 10 GLN GLN A . n A 1 12 ASN 12 11 11 ASN ASN A . n A 1 13 TYR 13 12 12 TYR TYR A . n A 1 14 HIS 14 13 13 HIS HIS A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 MET 38 37 37 MET MET A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 CYS 40 39 39 CYS CYS A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 TYR 55 54 54 TYR TYR A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 HIS 58 57 57 HIS HIS A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 HIS 61 60 60 HIS HIS A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 HIS 66 65 65 HIS HIS A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 ASN 75 74 74 ASN ASN A . n A 1 76 GLN 76 75 75 GLN GLN A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 GLY 78 77 77 GLY GLY A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 ARG 80 79 79 ARG ARG A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 PHE 82 81 81 PHE PHE A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 ASP 85 84 84 ASP ASP A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 ARG 91 90 90 ARG ARG A . n A 1 92 ASP 92 91 91 ASP ASP A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 TRP 94 93 93 TRP TRP A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 ASN 99 98 98 ASN ASN A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 MET 101 100 100 MET MET A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 CYS 103 102 102 CYS CYS A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 HIS 106 105 105 HIS HIS A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 SER 110 109 109 SER SER A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 ASN 112 111 111 ASN ASN A . n A 1 113 GLN 113 112 112 GLN GLN A . n A 1 114 SER 114 113 113 SER SER A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 GLU 117 116 116 GLU GLU A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 HIS 119 118 118 HIS HIS A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 THR 123 122 122 THR THR A . n A 1 124 ASP 124 123 123 ASP ASP A . n A 1 125 LYS 125 124 124 LYS LYS A . n A 1 126 ASN 126 125 125 ASN ASN A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 PRO 128 127 127 PRO PRO A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 CYS 131 130 130 CYS CYS A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 TYR 137 136 136 TYR TYR A . n A 1 138 TYR 138 137 137 TYR TYR A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 SER 140 139 139 SER SER A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 GLN 142 141 141 GLN GLN A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 SER 145 144 144 SER SER A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 GLU 148 147 147 GLU GLU A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 GLY 150 149 149 GLY GLY A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 HIS 152 151 151 HIS HIS A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 ASN 155 154 154 ASN ASN A . n A 1 156 LEU 156 155 155 LEU LEU A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 MET 159 158 158 MET MET A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 ALA 161 160 160 ALA ALA A . n A 1 162 PRO 162 161 161 PRO PRO A . n A 1 163 GLU 163 162 162 GLU GLU A . n A 1 164 ALA 164 163 163 ALA ALA A . n A 1 165 GLY 165 164 164 GLY GLY A . n A 1 166 MET 166 165 165 MET MET A . n A 1 167 ALA 167 166 166 ALA ALA A . n A 1 168 GLU 168 167 167 GLU GLU A . n A 1 169 TYR 169 168 168 TYR TYR A . n A 1 170 LEU 170 169 169 LEU LEU A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 ASP 172 171 171 ASP ASP A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 HIS 174 173 173 HIS HIS A . n A 1 175 THR 175 174 174 THR THR A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 GLY 177 176 176 GLY GLY A . n A 1 178 HIS 178 177 ? ? ? A . n A 1 179 GLY 179 178 ? ? ? A . n A 1 180 ASP 180 179 ? ? ? A . n A 1 181 GLU 181 180 ? ? ? A . n A 1 182 SER 182 181 ? ? ? A . n # _pdbx_contact_author.id 1 _pdbx_contact_author.email crusso@mrc-lmb.cam.ac.uk _pdbx_contact_author.name_first Christopher _pdbx_contact_author.name_last Russo _pdbx_contact_author.name_mi J. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4442-744X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 201 201 FE FE A . C 3 ZN 1 202 202 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 2 'point symmetry operation' ? ? 0.0 -1.0 0.0 276.54 1.0 0.0 0.0 0.0 0.0 0.0 1.0 0.0 3 'point symmetry operation' ? ? -1.0 0.0 0.0 276.54 0.0 -1.0 0.0 276.54 0.0 0.0 1.0 0.0 4 'point symmetry operation' ? ? 0.0 1.0 0.0 0.0 -1.0 0.0 0.0 276.54 0.0 0.0 1.0 0.0 5 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 0.0 1.0 0.0 0.0 -1.0 0.0 0.0 276.54 6 'point symmetry operation' ? ? -1.0 0.0 0.0 276.54 0.0 1.0 0.0 0.0 0.0 0.0 -1.0 276.54 7 'point symmetry operation' ? ? 0.0 0.0 -1.0 276.54 0.0 1.0 0.0 0.0 1.0 0.0 0.0 0.0 8 'point symmetry operation' ? ? 0.0 -1.0 0.0 276.54 0.0 0.0 1.0 0.0 -1.0 0.0 0.0 276.54 9 'point symmetry operation' ? ? 0.0 0.0 -1.0 276.54 -1.0 0.0 0.0 276.54 0.0 1.0 0.0 0.0 10 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 11 'point symmetry operation' ? ? 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 1.0 0.0 0.0 0.0 12 'point symmetry operation' ? ? 0.0 -1.0 0.0 276.54 -1.0 0.0 0.0 276.54 0.0 0.0 -1.0 276.54 13 'point symmetry operation' ? ? 0.0 1.0 0.0 -0.0 1.0 0.0 0.0 -0.0 0.0 0.0 -1.0 276.54 14 'point symmetry operation' ? ? 0.0 -1.0 0.0 276.54 0.0 0.0 -1.0 276.54 1.0 0.0 0.0 -0.0 15 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 -1.0 0.0 0.0 276.54 0.0 -1.0 0.0 276.54 16 'point symmetry operation' ? ? 0.0 0.0 -1.0 276.54 1.0 0.0 0.0 -0.0 0.0 -1.0 0.0 276.54 17 'point symmetry operation' ? ? 0.0 1.0 0.0 0.0 0.0 0.0 -1.0 276.54 -1.0 0.0 0.0 276.54 18 'point symmetry operation' ? ? 0.0 0.0 -1.0 276.54 0.0 -1.0 0.0 276.54 -1.0 0.0 0.0 276.54 19 'point symmetry operation' ? ? 0.0 0.0 1.0 -0.0 0.0 -1.0 0.0 276.54 1.0 0.0 0.0 -0.0 20 'point symmetry operation' ? ? 1.0 0.0 0.0 0.0 0.0 -1.0 0.0 276.54 0.0 0.0 -1.0 276.54 21 'point symmetry operation' ? ? -1.0 0.0 0.0 276.54 0.0 0.0 1.0 -0.0 0.0 1.0 0.0 -0.0 22 'point symmetry operation' ? ? 1.0 0.0 0.0 0.0 0.0 0.0 -1.0 276.54 0.0 1.0 0.0 0.0 23 'point symmetry operation' ? ? 1.0 0.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 -1.0 0.0 276.54 24 'point symmetry operation' ? ? -1.0 0.0 0.0 276.54 0.0 0.0 -1.0 276.54 0.0 -1.0 0.0 276.54 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 28 ? A GLU 27 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 69.3 ? 2 OE2 ? A GLU 28 ? A GLU 27 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 110.4 ? 3 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 95.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-11-29 2 'Structure model' 1 1 2023-12-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 2 'Structure model' '_citation_author.name' # _pdbx_entry_details.entry_id 8PVC _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 8PVC _em_3d_fitting.method ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_space RECIPROCAL _em_3d_fitting.ref_protocol ? # _em_3d_fitting_list.id 1 _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.pdb_entry_id 7a4m _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.pdb_chain_residue_range ? _em_3d_fitting_list.details ? _em_3d_fitting_list.chain_id ? _em_3d_fitting_list.chain_residue_range ? _em_3d_fitting_list.source_name PDB _em_3d_fitting_list.type 'experimental model' _em_3d_fitting_list.accession_code 7a4m _em_3d_fitting_list.initial_refinement_model_id 1 # _em_3d_reconstruction.entry_id 8PVC _em_3d_reconstruction.id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.citation_id ? _em_3d_reconstruction.details ? _em_3d_reconstruction.resolution 2.6 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.num_particles 26745 _em_3d_reconstruction.euler_angles_details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.symmetry_type POINT # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name ? _em_buffer.details ? _em_buffer.pH 7.5 # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.name 'Mouse heavy-chain apoferritin' _em_entity_assembly.details ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? _em_entity_assembly.entity_id_list 1 # _em_image_scans.entry_id 8PVC _em_image_scans.id 1 _em_image_scans.number_digital_images ? _em_image_scans.details ? _em_image_scans.scanner_model ? _em_image_scans.sampling_size 75 _em_image_scans.od_range ? _em_image_scans.quant_bit_size ? _em_image_scans.citation_id ? _em_image_scans.dimension_height 1066 _em_image_scans.dimension_width 1030 _em_image_scans.frames_per_image ? _em_image_scans.image_recording_id 1 _em_image_scans.used_frames_per_image ? # _em_imaging.entry_id 8PVC _em_imaging.id 1 _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? _em_imaging.residual_tilt ? _em_imaging.microscope_model 'JEOL 1400/HR + YPS FEG' _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model 'GATAN 626 SINGLE TILT LIQUID NITROGEN CRYO TRANSFER HOLDER' _em_imaging.details ? _em_imaging.date ? _em_imaging.accelerating_voltage 100 _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_min 500 _em_imaging.nominal_defocus_max 2000 _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_defocus_max ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.nominal_magnification ? _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.citation_id ? _em_imaging.temperature ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_minimum ? _em_imaging.recording_temperature_maximum ? _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.specimen_id 1 _em_imaging.cryogen NITROGEN # _em_sample_support.id 1 _em_sample_support.film_material ? _em_sample_support.method ? _em_sample_support.grid_material GOLD _em_sample_support.grid_mesh_size 300 _em_sample_support.grid_type 'UltrAuFoil R1.2/1.3' _em_sample_support.details ? _em_sample_support.specimen_id 1 _em_sample_support.citation_id ? # _em_vitrification.entry_id 8PVC _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.cryogen_name ETHANE _em_vitrification.humidity ? _em_vitrification.temp ? _em_vitrification.chamber_temperature ? _em_vitrification.instrument ? _em_vitrification.method ? _em_vitrification.time_resolved_state ? _em_vitrification.citation_id ? _em_vitrification.details ? # _em_experiment.entry_id 8PVC _em_experiment.id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.aggregation_state PARTICLE _em_experiment.entity_assembly_id 1 # _em_single_particle_entity.entry_id 8PVC _em_single_particle_entity.id 1 _em_single_particle_entity.image_processing_id 1 _em_single_particle_entity.point_symmetry O # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 63 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 63 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 63 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.56 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 4.26 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 10 ? ? -161.31 119.73 2 1 VAL A 46 ? ? -120.80 -61.39 3 1 GLU A 94 ? ? 76.50 -56.08 4 1 ASP A 126 ? ? -107.67 78.05 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 43 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.071 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A THR 1 ? A THR 2 3 1 Y 1 A THR 2 ? A THR 3 4 1 Y 1 A ALA 3 ? A ALA 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A HIS 177 ? A HIS 178 7 1 Y 1 A GLY 178 ? A GLY 179 8 1 Y 1 A ASP 179 ? A ASP 180 9 1 Y 1 A GLU 180 ? A GLU 181 10 1 Y 1 A SER 181 ? A SER 182 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 ZN ZN ZN N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _em_ctf_correction.details ? _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' # _em_entity_assembly_molwt.entity_assembly_id 1 _em_entity_assembly_molwt.experimental_flag NO _em_entity_assembly_molwt.id 1 _em_entity_assembly_molwt.units ? _em_entity_assembly_molwt.value ? # _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.ncbi_tax_id 10090 _em_entity_assembly_naturalsource.organism 'Mus musculus' _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? _em_entity_assembly_naturalsource.details ? # _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.ncbi_tax_id 469008 _em_entity_assembly_recombinant.organism 'Escherichia coli BL21(DE3)' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.details ? _em_image_processing.id 1 _em_image_processing.image_recording_id 1 # _em_image_recording.average_exposure_time ? _em_image_recording.avg_electron_dose_per_subtomogram ? _em_image_recording.avg_electron_dose_per_image 80 _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'DECTRIS SINGLA (1k x 1k)' _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.category _em_software.details _em_software.id _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id _em_software.name _em_software.version 'PARTICLE SELECTION' ? 1 1 ? ? ? ? 'IMAGE ACQUISITION' ? 2 ? ? 1 ? ? MASKING ? 3 ? ? ? ? ? 'CTF CORRECTION' ? 4 1 ? ? ? ? 'LAYERLINE INDEXING' ? 5 ? ? ? ? ? 'DIFFRACTION INDEXING' ? 6 ? ? ? ? ? 'MODEL FITTING' ? 7 ? 1 ? ? ? OTHER ? 8 ? ? ? ? ? 'INITIAL EULER ASSIGNMENT' ? 9 1 ? ? ? ? 'FINAL EULER ASSIGNMENT' ? 10 1 ? ? ? ? CLASSIFICATION ? 11 1 ? ? ? ? RECONSTRUCTION ? 12 1 ? ? ? ? 'MODEL REFINEMENT' ? 13 ? 1 ? Servalcat 0.4.27 # _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' 'MC UP 120117' 1 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' 'MC U105184322' 2 'Wellcome Trust' 'United Kingdom' 220526/B/20/Z 3 'Engineering and Physical Sciences Research Council' 'United Kingdom' R122522 4 'Innovate UK' 'United Kingdom' 103806 5 'Biotechnology and Biological Sciences Research Council (BBSRC)' 'United Kingdom' BB/T003677/1 6 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 'ZINC ION' ZN # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7a4m # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details 'not applicable' #