data_8PWT # _entry.id 8PWT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8PWT pdb_00008pwt 10.2210/pdb8pwt/pdb WWPDB D_1292131703 ? ? BMRB 34837 ? 10.13018/BMR34837 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-25 2 'Structure model' 1 1 2023-11-08 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_entry_details 4 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8PWT _pdbx_database_status.recvd_initial_deposition_date 2023-07-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the peptide U11-MYRTX-Tb1a from the venom of the ant Tetramorium bicarinatum' _pdbx_database_related.db_id 34837 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email laurence.jouvensal@cnrs-orleans.fr _pdbx_contact_author.name_first Laurence _pdbx_contact_author.name_last Jouvensal _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9223-9286 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jouvensal, L.' 1 0000-0001-9223-9286 'Paquet, F.' 2 0000-0001-8838-3445 'Loth, K.' 3 0000-0001-7058-8661 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Toxins _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2072-6651 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Discovery of an Insect Neuroactive Helix Ring Peptide from Ant Venom.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/toxins15100600 _citation.pdbx_database_id_PubMed 37888631 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barasse, V.' 1 ? primary 'Jouvensal, L.' 2 ? primary 'Boy, G.' 3 ? primary 'Billet, A.' 4 ? primary 'Ascoet, S.' 5 ? primary 'Lefranc, B.' 6 ? primary 'Leprince, J.' 7 ? primary 'Dejean, A.' 8 ? primary 'Lacotte, V.' 9 ? primary 'Rahioui, I.' 10 ? primary 'Sivignon, C.' 11 ? primary 'Gaget, K.' 12 ? primary 'Ribeiro Lopes, M.' 13 ? primary 'Calevro, F.' 14 ? primary 'Da Silva, P.' 15 ? primary 'Loth, K.' 16 ? primary 'Paquet, F.' 17 ? primary 'Treilhou, M.' 18 ? primary 'Bonnafe, E.' 19 ? primary 'Touchard, A.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description U11-myrmicitoxin-Tb1a _entity.formula_weight 4033.885 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name U11-MYRTX-Tb1a # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI _entity_poly.pdbx_seq_one_letter_code_can GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 GLU n 1 4 LYS n 1 5 GLU n 1 6 LYS n 1 7 LEU n 1 8 LYS n 1 9 GLN n 1 10 CYS n 1 11 PHE n 1 12 LYS n 1 13 ASP n 1 14 MET n 1 15 THR n 1 16 LEU n 1 17 ALA n 1 18 ALA n 1 19 ILE n 1 20 ASP n 1 21 TYR n 1 22 ALA n 1 23 LYS n 1 24 HIS n 1 25 LYS n 1 26 VAL n 1 27 GLU n 1 28 LYS n 1 29 HIS n 1 30 LEU n 1 31 PHE n 1 32 LYS n 1 33 CYS n 1 34 ILE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 34 _pdbx_entity_src_syn.organism_scientific 'Tetramorium bicarinatum' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 219812 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8PWT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8PWT _struct.title 'Solution structure of the peptide U11-MYRTX-Tb1a from the venom of the ant Tetramorium bicarinatum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8PWT _struct_keywords.text 'ant venom peptide, neurotoxin, Tetramorium, helix peptide, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TX11A_TETBN _struct_ref.pdbx_db_accession A0A6M3Z554 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GKEKEKLKQCFKDMTLAAIDYAKHKVEKHLFKCI _struct_ref.pdbx_align_begin 25 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8PWT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A6M3Z554 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 58 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 6 ? CYS A 10 ? LYS A 6 CYS A 10 5 ? 5 HELX_P HELX_P2 AA2 LEU A 16 ? LYS A 25 ? LEU A 16 LYS A 25 1 ? 10 HELX_P HELX_P3 AA3 VAL A 26 ? PHE A 31 ? VAL A 26 PHE A 31 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 10 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 33 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 10 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 33 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 10 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 33 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 10 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 33 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 8PWT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 5 ? ? -106.94 -102.94 2 1 GLN A 9 ? ? -33.71 -32.28 3 1 CYS A 10 ? ? -177.27 7.68 4 1 PHE A 11 ? ? -50.02 107.74 5 1 LYS A 12 ? ? -104.21 -68.08 6 1 LYS A 25 ? ? -92.23 -101.46 7 1 VAL A 26 ? ? -161.47 18.64 8 1 GLU A 27 ? ? -67.43 5.23 9 1 LYS A 32 ? ? -170.43 18.35 10 2 GLU A 3 ? ? 74.81 61.06 11 2 GLU A 5 ? ? -104.92 -105.02 12 2 LEU A 7 ? ? -43.56 -70.42 13 2 GLN A 9 ? ? -38.34 -35.64 14 2 CYS A 10 ? ? -170.18 7.58 15 2 PHE A 11 ? ? -48.82 104.81 16 2 LYS A 12 ? ? -104.01 -70.18 17 2 LYS A 25 ? ? -96.24 -86.03 18 2 VAL A 26 ? ? 178.86 18.15 19 2 GLU A 27 ? ? -66.13 2.49 20 2 LYS A 32 ? ? -177.66 131.41 21 2 CYS A 33 ? ? -170.76 -36.93 22 3 GLU A 5 ? ? -105.72 -107.00 23 3 CYS A 10 ? ? -175.88 8.84 24 3 PHE A 11 ? ? -53.97 107.68 25 3 LYS A 12 ? ? -104.37 -68.01 26 3 LYS A 25 ? ? -98.81 -105.80 27 3 VAL A 26 ? ? -155.41 17.19 28 3 LYS A 32 ? ? -174.05 134.99 29 3 CYS A 33 ? ? -174.45 -34.74 30 4 GLU A 5 ? ? -105.42 -107.03 31 4 GLN A 9 ? ? -39.42 -32.09 32 4 CYS A 10 ? ? -176.28 8.12 33 4 LYS A 12 ? ? -103.47 -68.71 34 4 MET A 14 ? ? -36.67 -37.98 35 4 LYS A 25 ? ? -91.67 -105.33 36 4 VAL A 26 ? ? -156.73 16.79 37 4 LYS A 32 ? ? -173.72 131.39 38 4 CYS A 33 ? ? -173.71 -37.59 39 5 GLU A 3 ? ? -113.35 61.01 40 5 GLU A 5 ? ? -103.62 -101.42 41 5 CYS A 10 ? ? -177.12 6.94 42 5 PHE A 11 ? ? -50.56 104.64 43 5 LYS A 12 ? ? -104.12 -68.90 44 5 GLU A 27 ? ? -67.98 5.14 45 5 LYS A 32 ? ? -165.53 27.85 46 6 GLU A 5 ? ? -104.07 -104.42 47 6 LEU A 7 ? ? -41.73 -70.12 48 6 GLN A 9 ? ? -39.80 -32.35 49 6 CYS A 10 ? ? -171.70 8.88 50 6 PHE A 11 ? ? -52.87 103.80 51 6 LYS A 12 ? ? -103.62 -65.97 52 6 LYS A 25 ? ? -97.42 -110.42 53 6 VAL A 26 ? ? -146.64 13.73 54 6 GLU A 27 ? ? -63.90 4.33 55 6 LYS A 32 ? ? -168.33 106.18 56 6 CYS A 33 ? ? -150.34 -44.59 57 7 GLU A 5 ? ? -105.44 -107.92 58 7 LEU A 7 ? ? -44.20 -70.44 59 7 CYS A 10 ? ? -163.56 7.34 60 7 PHE A 11 ? ? -52.50 103.17 61 7 LYS A 12 ? ? -104.17 -68.82 62 7 LYS A 25 ? ? -99.06 -104.76 63 7 VAL A 26 ? ? -158.00 16.91 64 7 LYS A 32 ? ? -169.65 116.49 65 7 CYS A 33 ? ? -140.19 -52.55 66 8 GLU A 5 ? ? -105.99 -102.05 67 8 LEU A 7 ? ? -43.62 -70.72 68 8 CYS A 10 ? ? -173.79 8.38 69 8 PHE A 11 ? ? -53.78 108.77 70 8 LYS A 12 ? ? -103.47 -67.82 71 8 LYS A 25 ? ? -98.80 -105.53 72 8 VAL A 26 ? ? -158.92 15.01 73 8 GLU A 27 ? ? -67.12 2.08 74 8 HIS A 29 ? ? -69.73 1.44 75 8 LYS A 32 ? ? 179.44 125.36 76 8 CYS A 33 ? ? -168.77 -34.97 77 9 LYS A 2 ? ? 71.56 -68.70 78 9 GLU A 5 ? ? -104.49 -96.62 79 9 GLN A 9 ? ? -29.06 -47.06 80 9 CYS A 10 ? ? -166.16 9.37 81 9 PHE A 11 ? ? -51.34 104.80 82 9 LYS A 12 ? ? -105.84 -67.55 83 9 MET A 14 ? ? -37.15 -36.99 84 9 LYS A 25 ? ? -97.82 -105.98 85 9 VAL A 26 ? ? -156.58 16.88 86 9 LYS A 32 ? ? -175.37 128.20 87 9 CYS A 33 ? ? -167.58 -35.44 88 10 GLU A 5 ? ? -105.38 -107.84 89 10 CYS A 10 ? ? -172.25 7.92 90 10 PHE A 11 ? ? -54.08 109.90 91 10 LYS A 12 ? ? -103.92 -69.39 92 10 LYS A 25 ? ? -94.96 -100.29 93 10 VAL A 26 ? ? -158.20 11.47 94 10 LYS A 32 ? ? -175.63 120.79 95 10 CYS A 33 ? ? -162.41 -39.80 96 11 GLU A 3 ? ? 83.52 70.33 97 11 GLU A 5 ? ? -104.08 -103.23 98 11 CYS A 10 ? ? -166.88 9.07 99 11 PHE A 11 ? ? -54.36 106.37 100 11 LYS A 12 ? ? -103.95 -69.43 101 11 LYS A 25 ? ? -100.84 -102.37 102 11 VAL A 26 ? ? -161.04 17.90 103 11 LYS A 32 ? ? -171.72 129.13 104 11 CYS A 33 ? ? -169.65 -34.45 105 12 LYS A 2 ? ? -145.77 -33.70 106 12 GLU A 5 ? ? -105.65 -102.51 107 12 CYS A 10 ? ? -170.53 8.08 108 12 PHE A 11 ? ? -53.33 103.24 109 12 LYS A 12 ? ? -103.77 -66.75 110 12 LYS A 25 ? ? -93.45 -109.78 111 12 VAL A 26 ? ? -153.45 14.68 112 12 LYS A 32 ? ? -175.06 119.69 113 12 CYS A 33 ? ? -146.95 -53.78 114 13 GLU A 5 ? ? -104.46 -105.99 115 13 LEU A 7 ? ? -41.21 -70.52 116 13 CYS A 10 ? ? -173.59 8.22 117 13 PHE A 11 ? ? -50.22 103.34 118 13 LYS A 12 ? ? -104.24 -70.58 119 13 LYS A 25 ? ? -97.45 -107.02 120 13 VAL A 26 ? ? -158.58 16.90 121 13 LYS A 32 ? ? 174.44 90.15 122 14 LYS A 2 ? ? 71.65 -56.69 123 14 GLU A 5 ? ? -106.77 -104.62 124 14 CYS A 10 ? ? -173.26 7.26 125 14 PHE A 11 ? ? -54.88 109.15 126 14 LYS A 12 ? ? -103.97 -68.57 127 14 LYS A 25 ? ? -100.65 -102.49 128 14 VAL A 26 ? ? -159.73 17.55 129 14 GLU A 27 ? ? -65.60 4.75 130 14 LYS A 32 ? ? -170.66 135.00 131 14 CYS A 33 ? ? -174.33 -40.46 132 15 GLU A 5 ? ? -104.96 -104.56 133 15 CYS A 10 ? ? -173.21 8.32 134 15 PHE A 11 ? ? -54.86 107.32 135 15 LYS A 12 ? ? -104.89 -66.44 136 15 LYS A 25 ? ? -94.85 -99.12 137 15 VAL A 26 ? ? -166.16 16.96 138 15 GLU A 27 ? ? -68.34 3.18 139 15 LYS A 32 ? ? -174.77 123.92 140 15 CYS A 33 ? ? -167.57 -35.37 # _pdbx_nmr_ensemble.entry_id 8PWT _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8PWT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.9 mM U11, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label U11 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component U11 _pdbx_nmr_exptl_sample.concentration 1.9 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_refine.entry_id 8PWT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'data analysis' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLU N N N N 64 GLU CA C N S 65 GLU C C N N 66 GLU O O N N 67 GLU CB C N N 68 GLU CG C N N 69 GLU CD C N N 70 GLU OE1 O N N 71 GLU OE2 O N N 72 GLU OXT O N N 73 GLU H H N N 74 GLU H2 H N N 75 GLU HA H N N 76 GLU HB2 H N N 77 GLU HB3 H N N 78 GLU HG2 H N N 79 GLU HG3 H N N 80 GLU HE2 H N N 81 GLU HXT H N N 82 GLY N N N N 83 GLY CA C N N 84 GLY C C N N 85 GLY O O N N 86 GLY OXT O N N 87 GLY H H N N 88 GLY H2 H N N 89 GLY HA2 H N N 90 GLY HA3 H N N 91 GLY HXT H N N 92 HIS N N N N 93 HIS CA C N S 94 HIS C C N N 95 HIS O O N N 96 HIS CB C N N 97 HIS CG C Y N 98 HIS ND1 N Y N 99 HIS CD2 C Y N 100 HIS CE1 C Y N 101 HIS NE2 N Y N 102 HIS OXT O N N 103 HIS H H N N 104 HIS H2 H N N 105 HIS HA H N N 106 HIS HB2 H N N 107 HIS HB3 H N N 108 HIS HD1 H N N 109 HIS HD2 H N N 110 HIS HE1 H N N 111 HIS HE2 H N N 112 HIS HXT H N N 113 ILE N N N N 114 ILE CA C N S 115 ILE C C N N 116 ILE O O N N 117 ILE CB C N S 118 ILE CG1 C N N 119 ILE CG2 C N N 120 ILE CD1 C N N 121 ILE OXT O N N 122 ILE H H N N 123 ILE H2 H N N 124 ILE HA H N N 125 ILE HB H N N 126 ILE HG12 H N N 127 ILE HG13 H N N 128 ILE HG21 H N N 129 ILE HG22 H N N 130 ILE HG23 H N N 131 ILE HD11 H N N 132 ILE HD12 H N N 133 ILE HD13 H N N 134 ILE HXT H N N 135 LEU N N N N 136 LEU CA C N S 137 LEU C C N N 138 LEU O O N N 139 LEU CB C N N 140 LEU CG C N N 141 LEU CD1 C N N 142 LEU CD2 C N N 143 LEU OXT O N N 144 LEU H H N N 145 LEU H2 H N N 146 LEU HA H N N 147 LEU HB2 H N N 148 LEU HB3 H N N 149 LEU HG H N N 150 LEU HD11 H N N 151 LEU HD12 H N N 152 LEU HD13 H N N 153 LEU HD21 H N N 154 LEU HD22 H N N 155 LEU HD23 H N N 156 LEU HXT H N N 157 LYS N N N N 158 LYS CA C N S 159 LYS C C N N 160 LYS O O N N 161 LYS CB C N N 162 LYS CG C N N 163 LYS CD C N N 164 LYS CE C N N 165 LYS NZ N N N 166 LYS OXT O N N 167 LYS H H N N 168 LYS H2 H N N 169 LYS HA H N N 170 LYS HB2 H N N 171 LYS HB3 H N N 172 LYS HG2 H N N 173 LYS HG3 H N N 174 LYS HD2 H N N 175 LYS HD3 H N N 176 LYS HE2 H N N 177 LYS HE3 H N N 178 LYS HZ1 H N N 179 LYS HZ2 H N N 180 LYS HZ3 H N N 181 LYS HXT H N N 182 MET N N N N 183 MET CA C N S 184 MET C C N N 185 MET O O N N 186 MET CB C N N 187 MET CG C N N 188 MET SD S N N 189 MET CE C N N 190 MET OXT O N N 191 MET H H N N 192 MET H2 H N N 193 MET HA H N N 194 MET HB2 H N N 195 MET HB3 H N N 196 MET HG2 H N N 197 MET HG3 H N N 198 MET HE1 H N N 199 MET HE2 H N N 200 MET HE3 H N N 201 MET HXT H N N 202 PHE N N N N 203 PHE CA C N S 204 PHE C C N N 205 PHE O O N N 206 PHE CB C N N 207 PHE CG C Y N 208 PHE CD1 C Y N 209 PHE CD2 C Y N 210 PHE CE1 C Y N 211 PHE CE2 C Y N 212 PHE CZ C Y N 213 PHE OXT O N N 214 PHE H H N N 215 PHE H2 H N N 216 PHE HA H N N 217 PHE HB2 H N N 218 PHE HB3 H N N 219 PHE HD1 H N N 220 PHE HD2 H N N 221 PHE HE1 H N N 222 PHE HE2 H N N 223 PHE HZ H N N 224 PHE HXT H N N 225 THR N N N N 226 THR CA C N S 227 THR C C N N 228 THR O O N N 229 THR CB C N R 230 THR OG1 O N N 231 THR CG2 C N N 232 THR OXT O N N 233 THR H H N N 234 THR H2 H N N 235 THR HA H N N 236 THR HB H N N 237 THR HG1 H N N 238 THR HG21 H N N 239 THR HG22 H N N 240 THR HG23 H N N 241 THR HXT H N N 242 TYR N N N N 243 TYR CA C N S 244 TYR C C N N 245 TYR O O N N 246 TYR CB C N N 247 TYR CG C Y N 248 TYR CD1 C Y N 249 TYR CD2 C Y N 250 TYR CE1 C Y N 251 TYR CE2 C Y N 252 TYR CZ C Y N 253 TYR OH O N N 254 TYR OXT O N N 255 TYR H H N N 256 TYR H2 H N N 257 TYR HA H N N 258 TYR HB2 H N N 259 TYR HB3 H N N 260 TYR HD1 H N N 261 TYR HD2 H N N 262 TYR HE1 H N N 263 TYR HE2 H N N 264 TYR HH H N N 265 TYR HXT H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLU N CA sing N N 60 GLU N H sing N N 61 GLU N H2 sing N N 62 GLU CA C sing N N 63 GLU CA CB sing N N 64 GLU CA HA sing N N 65 GLU C O doub N N 66 GLU C OXT sing N N 67 GLU CB CG sing N N 68 GLU CB HB2 sing N N 69 GLU CB HB3 sing N N 70 GLU CG CD sing N N 71 GLU CG HG2 sing N N 72 GLU CG HG3 sing N N 73 GLU CD OE1 doub N N 74 GLU CD OE2 sing N N 75 GLU OE2 HE2 sing N N 76 GLU OXT HXT sing N N 77 GLY N CA sing N N 78 GLY N H sing N N 79 GLY N H2 sing N N 80 GLY CA C sing N N 81 GLY CA HA2 sing N N 82 GLY CA HA3 sing N N 83 GLY C O doub N N 84 GLY C OXT sing N N 85 GLY OXT HXT sing N N 86 HIS N CA sing N N 87 HIS N H sing N N 88 HIS N H2 sing N N 89 HIS CA C sing N N 90 HIS CA CB sing N N 91 HIS CA HA sing N N 92 HIS C O doub N N 93 HIS C OXT sing N N 94 HIS CB CG sing N N 95 HIS CB HB2 sing N N 96 HIS CB HB3 sing N N 97 HIS CG ND1 sing Y N 98 HIS CG CD2 doub Y N 99 HIS ND1 CE1 doub Y N 100 HIS ND1 HD1 sing N N 101 HIS CD2 NE2 sing Y N 102 HIS CD2 HD2 sing N N 103 HIS CE1 NE2 sing Y N 104 HIS CE1 HE1 sing N N 105 HIS NE2 HE2 sing N N 106 HIS OXT HXT sing N N 107 ILE N CA sing N N 108 ILE N H sing N N 109 ILE N H2 sing N N 110 ILE CA C sing N N 111 ILE CA CB sing N N 112 ILE CA HA sing N N 113 ILE C O doub N N 114 ILE C OXT sing N N 115 ILE CB CG1 sing N N 116 ILE CB CG2 sing N N 117 ILE CB HB sing N N 118 ILE CG1 CD1 sing N N 119 ILE CG1 HG12 sing N N 120 ILE CG1 HG13 sing N N 121 ILE CG2 HG21 sing N N 122 ILE CG2 HG22 sing N N 123 ILE CG2 HG23 sing N N 124 ILE CD1 HD11 sing N N 125 ILE CD1 HD12 sing N N 126 ILE CD1 HD13 sing N N 127 ILE OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 MET N CA sing N N 174 MET N H sing N N 175 MET N H2 sing N N 176 MET CA C sing N N 177 MET CA CB sing N N 178 MET CA HA sing N N 179 MET C O doub N N 180 MET C OXT sing N N 181 MET CB CG sing N N 182 MET CB HB2 sing N N 183 MET CB HB3 sing N N 184 MET CG SD sing N N 185 MET CG HG2 sing N N 186 MET CG HG3 sing N N 187 MET SD CE sing N N 188 MET CE HE1 sing N N 189 MET CE HE2 sing N N 190 MET CE HE3 sing N N 191 MET OXT HXT sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 THR N CA sing N N 216 THR N H sing N N 217 THR N H2 sing N N 218 THR CA C sing N N 219 THR CA CB sing N N 220 THR CA HA sing N N 221 THR C O doub N N 222 THR C OXT sing N N 223 THR CB OG1 sing N N 224 THR CB CG2 sing N N 225 THR CB HB sing N N 226 THR OG1 HG1 sing N N 227 THR CG2 HG21 sing N N 228 THR CG2 HG22 sing N N 229 THR CG2 HG23 sing N N 230 THR OXT HXT sing N N 231 TYR N CA sing N N 232 TYR N H sing N N 233 TYR N H2 sing N N 234 TYR CA C sing N N 235 TYR CA CB sing N N 236 TYR CA HA sing N N 237 TYR C O doub N N 238 TYR C OXT sing N N 239 TYR CB CG sing N N 240 TYR CB HB2 sing N N 241 TYR CB HB3 sing N N 242 TYR CG CD1 doub Y N 243 TYR CG CD2 sing Y N 244 TYR CD1 CE1 sing Y N 245 TYR CD1 HD1 sing N N 246 TYR CD2 CE2 doub Y N 247 TYR CD2 HD2 sing N N 248 TYR CE1 CZ doub Y N 249 TYR CE1 HE1 sing N N 250 TYR CE2 CZ sing Y N 251 TYR CE2 HE2 sing N N 252 TYR CZ OH sing N N 253 TYR OH HH sing N N 254 TYR OXT HXT sing N N 255 VAL N CA sing N N 256 VAL N H sing N N 257 VAL N H2 sing N N 258 VAL CA C sing N N 259 VAL CA CB sing N N 260 VAL CA HA sing N N 261 VAL C O doub N N 262 VAL C OXT sing N N 263 VAL CB CG1 sing N N 264 VAL CB CG2 sing N N 265 VAL CB HB sing N N 266 VAL CG1 HG11 sing N N 267 VAL CG1 HG12 sing N N 268 VAL CG1 HG13 sing N N 269 VAL CG2 HG21 sing N N 270 VAL CG2 HG22 sing N N 271 VAL CG2 HG23 sing N N 272 VAL OXT HXT sing N N 273 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8PWT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_