data_8PX2 # _entry.id 8PX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8PX2 pdb_00008px2 10.2210/pdb8px2/pdb WWPDB D_1292132126 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-18 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author 4 3 'Structure model' citation 5 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8PX2 _pdbx_database_status.recvd_initial_deposition_date 2023-07-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email cc16943@gsk.com _pdbx_contact_author.name_first Chun-wa _pdbx_contact_author.name_last Chung _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2480-3110 # _audit_author.name 'Chung, C.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-2480-3110 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 66 _citation.language ? _citation.page_first 15728 _citation.page_last 15749 _citation.title 'Structure-Guided Design of a Domain-Selective Bromodomain and Extra Terminal N-Terminal Bromodomain Chemical Probe.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c00906 _citation.pdbx_database_id_PubMed 37967462 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bradley, E.' 1 ? primary 'Fusani, L.' 2 ? primary 'Chung, C.W.' 3 ? primary 'Craggs, P.D.' 4 ? primary 'Demont, E.H.' 5 ? primary 'Humphreys, P.G.' 6 ? primary 'Mitchell, D.J.' 7 ? primary 'Phillipou, A.' 8 ? primary 'Rioja, I.' 9 ? primary 'Shah, R.R.' 10 ? primary 'Wellaway, C.R.' 11 ? primary 'Prinjha, R.K.' 12 ? primary 'Palmer, D.S.' 13 ? primary 'Kerr, W.J.' 14 ? primary 'Reid, M.' 15 ? primary 'Wall, I.D.' 16 ? primary 'Cookson, R.' 17 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 2' 13432.462 1 ? ? ? ? 2 non-polymer syn '1,3-dimethyl-5-[1-(oxan-4-ylmethyl)benzimidazol-2-yl]pyridin-2-one' 337.416 1 ? ? ? ? 3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 4 water nat water 18.015 255 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'O27.1.1,Really interesting new gene 3 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1,3-dimethyl-5-[1-(oxan-4-ylmethyl)benzimidazol-2-yl]pyridin-2-one' NUB 3 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 LYS n 1 6 LEU n 1 7 SER n 1 8 GLU n 1 9 GLN n 1 10 LEU n 1 11 LYS n 1 12 HIS n 1 13 CYS n 1 14 ASN n 1 15 GLY n 1 16 ILE n 1 17 LEU n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 LEU n 1 22 SER n 1 23 LYS n 1 24 LYS n 1 25 HIS n 1 26 ALA n 1 27 ALA n 1 28 TYR n 1 29 ALA n 1 30 TRP n 1 31 PRO n 1 32 PHE n 1 33 TYR n 1 34 LYS n 1 35 PRO n 1 36 VAL n 1 37 ASP n 1 38 ALA n 1 39 SER n 1 40 ALA n 1 41 LEU n 1 42 GLY n 1 43 LEU n 1 44 HIS n 1 45 ASP n 1 46 TYR n 1 47 HIS n 1 48 ASP n 1 49 ILE n 1 50 ILE n 1 51 LYS n 1 52 HIS n 1 53 PRO n 1 54 MET n 1 55 ASP n 1 56 LEU n 1 57 SER n 1 58 THR n 1 59 VAL n 1 60 LYS n 1 61 ARG n 1 62 LYS n 1 63 MET n 1 64 GLU n 1 65 ASN n 1 66 ARG n 1 67 ASP n 1 68 TYR n 1 69 ARG n 1 70 ASP n 1 71 ALA n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 ALA n 1 76 ALA n 1 77 ASP n 1 78 VAL n 1 79 ARG n 1 80 LEU n 1 81 MET n 1 82 PHE n 1 83 SER n 1 84 ASN n 1 85 CYS n 1 86 TYR n 1 87 LYS n 1 88 TYR n 1 89 ASN n 1 90 PRO n 1 91 PRO n 1 92 ASP n 1 93 HIS n 1 94 ASP n 1 95 VAL n 1 96 VAL n 1 97 ALA n 1 98 MET n 1 99 ALA n 1 100 ARG n 1 101 LYS n 1 102 LEU n 1 103 GLN n 1 104 ASP n 1 105 VAL n 1 106 PHE n 1 107 GLU n 1 108 PHE n 1 109 ARG n 1 110 TYR n 1 111 ALA n 1 112 LYS n 1 113 MET n 1 114 PRO n 1 115 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 115 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD2, KIAA9001, RING3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NUB non-polymer . '1,3-dimethyl-5-[1-(oxan-4-ylmethyl)benzimidazol-2-yl]pyridin-2-one' '1,3-dimethyl-5-(1-((tetrahydro-2H-pyran-4-yl)methyl)-1H-benzo[d]imidazol-2-yl)pyridin-2(1H)-one' 'C20 H23 N3 O2' 337.416 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 341 ? ? ? A . n A 1 2 SER 2 342 ? ? ? A . n A 1 3 MET 3 343 343 MET MET A . n A 1 4 GLY 4 344 344 GLY GLY A . n A 1 5 LYS 5 345 345 LYS LYS A . n A 1 6 LEU 6 346 346 LEU LEU A . n A 1 7 SER 7 347 347 SER SER A . n A 1 8 GLU 8 348 348 GLU GLU A . n A 1 9 GLN 9 349 349 GLN GLN A . n A 1 10 LEU 10 350 350 LEU LEU A . n A 1 11 LYS 11 351 351 LYS LYS A . n A 1 12 HIS 12 352 352 HIS HIS A . n A 1 13 CYS 13 353 353 CYS CYS A . n A 1 14 ASN 14 354 354 ASN ASN A . n A 1 15 GLY 15 355 355 GLY GLY A . n A 1 16 ILE 16 356 356 ILE ILE A . n A 1 17 LEU 17 357 357 LEU LEU A . n A 1 18 LYS 18 358 358 LYS LYS A . n A 1 19 GLU 19 359 359 GLU GLU A . n A 1 20 LEU 20 360 360 LEU LEU A . n A 1 21 LEU 21 361 361 LEU LEU A . n A 1 22 SER 22 362 362 SER SER A . n A 1 23 LYS 23 363 363 LYS LYS A . n A 1 24 LYS 24 364 364 LYS LYS A . n A 1 25 HIS 25 365 365 HIS HIS A . n A 1 26 ALA 26 366 366 ALA ALA A . n A 1 27 ALA 27 367 367 ALA ALA A . n A 1 28 TYR 28 368 368 TYR TYR A . n A 1 29 ALA 29 369 369 ALA ALA A . n A 1 30 TRP 30 370 370 TRP TRP A . n A 1 31 PRO 31 371 371 PRO PRO A . n A 1 32 PHE 32 372 372 PHE PHE A . n A 1 33 TYR 33 373 373 TYR TYR A . n A 1 34 LYS 34 374 374 LYS LYS A . n A 1 35 PRO 35 375 375 PRO PRO A . n A 1 36 VAL 36 376 376 VAL VAL A . n A 1 37 ASP 37 377 377 ASP ASP A . n A 1 38 ALA 38 378 378 ALA ALA A . n A 1 39 SER 39 379 379 SER SER A . n A 1 40 ALA 40 380 380 ALA ALA A . n A 1 41 LEU 41 381 381 LEU LEU A . n A 1 42 GLY 42 382 382 GLY GLY A . n A 1 43 LEU 43 383 383 LEU LEU A . n A 1 44 HIS 44 384 384 HIS HIS A . n A 1 45 ASP 45 385 385 ASP ASP A . n A 1 46 TYR 46 386 386 TYR TYR A . n A 1 47 HIS 47 387 387 HIS HIS A . n A 1 48 ASP 48 388 388 ASP ASP A . n A 1 49 ILE 49 389 389 ILE ILE A . n A 1 50 ILE 50 390 390 ILE ILE A . n A 1 51 LYS 51 391 391 LYS LYS A . n A 1 52 HIS 52 392 392 HIS HIS A . n A 1 53 PRO 53 393 393 PRO PRO A . n A 1 54 MET 54 394 394 MET MET A . n A 1 55 ASP 55 395 395 ASP ASP A . n A 1 56 LEU 56 396 396 LEU LEU A . n A 1 57 SER 57 397 397 SER SER A . n A 1 58 THR 58 398 398 THR THR A . n A 1 59 VAL 59 399 399 VAL VAL A . n A 1 60 LYS 60 400 400 LYS LYS A . n A 1 61 ARG 61 401 401 ARG ARG A . n A 1 62 LYS 62 402 402 LYS LYS A . n A 1 63 MET 63 403 403 MET MET A . n A 1 64 GLU 64 404 404 GLU GLU A . n A 1 65 ASN 65 405 405 ASN ASN A . n A 1 66 ARG 66 406 406 ARG ARG A . n A 1 67 ASP 67 407 407 ASP ASP A . n A 1 68 TYR 68 408 408 TYR TYR A . n A 1 69 ARG 69 409 409 ARG ARG A . n A 1 70 ASP 70 410 410 ASP ASP A . n A 1 71 ALA 71 411 411 ALA ALA A . n A 1 72 GLN 72 412 412 GLN GLN A . n A 1 73 GLU 73 413 413 GLU GLU A . n A 1 74 PHE 74 414 414 PHE PHE A . n A 1 75 ALA 75 415 415 ALA ALA A . n A 1 76 ALA 76 416 416 ALA ALA A . n A 1 77 ASP 77 417 417 ASP ASP A . n A 1 78 VAL 78 418 418 VAL VAL A . n A 1 79 ARG 79 419 419 ARG ARG A . n A 1 80 LEU 80 420 420 LEU LEU A . n A 1 81 MET 81 421 421 MET MET A . n A 1 82 PHE 82 422 422 PHE PHE A . n A 1 83 SER 83 423 423 SER SER A . n A 1 84 ASN 84 424 424 ASN ASN A . n A 1 85 CYS 85 425 425 CYS CYS A . n A 1 86 TYR 86 426 426 TYR TYR A . n A 1 87 LYS 87 427 427 LYS LYS A . n A 1 88 TYR 88 428 428 TYR TYR A . n A 1 89 ASN 89 429 429 ASN ASN A . n A 1 90 PRO 90 430 430 PRO PRO A . n A 1 91 PRO 91 431 431 PRO PRO A . n A 1 92 ASP 92 432 432 ASP ASP A . n A 1 93 HIS 93 433 433 HIS HIS A . n A 1 94 ASP 94 434 434 ASP ASP A . n A 1 95 VAL 95 435 435 VAL VAL A . n A 1 96 VAL 96 436 436 VAL VAL A . n A 1 97 ALA 97 437 437 ALA ALA A . n A 1 98 MET 98 438 438 MET MET A . n A 1 99 ALA 99 439 439 ALA ALA A . n A 1 100 ARG 100 440 440 ARG ARG A . n A 1 101 LYS 101 441 441 LYS LYS A . n A 1 102 LEU 102 442 442 LEU LEU A . n A 1 103 GLN 103 443 443 GLN GLN A . n A 1 104 ASP 104 444 444 ASP ASP A . n A 1 105 VAL 105 445 445 VAL VAL A . n A 1 106 PHE 106 446 446 PHE PHE A . n A 1 107 GLU 107 447 447 GLU GLU A . n A 1 108 PHE 108 448 448 PHE PHE A . n A 1 109 ARG 109 449 449 ARG ARG A . n A 1 110 TYR 110 450 450 TYR TYR A . n A 1 111 ALA 111 451 451 ALA ALA A . n A 1 112 LYS 112 452 452 LYS LYS A . n A 1 113 MET 113 453 453 MET MET A . n A 1 114 PRO 114 454 454 PRO PRO A . n A 1 115 ASP 115 455 455 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NUB 1 501 1 NUB LIG A . C 3 MES 1 502 1 MES MES A . D 4 HOH 1 601 224 HOH HOH A . D 4 HOH 2 602 216 HOH HOH A . D 4 HOH 3 603 119 HOH HOH A . D 4 HOH 4 604 176 HOH HOH A . D 4 HOH 5 605 11 HOH HOH A . D 4 HOH 6 606 230 HOH HOH A . D 4 HOH 7 607 89 HOH HOH A . D 4 HOH 8 608 103 HOH HOH A . D 4 HOH 9 609 99 HOH HOH A . D 4 HOH 10 610 185 HOH HOH A . D 4 HOH 11 611 207 HOH HOH A . D 4 HOH 12 612 4 HOH HOH A . D 4 HOH 13 613 65 HOH HOH A . D 4 HOH 14 614 242 HOH HOH A . D 4 HOH 15 615 8 HOH HOH A . D 4 HOH 16 616 223 HOH HOH A . D 4 HOH 17 617 211 HOH HOH A . D 4 HOH 18 618 227 HOH HOH A . D 4 HOH 19 619 55 HOH HOH A . D 4 HOH 20 620 219 HOH HOH A . D 4 HOH 21 621 175 HOH HOH A . D 4 HOH 22 622 68 HOH HOH A . D 4 HOH 23 623 63 HOH HOH A . D 4 HOH 24 624 251 HOH HOH A . D 4 HOH 25 625 36 HOH HOH A . D 4 HOH 26 626 197 HOH HOH A . D 4 HOH 27 627 243 HOH HOH A . D 4 HOH 28 628 217 HOH HOH A . D 4 HOH 29 629 60 HOH HOH A . D 4 HOH 30 630 74 HOH HOH A . D 4 HOH 31 631 41 HOH HOH A . D 4 HOH 32 632 5 HOH HOH A . D 4 HOH 33 633 160 HOH HOH A . D 4 HOH 34 634 46 HOH HOH A . D 4 HOH 35 635 94 HOH HOH A . D 4 HOH 36 636 108 HOH HOH A . D 4 HOH 37 637 12 HOH HOH A . D 4 HOH 38 638 20 HOH HOH A . D 4 HOH 39 639 165 HOH HOH A . D 4 HOH 40 640 59 HOH HOH A . D 4 HOH 41 641 33 HOH HOH A . D 4 HOH 42 642 58 HOH HOH A . D 4 HOH 43 643 64 HOH HOH A . D 4 HOH 44 644 61 HOH HOH A . D 4 HOH 45 645 123 HOH HOH A . D 4 HOH 46 646 49 HOH HOH A . D 4 HOH 47 647 16 HOH HOH A . D 4 HOH 48 648 13 HOH HOH A . D 4 HOH 49 649 6 HOH HOH A . D 4 HOH 50 650 28 HOH HOH A . D 4 HOH 51 651 78 HOH HOH A . D 4 HOH 52 652 14 HOH HOH A . D 4 HOH 53 653 178 HOH HOH A . D 4 HOH 54 654 51 HOH HOH A . D 4 HOH 55 655 23 HOH HOH A . D 4 HOH 56 656 221 HOH HOH A . D 4 HOH 57 657 254 HOH HOH A . D 4 HOH 58 658 7 HOH HOH A . D 4 HOH 59 659 109 HOH HOH A . D 4 HOH 60 660 2 HOH HOH A . D 4 HOH 61 661 134 HOH HOH A . D 4 HOH 62 662 18 HOH HOH A . D 4 HOH 63 663 77 HOH HOH A . D 4 HOH 64 664 212 HOH HOH A . D 4 HOH 65 665 248 HOH HOH A . D 4 HOH 66 666 9 HOH HOH A . D 4 HOH 67 667 129 HOH HOH A . D 4 HOH 68 668 26 HOH HOH A . D 4 HOH 69 669 38 HOH HOH A . D 4 HOH 70 670 95 HOH HOH A . D 4 HOH 71 671 200 HOH HOH A . D 4 HOH 72 672 150 HOH HOH A . D 4 HOH 73 673 72 HOH HOH A . D 4 HOH 74 674 86 HOH HOH A . D 4 HOH 75 675 21 HOH HOH A . D 4 HOH 76 676 141 HOH HOH A . D 4 HOH 77 677 83 HOH HOH A . D 4 HOH 78 678 195 HOH HOH A . D 4 HOH 79 679 47 HOH HOH A . D 4 HOH 80 680 24 HOH HOH A . D 4 HOH 81 681 192 HOH HOH A . D 4 HOH 82 682 34 HOH HOH A . D 4 HOH 83 683 118 HOH HOH A . D 4 HOH 84 684 3 HOH HOH A . D 4 HOH 85 685 69 HOH HOH A . D 4 HOH 86 686 151 HOH HOH A . D 4 HOH 87 687 25 HOH HOH A . D 4 HOH 88 688 37 HOH HOH A . D 4 HOH 89 689 105 HOH HOH A . D 4 HOH 90 690 130 HOH HOH A . D 4 HOH 91 691 10 HOH HOH A . D 4 HOH 92 692 220 HOH HOH A . D 4 HOH 93 693 27 HOH HOH A . D 4 HOH 94 694 15 HOH HOH A . D 4 HOH 95 695 75 HOH HOH A . D 4 HOH 96 696 135 HOH HOH A . D 4 HOH 97 697 30 HOH HOH A . D 4 HOH 98 698 57 HOH HOH A . D 4 HOH 99 699 50 HOH HOH A . D 4 HOH 100 700 112 HOH HOH A . D 4 HOH 101 701 107 HOH HOH A . D 4 HOH 102 702 39 HOH HOH A . D 4 HOH 103 703 40 HOH HOH A . D 4 HOH 104 704 215 HOH HOH A . D 4 HOH 105 705 54 HOH HOH A . D 4 HOH 106 706 17 HOH HOH A . D 4 HOH 107 707 42 HOH HOH A . D 4 HOH 108 708 203 HOH HOH A . D 4 HOH 109 709 43 HOH HOH A . D 4 HOH 110 710 213 HOH HOH A . D 4 HOH 111 711 29 HOH HOH A . D 4 HOH 112 712 31 HOH HOH A . D 4 HOH 113 713 156 HOH HOH A . D 4 HOH 114 714 45 HOH HOH A . D 4 HOH 115 715 225 HOH HOH A . D 4 HOH 116 716 90 HOH HOH A . D 4 HOH 117 717 22 HOH HOH A . D 4 HOH 118 718 1 HOH HOH A . D 4 HOH 119 719 228 HOH HOH A . D 4 HOH 120 720 35 HOH HOH A . D 4 HOH 121 721 177 HOH HOH A . D 4 HOH 122 722 235 HOH HOH A . D 4 HOH 123 723 167 HOH HOH A . D 4 HOH 124 724 247 HOH HOH A . D 4 HOH 125 725 104 HOH HOH A . D 4 HOH 126 726 48 HOH HOH A . D 4 HOH 127 727 19 HOH HOH A . D 4 HOH 128 728 171 HOH HOH A . D 4 HOH 129 729 91 HOH HOH A . D 4 HOH 130 730 241 HOH HOH A . D 4 HOH 131 731 87 HOH HOH A . D 4 HOH 132 732 85 HOH HOH A . D 4 HOH 133 733 82 HOH HOH A . D 4 HOH 134 734 113 HOH HOH A . D 4 HOH 135 735 240 HOH HOH A . D 4 HOH 136 736 169 HOH HOH A . D 4 HOH 137 737 189 HOH HOH A . D 4 HOH 138 738 124 HOH HOH A . D 4 HOH 139 739 161 HOH HOH A . D 4 HOH 140 740 146 HOH HOH A . D 4 HOH 141 741 62 HOH HOH A . D 4 HOH 142 742 190 HOH HOH A . D 4 HOH 143 743 172 HOH HOH A . D 4 HOH 144 744 188 HOH HOH A . D 4 HOH 145 745 234 HOH HOH A . D 4 HOH 146 746 114 HOH HOH A . D 4 HOH 147 747 222 HOH HOH A . D 4 HOH 148 748 173 HOH HOH A . D 4 HOH 149 749 250 HOH HOH A . D 4 HOH 150 750 79 HOH HOH A . D 4 HOH 151 751 166 HOH HOH A . D 4 HOH 152 752 209 HOH HOH A . D 4 HOH 153 753 96 HOH HOH A . D 4 HOH 154 754 67 HOH HOH A . D 4 HOH 155 755 117 HOH HOH A . D 4 HOH 156 756 198 HOH HOH A . D 4 HOH 157 757 249 HOH HOH A . D 4 HOH 158 758 233 HOH HOH A . D 4 HOH 159 759 229 HOH HOH A . D 4 HOH 160 760 66 HOH HOH A . D 4 HOH 161 761 149 HOH HOH A . D 4 HOH 162 762 252 HOH HOH A . D 4 HOH 163 763 53 HOH HOH A . D 4 HOH 164 764 162 HOH HOH A . D 4 HOH 165 765 187 HOH HOH A . D 4 HOH 166 766 180 HOH HOH A . D 4 HOH 167 767 84 HOH HOH A . D 4 HOH 168 768 92 HOH HOH A . D 4 HOH 169 769 52 HOH HOH A . D 4 HOH 170 770 206 HOH HOH A . D 4 HOH 171 771 106 HOH HOH A . D 4 HOH 172 772 98 HOH HOH A . D 4 HOH 173 773 181 HOH HOH A . D 4 HOH 174 774 145 HOH HOH A . D 4 HOH 175 775 93 HOH HOH A . D 4 HOH 176 776 204 HOH HOH A . D 4 HOH 177 777 56 HOH HOH A . D 4 HOH 178 778 147 HOH HOH A . D 4 HOH 179 779 179 HOH HOH A . D 4 HOH 180 780 199 HOH HOH A . D 4 HOH 181 781 168 HOH HOH A . D 4 HOH 182 782 163 HOH HOH A . D 4 HOH 183 783 153 HOH HOH A . D 4 HOH 184 784 148 HOH HOH A . D 4 HOH 185 785 244 HOH HOH A . D 4 HOH 186 786 194 HOH HOH A . D 4 HOH 187 787 128 HOH HOH A . D 4 HOH 188 788 32 HOH HOH A . D 4 HOH 189 789 44 HOH HOH A . D 4 HOH 190 790 76 HOH HOH A . D 4 HOH 191 791 144 HOH HOH A . D 4 HOH 192 792 152 HOH HOH A . D 4 HOH 193 793 170 HOH HOH A . D 4 HOH 194 794 102 HOH HOH A . D 4 HOH 195 795 97 HOH HOH A . D 4 HOH 196 796 122 HOH HOH A . D 4 HOH 197 797 210 HOH HOH A . D 4 HOH 198 798 116 HOH HOH A . D 4 HOH 199 799 115 HOH HOH A . D 4 HOH 200 800 191 HOH HOH A . D 4 HOH 201 801 70 HOH HOH A . D 4 HOH 202 802 245 HOH HOH A . D 4 HOH 203 803 143 HOH HOH A . D 4 HOH 204 804 231 HOH HOH A . D 4 HOH 205 805 81 HOH HOH A . D 4 HOH 206 806 131 HOH HOH A . D 4 HOH 207 807 196 HOH HOH A . D 4 HOH 208 808 201 HOH HOH A . D 4 HOH 209 809 120 HOH HOH A . D 4 HOH 210 810 138 HOH HOH A . D 4 HOH 211 811 184 HOH HOH A . D 4 HOH 212 812 133 HOH HOH A . D 4 HOH 213 813 110 HOH HOH A . D 4 HOH 214 814 73 HOH HOH A . D 4 HOH 215 815 132 HOH HOH A . D 4 HOH 216 816 80 HOH HOH A . D 4 HOH 217 817 218 HOH HOH A . D 4 HOH 218 818 158 HOH HOH A . D 4 HOH 219 819 140 HOH HOH A . D 4 HOH 220 820 88 HOH HOH A . D 4 HOH 221 821 121 HOH HOH A . D 4 HOH 222 822 238 HOH HOH A . D 4 HOH 223 823 154 HOH HOH A . D 4 HOH 224 824 214 HOH HOH A . D 4 HOH 225 825 183 HOH HOH A . D 4 HOH 226 826 202 HOH HOH A . D 4 HOH 227 827 186 HOH HOH A . D 4 HOH 228 828 193 HOH HOH A . D 4 HOH 229 829 137 HOH HOH A . D 4 HOH 230 830 126 HOH HOH A . D 4 HOH 231 831 111 HOH HOH A . D 4 HOH 232 832 236 HOH HOH A . D 4 HOH 233 833 155 HOH HOH A . D 4 HOH 234 834 142 HOH HOH A . D 4 HOH 235 835 226 HOH HOH A . D 4 HOH 236 836 71 HOH HOH A . D 4 HOH 237 837 205 HOH HOH A . D 4 HOH 238 838 101 HOH HOH A . D 4 HOH 239 839 255 HOH HOH A . D 4 HOH 240 840 182 HOH HOH A . D 4 HOH 241 841 159 HOH HOH A . D 4 HOH 242 842 136 HOH HOH A . D 4 HOH 243 843 246 HOH HOH A . D 4 HOH 244 844 174 HOH HOH A . D 4 HOH 245 845 239 HOH HOH A . D 4 HOH 246 846 127 HOH HOH A . D 4 HOH 247 847 139 HOH HOH A . D 4 HOH 248 848 100 HOH HOH A . D 4 HOH 249 849 208 HOH HOH A . D 4 HOH 250 850 157 HOH HOH A . D 4 HOH 251 851 232 HOH HOH A . D 4 HOH 252 852 237 HOH HOH A . D 4 HOH 253 853 253 HOH HOH A . D 4 HOH 254 854 125 HOH HOH A . D 4 HOH 255 855 164 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0352 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8PX2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.949 _cell.length_a_esd ? _cell.length_b 52.631 _cell.length_b_esd ? _cell.length_c 32.159 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8PX2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8PX2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.73 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 300, 0.1M MES buffer pH6.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN A200' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8PX2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.62 _reflns.d_resolution_low 71.95 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15520 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.024 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.62 _reflns_shell.d_res_low 1.71 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1903 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 83.6 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.170 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.053 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.002 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.051 _refine.B_iso_max ? _refine.B_iso_mean 15.117 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8PX2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.622 _refine.ls_d_res_low 27.442 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15429 _refine.ls_number_reflns_R_free 765 _refine.ls_number_reflns_R_work 14664 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.922 _refine.ls_percent_reflns_R_free 4.958 _refine.ls_R_factor_all 0.153 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1769 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1517 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.091 _refine.pdbx_overall_ESU_R_Free 0.086 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.113 _refine.overall_SU_ML 0.056 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 931 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 255 _refine_hist.number_atoms_total 1223 _refine_hist.d_res_high 1.622 _refine_hist.d_res_low 27.442 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 0.012 1022 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 927 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.044 1.661 1381 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.400 1.626 2172 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.972 5.000 118 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 3.470 5.000 6 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.468 10.000 180 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.908 10.000 49 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.060 0.200 136 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1140 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 207 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.220 0.200 236 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 818 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.187 0.200 509 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.070 0.200 459 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.145 0.200 147 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.216 0.200 16 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.155 0.200 70 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.099 0.200 47 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.012 1.767 466 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 0.978 1.766 466 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.653 3.948 586 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.653 3.961 587 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.708 2.169 556 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.710 2.166 554 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 2.809 4.662 795 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 2.807 4.666 796 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.700 37.379 1378 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 6.700 37.377 1379 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.622 1.664 1169 . 45 864 77.7588 . 0.251 . . 0.249 . . . . . 0.201 . 20 . 0.937 0.872 0.291 'X-RAY DIFFRACTION' 1.664 1.709 1108 . 56 927 88.7184 . 0.227 . . 0.228 . . . . . 0.191 . 20 . 0.960 0.955 0.220 'X-RAY DIFFRACTION' 1.709 1.759 1111 . 47 1007 94.8695 . 0.198 . . 0.196 . . . . . 0.159 . 20 . 0.971 0.957 0.262 'X-RAY DIFFRACTION' 1.759 1.812 1058 . 63 984 98.9603 . 0.175 . . 0.175 . . . . . 0.143 . 20 . 0.979 0.977 0.184 'X-RAY DIFFRACTION' 1.812 1.872 1049 . 46 991 98.8561 . 0.161 . . 0.160 . . . . . 0.130 . 20 . 0.983 0.974 0.191 'X-RAY DIFFRACTION' 1.872 1.937 1019 . 54 956 99.1168 . 0.165 . . 0.162 . . . . . 0.133 . 20 . 0.983 0.974 0.204 'X-RAY DIFFRACTION' 1.937 2.010 981 . 44 930 99.2864 . 0.138 . . 0.137 . . . . . 0.117 . 20 . 0.988 0.985 0.167 'X-RAY DIFFRACTION' 2.010 2.091 917 . 45 865 99.2366 . 0.128 . . 0.130 . . . . . 0.111 . 20 . 0.989 0.993 0.108 'X-RAY DIFFRACTION' 2.091 2.184 926 . 36 886 99.5680 . 0.133 . . 0.132 . . . . . 0.113 . 20 . 0.989 0.986 0.146 'X-RAY DIFFRACTION' 2.184 2.290 875 . 60 812 99.6571 . 0.133 . . 0.130 . . . . . 0.114 . 20 . 0.988 0.983 0.169 'X-RAY DIFFRACTION' 2.290 2.413 820 . 35 776 98.9024 . 0.138 . . 0.136 . . . . . 0.119 . 20 . 0.988 0.980 0.198 'X-RAY DIFFRACTION' 2.413 2.558 784 . 48 727 98.8520 . 0.148 . . 0.145 . . . . . 0.127 . 20 . 0.986 0.982 0.183 'X-RAY DIFFRACTION' 2.558 2.733 737 . 36 686 97.9647 . 0.143 . . 0.141 . . . . . 0.125 . 20 . 0.988 0.981 0.190 'X-RAY DIFFRACTION' 2.733 2.949 706 . 44 649 98.1586 . 0.155 . . 0.154 . . . . . 0.140 . 20 . 0.985 0.983 0.171 'X-RAY DIFFRACTION' 2.949 3.227 640 . 25 602 97.9688 . 0.146 . . 0.144 . . . . . 0.134 . 20 . 0.986 0.977 0.184 'X-RAY DIFFRACTION' 3.227 3.601 594 . 23 559 97.9798 . 0.141 . . 0.141 . . . . . 0.140 . 20 . 0.987 0.983 0.146 'X-RAY DIFFRACTION' 3.601 4.147 525 . 17 495 97.5238 . 0.129 . . 0.129 . . . . . 0.133 . 20 . 0.989 0.991 0.125 'X-RAY DIFFRACTION' 4.147 5.050 453 . 18 421 96.9095 . 0.141 . . 0.141 . . . . . 0.139 . 20 . 0.987 0.990 0.133 'X-RAY DIFFRACTION' 5.050 7.024 370 . 15 328 92.7027 . 0.187 . . 0.184 . . . . . 0.186 . 20 . 0.977 0.966 0.252 'X-RAY DIFFRACTION' 7.024 27.442 238 . 8 199 86.9748 . 0.185 . . 0.184 . . . . . 0.201 . 20 . 0.974 0.969 0.229 # _struct.entry_id 8PX2 _struct.title ;C-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1,3-dimethyl-5-(1-((tetrahydro-2H-pyran-4-yl)methyl)-1H-benzo[d]imidazol-2-yl)pyridin-2(1H)-one ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8PX2 _struct_keywords.text 'Bromodomain inhibitor, complex, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD2_HUMAN _struct_ref.pdbx_db_accession P25440 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFS NCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _struct_ref.pdbx_align_begin 344 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8PX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25440 _struct_ref_seq.db_align_beg 344 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 455 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 344 _struct_ref_seq.pdbx_auth_seq_align_end 455 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8PX2 GLY A 1 ? UNP P25440 ? ? 'expression tag' 341 1 1 8PX2 SER A 2 ? UNP P25440 ? ? 'expression tag' 342 2 1 8PX2 MET A 3 ? UNP P25440 ? ? 'expression tag' 343 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 190 ? 1 MORE 2 ? 1 'SSA (A^2)' 7060 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 7 ? LEU A 21 ? SER A 347 LEU A 361 1 ? 15 HELX_P HELX_P2 AA2 SER A 22 ? LYS A 24 ? SER A 362 LYS A 364 5 ? 3 HELX_P HELX_P3 AA3 HIS A 25 ? TRP A 30 ? HIS A 365 TRP A 370 1 ? 6 HELX_P HELX_P4 AA4 PRO A 31 ? TYR A 33 ? PRO A 371 TYR A 373 5 ? 3 HELX_P HELX_P5 AA5 ASP A 37 ? GLY A 42 ? ASP A 377 GLY A 382 1 ? 6 HELX_P HELX_P6 AA6 ASP A 45 ? ILE A 50 ? ASP A 385 ILE A 390 1 ? 6 HELX_P HELX_P7 AA7 ASP A 55 ? ASN A 65 ? ASP A 395 ASN A 405 1 ? 11 HELX_P HELX_P8 AA8 ASP A 70 ? ASN A 89 ? ASP A 410 ASN A 429 1 ? 20 HELX_P HELX_P9 AA9 HIS A 93 ? ALA A 111 ? HIS A 433 ALA A 451 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 743 ? ? 1_555 O A HOH 743 ? ? 2_655 2.08 2 1 O A HOH 786 ? ? 1_555 O A HOH 786 ? ? 2_655 2.13 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 32.7197 _pdbx_refine_tls.origin_y 10.3691 _pdbx_refine_tls.origin_z 0.6484 _pdbx_refine_tls.T[1][1] 0.0079 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0049 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0026 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0032 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0010 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0032 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.8851 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.1477 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.1319 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.1720 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0212 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.1026 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0140 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.0130 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0085 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0062 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0025 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0062 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0173 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0077 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0166 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 343 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 455 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # _pdbx_entry_details.entry_id 8PX2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 850 ? 6.50 . 2 1 O ? A HOH 851 ? 6.50 . 3 1 O ? A HOH 852 ? . 6.50 4 1 O ? A HOH 853 ? 6.50 . 5 1 O ? A HOH 854 ? 6.65 . 6 1 O ? A HOH 855 ? 7.01 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 341 ? A GLY 1 2 1 Y 1 A SER 342 ? A SER 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MES O1 O N N 230 MES C2 C N N 231 MES C3 C N N 232 MES N4 N N N 233 MES C5 C N N 234 MES C6 C N N 235 MES C7 C N N 236 MES C8 C N N 237 MES S S N N 238 MES O1S O N N 239 MES O2S O N N 240 MES O3S O N N 241 MES H21 H N N 242 MES H22 H N N 243 MES H31 H N N 244 MES H32 H N N 245 MES HN4 H N N 246 MES H51 H N N 247 MES H52 H N N 248 MES H61 H N N 249 MES H62 H N N 250 MES H71 H N N 251 MES H72 H N N 252 MES H81 H N N 253 MES H82 H N N 254 MET N N N N 255 MET CA C N S 256 MET C C N N 257 MET O O N N 258 MET CB C N N 259 MET CG C N N 260 MET SD S N N 261 MET CE C N N 262 MET OXT O N N 263 MET H H N N 264 MET H2 H N N 265 MET HA H N N 266 MET HB2 H N N 267 MET HB3 H N N 268 MET HG2 H N N 269 MET HG3 H N N 270 MET HE1 H N N 271 MET HE2 H N N 272 MET HE3 H N N 273 MET HXT H N N 274 NUB C20 C Y N 275 NUB C21 C Y N 276 NUB C01 C N N 277 NUB C05 C N N 278 NUB C06 C N N 279 NUB C08 C N N 280 NUB C09 C N N 281 NUB N11 N N N 282 NUB C12 C N N 283 NUB C16 C N N 284 NUB O17 O N N 285 NUB C18 C Y N 286 NUB N19 N Y N 287 NUB C23 C Y N 288 NUB C25 C Y N 289 NUB C27 C Y N 290 NUB C29 C Y N 291 NUB N30 N Y N 292 NUB C31 C N N 293 NUB C34 C N N 294 NUB C36 C N N 295 NUB C39 C N N 296 NUB O42 O N N 297 NUB C43 C N N 298 NUB C46 C N N 299 NUB H1 H N N 300 NUB H2 H N N 301 NUB H3 H N N 302 NUB H4 H N N 303 NUB H5 H N N 304 NUB H6 H N N 305 NUB H7 H N N 306 NUB H8 H N N 307 NUB H9 H N N 308 NUB H10 H N N 309 NUB H11 H N N 310 NUB H12 H N N 311 NUB H13 H N N 312 NUB H14 H N N 313 NUB H15 H N N 314 NUB H16 H N N 315 NUB H17 H N N 316 NUB H18 H N N 317 NUB H19 H N N 318 NUB H20 H N N 319 NUB H21 H N N 320 NUB H22 H N N 321 NUB H23 H N N 322 PHE N N N N 323 PHE CA C N S 324 PHE C C N N 325 PHE O O N N 326 PHE CB C N N 327 PHE CG C Y N 328 PHE CD1 C Y N 329 PHE CD2 C Y N 330 PHE CE1 C Y N 331 PHE CE2 C Y N 332 PHE CZ C Y N 333 PHE OXT O N N 334 PHE H H N N 335 PHE H2 H N N 336 PHE HA H N N 337 PHE HB2 H N N 338 PHE HB3 H N N 339 PHE HD1 H N N 340 PHE HD2 H N N 341 PHE HE1 H N N 342 PHE HE2 H N N 343 PHE HZ H N N 344 PHE HXT H N N 345 PRO N N N N 346 PRO CA C N S 347 PRO C C N N 348 PRO O O N N 349 PRO CB C N N 350 PRO CG C N N 351 PRO CD C N N 352 PRO OXT O N N 353 PRO H H N N 354 PRO HA H N N 355 PRO HB2 H N N 356 PRO HB3 H N N 357 PRO HG2 H N N 358 PRO HG3 H N N 359 PRO HD2 H N N 360 PRO HD3 H N N 361 PRO HXT H N N 362 SER N N N N 363 SER CA C N S 364 SER C C N N 365 SER O O N N 366 SER CB C N N 367 SER OG O N N 368 SER OXT O N N 369 SER H H N N 370 SER H2 H N N 371 SER HA H N N 372 SER HB2 H N N 373 SER HB3 H N N 374 SER HG H N N 375 SER HXT H N N 376 THR N N N N 377 THR CA C N S 378 THR C C N N 379 THR O O N N 380 THR CB C N R 381 THR OG1 O N N 382 THR CG2 C N N 383 THR OXT O N N 384 THR H H N N 385 THR H2 H N N 386 THR HA H N N 387 THR HB H N N 388 THR HG1 H N N 389 THR HG21 H N N 390 THR HG22 H N N 391 THR HG23 H N N 392 THR HXT H N N 393 TRP N N N N 394 TRP CA C N S 395 TRP C C N N 396 TRP O O N N 397 TRP CB C N N 398 TRP CG C Y N 399 TRP CD1 C Y N 400 TRP CD2 C Y N 401 TRP NE1 N Y N 402 TRP CE2 C Y N 403 TRP CE3 C Y N 404 TRP CZ2 C Y N 405 TRP CZ3 C Y N 406 TRP CH2 C Y N 407 TRP OXT O N N 408 TRP H H N N 409 TRP H2 H N N 410 TRP HA H N N 411 TRP HB2 H N N 412 TRP HB3 H N N 413 TRP HD1 H N N 414 TRP HE1 H N N 415 TRP HE3 H N N 416 TRP HZ2 H N N 417 TRP HZ3 H N N 418 TRP HH2 H N N 419 TRP HXT H N N 420 TYR N N N N 421 TYR CA C N S 422 TYR C C N N 423 TYR O O N N 424 TYR CB C N N 425 TYR CG C Y N 426 TYR CD1 C Y N 427 TYR CD2 C Y N 428 TYR CE1 C Y N 429 TYR CE2 C Y N 430 TYR CZ C Y N 431 TYR OH O N N 432 TYR OXT O N N 433 TYR H H N N 434 TYR H2 H N N 435 TYR HA H N N 436 TYR HB2 H N N 437 TYR HB3 H N N 438 TYR HD1 H N N 439 TYR HD2 H N N 440 TYR HE1 H N N 441 TYR HE2 H N N 442 TYR HH H N N 443 TYR HXT H N N 444 VAL N N N N 445 VAL CA C N S 446 VAL C C N N 447 VAL O O N N 448 VAL CB C N N 449 VAL CG1 C N N 450 VAL CG2 C N N 451 VAL OXT O N N 452 VAL H H N N 453 VAL H2 H N N 454 VAL HA H N N 455 VAL HB H N N 456 VAL HG11 H N N 457 VAL HG12 H N N 458 VAL HG13 H N N 459 VAL HG21 H N N 460 VAL HG22 H N N 461 VAL HG23 H N N 462 VAL HXT H N N 463 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MES O1 C2 sing N N 218 MES O1 C6 sing N N 219 MES C2 C3 sing N N 220 MES C2 H21 sing N N 221 MES C2 H22 sing N N 222 MES C3 N4 sing N N 223 MES C3 H31 sing N N 224 MES C3 H32 sing N N 225 MES N4 C5 sing N N 226 MES N4 C7 sing N N 227 MES N4 HN4 sing N N 228 MES C5 C6 sing N N 229 MES C5 H51 sing N N 230 MES C5 H52 sing N N 231 MES C6 H61 sing N N 232 MES C6 H62 sing N N 233 MES C7 C8 sing N N 234 MES C7 H71 sing N N 235 MES C7 H72 sing N N 236 MES C8 S sing N N 237 MES C8 H81 sing N N 238 MES C8 H82 sing N N 239 MES S O1S doub N N 240 MES S O2S doub N N 241 MES S O3S sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 NUB C43 O42 sing N N 262 NUB C43 C46 sing N N 263 NUB O42 C39 sing N N 264 NUB C46 C34 sing N N 265 NUB C39 C36 sing N N 266 NUB C34 C36 sing N N 267 NUB C34 C31 sing N N 268 NUB C31 N30 sing N N 269 NUB C27 C25 doub Y N 270 NUB C27 C29 sing Y N 271 NUB N30 C29 sing Y N 272 NUB N30 C18 sing Y N 273 NUB C01 C05 sing N N 274 NUB C25 C23 sing Y N 275 NUB C29 C20 doub Y N 276 NUB C06 C05 doub N N 277 NUB C06 C08 sing N N 278 NUB C05 C16 sing N N 279 NUB C18 C08 sing N N 280 NUB C18 N19 doub Y N 281 NUB C08 C09 doub N N 282 NUB C16 O17 doub N N 283 NUB C16 N11 sing N N 284 NUB C23 C21 doub Y N 285 NUB C20 N19 sing Y N 286 NUB C20 C21 sing Y N 287 NUB C09 N11 sing N N 288 NUB N11 C12 sing N N 289 NUB C21 H1 sing N N 290 NUB C01 H2 sing N N 291 NUB C01 H3 sing N N 292 NUB C01 H4 sing N N 293 NUB C06 H5 sing N N 294 NUB C09 H6 sing N N 295 NUB C12 H7 sing N N 296 NUB C12 H8 sing N N 297 NUB C12 H9 sing N N 298 NUB C23 H10 sing N N 299 NUB C25 H11 sing N N 300 NUB C27 H12 sing N N 301 NUB C31 H13 sing N N 302 NUB C31 H14 sing N N 303 NUB C34 H15 sing N N 304 NUB C36 H16 sing N N 305 NUB C36 H17 sing N N 306 NUB C39 H18 sing N N 307 NUB C39 H19 sing N N 308 NUB C43 H20 sing N N 309 NUB C43 H21 sing N N 310 NUB C46 H22 sing N N 311 NUB C46 H23 sing N N 312 PHE N CA sing N N 313 PHE N H sing N N 314 PHE N H2 sing N N 315 PHE CA C sing N N 316 PHE CA CB sing N N 317 PHE CA HA sing N N 318 PHE C O doub N N 319 PHE C OXT sing N N 320 PHE CB CG sing N N 321 PHE CB HB2 sing N N 322 PHE CB HB3 sing N N 323 PHE CG CD1 doub Y N 324 PHE CG CD2 sing Y N 325 PHE CD1 CE1 sing Y N 326 PHE CD1 HD1 sing N N 327 PHE CD2 CE2 doub Y N 328 PHE CD2 HD2 sing N N 329 PHE CE1 CZ doub Y N 330 PHE CE1 HE1 sing N N 331 PHE CE2 CZ sing Y N 332 PHE CE2 HE2 sing N N 333 PHE CZ HZ sing N N 334 PHE OXT HXT sing N N 335 PRO N CA sing N N 336 PRO N CD sing N N 337 PRO N H sing N N 338 PRO CA C sing N N 339 PRO CA CB sing N N 340 PRO CA HA sing N N 341 PRO C O doub N N 342 PRO C OXT sing N N 343 PRO CB CG sing N N 344 PRO CB HB2 sing N N 345 PRO CB HB3 sing N N 346 PRO CG CD sing N N 347 PRO CG HG2 sing N N 348 PRO CG HG3 sing N N 349 PRO CD HD2 sing N N 350 PRO CD HD3 sing N N 351 PRO OXT HXT sing N N 352 SER N CA sing N N 353 SER N H sing N N 354 SER N H2 sing N N 355 SER CA C sing N N 356 SER CA CB sing N N 357 SER CA HA sing N N 358 SER C O doub N N 359 SER C OXT sing N N 360 SER CB OG sing N N 361 SER CB HB2 sing N N 362 SER CB HB3 sing N N 363 SER OG HG sing N N 364 SER OXT HXT sing N N 365 THR N CA sing N N 366 THR N H sing N N 367 THR N H2 sing N N 368 THR CA C sing N N 369 THR CA CB sing N N 370 THR CA HA sing N N 371 THR C O doub N N 372 THR C OXT sing N N 373 THR CB OG1 sing N N 374 THR CB CG2 sing N N 375 THR CB HB sing N N 376 THR OG1 HG1 sing N N 377 THR CG2 HG21 sing N N 378 THR CG2 HG22 sing N N 379 THR CG2 HG23 sing N N 380 THR OXT HXT sing N N 381 TRP N CA sing N N 382 TRP N H sing N N 383 TRP N H2 sing N N 384 TRP CA C sing N N 385 TRP CA CB sing N N 386 TRP CA HA sing N N 387 TRP C O doub N N 388 TRP C OXT sing N N 389 TRP CB CG sing N N 390 TRP CB HB2 sing N N 391 TRP CB HB3 sing N N 392 TRP CG CD1 doub Y N 393 TRP CG CD2 sing Y N 394 TRP CD1 NE1 sing Y N 395 TRP CD1 HD1 sing N N 396 TRP CD2 CE2 doub Y N 397 TRP CD2 CE3 sing Y N 398 TRP NE1 CE2 sing Y N 399 TRP NE1 HE1 sing N N 400 TRP CE2 CZ2 sing Y N 401 TRP CE3 CZ3 doub Y N 402 TRP CE3 HE3 sing N N 403 TRP CZ2 CH2 doub Y N 404 TRP CZ2 HZ2 sing N N 405 TRP CZ3 CH2 sing Y N 406 TRP CZ3 HZ3 sing N N 407 TRP CH2 HH2 sing N N 408 TRP OXT HXT sing N N 409 TYR N CA sing N N 410 TYR N H sing N N 411 TYR N H2 sing N N 412 TYR CA C sing N N 413 TYR CA CB sing N N 414 TYR CA HA sing N N 415 TYR C O doub N N 416 TYR C OXT sing N N 417 TYR CB CG sing N N 418 TYR CB HB2 sing N N 419 TYR CB HB3 sing N N 420 TYR CG CD1 doub Y N 421 TYR CG CD2 sing Y N 422 TYR CD1 CE1 sing Y N 423 TYR CD1 HD1 sing N N 424 TYR CD2 CE2 doub Y N 425 TYR CD2 HD2 sing N N 426 TYR CE1 CZ doub Y N 427 TYR CE1 HE1 sing N N 428 TYR CE2 CZ sing Y N 429 TYR CE2 HE2 sing N N 430 TYR CZ OH sing N N 431 TYR OH HH sing N N 432 TYR OXT HXT sing N N 433 VAL N CA sing N N 434 VAL N H sing N N 435 VAL N H2 sing N N 436 VAL CA C sing N N 437 VAL CA CB sing N N 438 VAL CA HA sing N N 439 VAL C O doub N N 440 VAL C OXT sing N N 441 VAL CB CG1 sing N N 442 VAL CB CG2 sing N N 443 VAL CB HB sing N N 444 VAL CG1 HG11 sing N N 445 VAL CG1 HG12 sing N N 446 VAL CG1 HG13 sing N N 447 VAL CG2 HG21 sing N N 448 VAL CG2 HG22 sing N N 449 VAL CG2 HG23 sing N N 450 VAL OXT HXT sing N N 451 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NUB _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NUB _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'in house structure' # _atom_sites.entry_id 8PX2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013899 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031095 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_