data_8QNT # _entry.id 8QNT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8QNT pdb_00008qnt 10.2210/pdb8qnt/pdb WWPDB D_1292133610 ? ? BMRB 34865 ? 10.13018/BMR34865 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-02-21 2 'Structure model' 1 1 2024-02-28 3 'Structure model' 1 2 2024-03-06 4 'Structure model' 2 0 2024-03-27 5 'Structure model' 2 1 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' atom_site 6 4 'Structure model' entity_name_com 7 4 'Structure model' pdbx_nmr_representative 8 4 'Structure model' pdbx_validate_torsion 9 4 'Structure model' struct_conf 10 5 'Structure model' database_2 11 5 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_last' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_citation_author.name' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.title' 7 3 'Structure model' '_citation_author.name' 8 4 'Structure model' '_atom_site.B_iso_or_equiv' 9 4 'Structure model' '_atom_site.Cartn_x' 10 4 'Structure model' '_atom_site.Cartn_y' 11 4 'Structure model' '_atom_site.Cartn_z' 12 4 'Structure model' '_pdbx_nmr_representative.conformer_id' 13 4 'Structure model' '_pdbx_validate_torsion.PDB_model_num' 14 4 'Structure model' '_pdbx_validate_torsion.auth_comp_id' 15 4 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 16 4 'Structure model' '_pdbx_validate_torsion.phi' 17 4 'Structure model' '_pdbx_validate_torsion.psi' 18 5 'Structure model' '_database_2.pdbx_DOI' 19 5 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 20 5 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8QNT _pdbx_database_status.recvd_initial_deposition_date 2023-09-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Folded alpha helical de novo proteins from Apilactobacillus kunkeei' _pdbx_database_related.db_id 34865 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chi.celestine@imbim.uu.se _pdbx_contact_author.name_first Chi _pdbx_contact_author.name_last Celestine _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4154-2378 # _audit_author.name 'Celestine, C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 436 _citation.language ? _citation.page_first 168490 _citation.page_last 168490 _citation.title 'Folded Alpha Helical Putative New Proteins from Apilactobacillus kunkeei.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2024.168490 _citation.pdbx_database_id_PubMed 38355092 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ye, W.' 1 ? primary 'Krishna Behra, P.R.' 2 ? primary 'Dyrhage, K.' 3 ? primary 'Seeger, C.' 4 ? primary 'Joiner, J.D.' 5 ? primary 'Karlsson, E.' 6 ? primary 'Andersson, E.' 7 ? primary 'Chi, C.N.' 8 ? primary 'Andersson, S.G.E.' 9 ? primary 'Jemth, P.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Transposase _entity.formula_weight 5860.950 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMKNYQPNKDLLEILESQKIKIKNLKEEVKILQRKIDQQIAKERVIKQ _entity_poly.pdbx_seq_one_letter_code_can GSMKNYQPNKDLLEILESQKIKIKNLKEEVKILQRKIDQQIAKERVIKQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 ASN n 1 6 TYR n 1 7 GLN n 1 8 PRO n 1 9 ASN n 1 10 LYS n 1 11 ASP n 1 12 LEU n 1 13 LEU n 1 14 GLU n 1 15 ILE n 1 16 LEU n 1 17 GLU n 1 18 SER n 1 19 GLN n 1 20 LYS n 1 21 ILE n 1 22 LYS n 1 23 ILE n 1 24 LYS n 1 25 ASN n 1 26 LEU n 1 27 LYS n 1 28 GLU n 1 29 GLU n 1 30 VAL n 1 31 LYS n 1 32 ILE n 1 33 LEU n 1 34 GLN n 1 35 ARG n 1 36 LYS n 1 37 ILE n 1 38 ASP n 1 39 GLN n 1 40 GLN n 1 41 ILE n 1 42 ALA n 1 43 LYS n 1 44 GLU n 1 45 ARG n 1 46 VAL n 1 47 ILE n 1 48 LYS n 1 49 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 49 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FF306_00177 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Apilactobacillus kunkeei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 148814 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLN 49 49 49 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8QNT _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8QNT _struct.title 'Folded alpha helical de novo proteins from Apilactobacillus kunkeei' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8QNT _struct_keywords.text 'proteins from Apilactobacillus kunkeei, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1L8CFW4_9LACO _struct_ref.pdbx_db_accession A0A1L8CFW4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKNYQPNKDLLEILESQKIKIKNLKEEVKILQRKLDQQIAKEGMIKQ _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8QNT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1L8CFW4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 47 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 49 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8QNT GLY A 1 ? UNP A0A1L8CFW4 ? ? 'expression tag' 1 1 1 8QNT SER A 2 ? UNP A0A1L8CFW4 ? ? 'expression tag' 2 2 1 8QNT ILE A 37 ? UNP A0A1L8CFW4 LEU 35 conflict 37 3 1 8QNT ARG A 45 ? UNP A0A1L8CFW4 GLY 43 conflict 45 4 1 8QNT VAL A 46 ? UNP A0A1L8CFW4 MET 44 conflict 46 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 9 ? GLN A 39 ? ASN A 9 GLN A 39 1 ? 31 HELX_P HELX_P2 AA2 ILE A 41 ? VAL A 46 ? ILE A 41 VAL A 46 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 7 ? ? -46.69 162.28 2 1 PRO A 8 ? ? -69.76 72.54 3 1 ILE A 41 ? ? -137.13 -38.25 4 2 GLN A 7 ? ? -44.87 158.68 5 2 PRO A 8 ? ? -69.77 71.88 6 2 ILE A 41 ? ? -141.97 -33.05 7 3 TYR A 6 ? ? -104.84 -69.08 8 3 PRO A 8 ? ? -69.70 71.52 9 3 ILE A 41 ? ? -143.16 -32.74 10 4 SER A 2 ? ? -136.60 -45.22 11 4 GLN A 7 ? ? 62.96 160.64 12 4 PRO A 8 ? ? -69.80 74.84 13 4 ILE A 41 ? ? -139.73 -36.41 14 5 TYR A 6 ? ? -100.13 -68.28 15 5 PRO A 8 ? ? -69.76 71.65 16 5 ILE A 41 ? ? -139.16 -36.72 17 5 LYS A 48 ? ? -179.27 106.07 18 6 GLN A 7 ? ? 63.45 160.48 19 6 PRO A 8 ? ? -69.76 68.06 20 6 ILE A 41 ? ? -143.22 -32.38 21 6 LYS A 48 ? ? -163.88 105.82 22 7 PRO A 8 ? ? -69.72 68.55 23 7 ILE A 41 ? ? -138.91 -36.21 24 7 LYS A 48 ? ? -160.82 106.03 25 8 GLN A 7 ? ? 63.51 160.96 26 8 PRO A 8 ? ? -69.76 74.18 27 8 ILE A 41 ? ? -138.63 -35.55 28 8 ARG A 45 ? ? -176.54 119.76 29 9 PRO A 8 ? ? -69.79 63.97 30 9 ASN A 9 ? ? 39.74 49.50 31 9 ILE A 41 ? ? -137.90 -38.41 32 10 SER A 2 ? ? -136.92 -65.74 33 10 PRO A 8 ? ? -69.74 69.86 34 10 ILE A 41 ? ? -138.22 -37.44 35 10 LYS A 48 ? ? -179.33 106.14 36 11 GLN A 7 ? ? 64.22 154.54 37 11 PRO A 8 ? ? -69.78 72.37 38 11 ILE A 41 ? ? -142.47 -31.15 39 11 GLU A 44 ? ? -57.30 -74.37 40 11 ARG A 45 ? ? -146.93 32.99 41 11 LYS A 48 ? ? -177.34 122.82 42 12 SER A 2 ? ? -104.87 -63.24 43 12 PRO A 8 ? ? -69.73 69.61 44 12 ILE A 41 ? ? -138.31 -37.31 45 13 GLN A 7 ? ? 63.35 160.70 46 13 PRO A 8 ? ? -69.74 71.23 47 13 ILE A 41 ? ? -139.98 -35.92 48 14 PRO A 8 ? ? -69.81 64.93 49 14 ILE A 41 ? ? -139.75 -35.88 50 15 SER A 2 ? ? -104.81 66.93 51 15 GLN A 7 ? ? 65.67 136.94 52 15 PRO A 8 ? ? -69.72 70.23 53 15 ILE A 41 ? ? -165.57 -35.36 54 16 GLN A 7 ? ? -46.79 162.55 55 16 PRO A 8 ? ? -69.73 75.79 56 16 ILE A 41 ? ? -142.46 -34.59 57 16 GLU A 44 ? ? -81.30 -72.33 58 17 GLN A 7 ? ? -46.54 162.12 59 17 PRO A 8 ? ? -69.75 73.35 60 17 ILE A 41 ? ? -138.44 -37.10 61 17 LYS A 48 ? ? -173.75 115.30 62 18 ASN A 5 ? ? -102.58 -169.90 63 18 GLN A 7 ? ? 62.96 158.39 64 18 PRO A 8 ? ? -69.75 65.90 65 18 ASN A 9 ? ? -90.08 34.88 66 18 ILE A 41 ? ? -139.61 -35.96 67 19 GLN A 7 ? ? 64.38 153.28 68 19 PRO A 8 ? ? -69.73 76.28 69 19 ILE A 41 ? ? -138.93 -35.40 70 19 GLU A 44 ? ? -57.14 -74.27 71 19 LYS A 48 ? ? -175.40 126.34 72 20 GLN A 7 ? ? 64.43 153.68 73 20 PRO A 8 ? ? -69.74 73.69 74 20 ILE A 41 ? ? -138.30 -37.04 # _pdbx_nmr_ensemble.entry_id 8QNT _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8QNT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '500 uM [U-99% 13C; U-99% 15N] Orphan7, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N, 13C sample' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '50 mM sodium phosphate pH 6.5' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component Orphan7 _pdbx_nmr_exptl_sample.concentration 500 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HN(COCA)CB' 1 isotropic 5 1 1 '3D 1H-15N TOCSY' 1 isotropic 6 1 1 '3D 1H-13C NOESY' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 8QNT _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' TopSpin ? 'Bruker Biospin' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 4 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PRO N N N N 212 PRO CA C N S 213 PRO C C N N 214 PRO O O N N 215 PRO CB C N N 216 PRO CG C N N 217 PRO CD C N N 218 PRO OXT O N N 219 PRO H H N N 220 PRO HA H N N 221 PRO HB2 H N N 222 PRO HB3 H N N 223 PRO HG2 H N N 224 PRO HG3 H N N 225 PRO HD2 H N N 226 PRO HD3 H N N 227 PRO HXT H N N 228 SER N N N N 229 SER CA C N S 230 SER C C N N 231 SER O O N N 232 SER CB C N N 233 SER OG O N N 234 SER OXT O N N 235 SER H H N N 236 SER H2 H N N 237 SER HA H N N 238 SER HB2 H N N 239 SER HB3 H N N 240 SER HG H N N 241 SER HXT H N N 242 TYR N N N N 243 TYR CA C N S 244 TYR C C N N 245 TYR O O N N 246 TYR CB C N N 247 TYR CG C Y N 248 TYR CD1 C Y N 249 TYR CD2 C Y N 250 TYR CE1 C Y N 251 TYR CE2 C Y N 252 TYR CZ C Y N 253 TYR OH O N N 254 TYR OXT O N N 255 TYR H H N N 256 TYR H2 H N N 257 TYR HA H N N 258 TYR HB2 H N N 259 TYR HB3 H N N 260 TYR HD1 H N N 261 TYR HD2 H N N 262 TYR HE1 H N N 263 TYR HE2 H N N 264 TYR HH H N N 265 TYR HXT H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PRO N CA sing N N 201 PRO N CD sing N N 202 PRO N H sing N N 203 PRO CA C sing N N 204 PRO CA CB sing N N 205 PRO CA HA sing N N 206 PRO C O doub N N 207 PRO C OXT sing N N 208 PRO CB CG sing N N 209 PRO CB HB2 sing N N 210 PRO CB HB3 sing N N 211 PRO CG CD sing N N 212 PRO CG HG2 sing N N 213 PRO CG HG3 sing N N 214 PRO CD HD2 sing N N 215 PRO CD HD3 sing N N 216 PRO OXT HXT sing N N 217 SER N CA sing N N 218 SER N H sing N N 219 SER N H2 sing N N 220 SER CA C sing N N 221 SER CA CB sing N N 222 SER CA HA sing N N 223 SER C O doub N N 224 SER C OXT sing N N 225 SER CB OG sing N N 226 SER CB HB2 sing N N 227 SER CB HB3 sing N N 228 SER OG HG sing N N 229 SER OXT HXT sing N N 230 TYR N CA sing N N 231 TYR N H sing N N 232 TYR N H2 sing N N 233 TYR CA C sing N N 234 TYR CA CB sing N N 235 TYR CA HA sing N N 236 TYR C O doub N N 237 TYR C OXT sing N N 238 TYR CB CG sing N N 239 TYR CB HB2 sing N N 240 TYR CB HB3 sing N N 241 TYR CG CD1 doub Y N 242 TYR CG CD2 sing Y N 243 TYR CD1 CE1 sing Y N 244 TYR CD1 HD1 sing N N 245 TYR CD2 CE2 doub Y N 246 TYR CD2 HD2 sing N N 247 TYR CE1 CZ doub Y N 248 TYR CE1 HE1 sing N N 249 TYR CE2 CZ sing Y N 250 TYR CE2 HE2 sing N N 251 TYR CZ OH sing N N 252 TYR OH HH sing N N 253 TYR OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # _pdbx_audit_support.funding_organization 'Swedish Research Council' _pdbx_audit_support.country Sweden _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8QNT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_