data_8QPY # _entry.id 8QPY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8QPY pdb_00008qpy 10.2210/pdb8qpy/pdb WWPDB D_1292133510 ? ? BMRB 34868 ? 10.13018/BMR34868 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-06-26 2 'Structure model' 1 1 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8QPY _pdbx_database_status.recvd_initial_deposition_date 2023-10-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase' _pdbx_database_related.db_id 34868 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email t.carlomagno@bham.ac.uk _pdbx_contact_author.name_first Teresa _pdbx_contact_author.name_last Carlomagno _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2437-2760 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Karanth, M.N.' 1 0000-0003-3392-6523 'Kirkpatrick, J.P.' 2 0000-0002-9761-3377 'Carlomagno, T.' 3 0000-0002-2437-2760 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first eadm9404 _citation.page_last eadm9404 _citation.title 'The specificity of intermodular recognition in a prototypical nonribosomal peptide synthetase depends on an adaptor domain.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.adm9404 _citation.pdbx_database_id_PubMed 38896613 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karanth, M.N.' 1 0000-0003-3392-6523 primary 'Kirkpatrick, J.P.' 2 0000-0002-9761-3377 primary 'Krausze, J.' 3 0000-0001-5333-8046 primary 'Schmelz, S.' 4 0000-0002-2511-7593 primary 'Scrima, A.' 5 0000-0003-2760-611X primary 'Carlomagno, T.' 6 0000-0002-2437-2760 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Carrier protein TomAPCP' _entity.formula_weight 10380.378 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ;First four residues (GPMA) in the protein are from cloning artifacts. Therefore, the appropriate residue numbering has the first residue (G) designated as residue-number '-3', so that the fifth residue has residue-number '1'. A special modified residue SPP is designated for the serine residue covalently linked to a 4'-phosphopantetheine prosthetic group. ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGN(4HH)LHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARF VEQSRDTGRNPAAQTQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGNXLHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARFVEQS RDTGRNPAAQTQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ALA n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 GLN n 1 9 ASN n 1 10 PRO n 1 11 LEU n 1 12 GLU n 1 13 THR n 1 14 VAL n 1 15 VAL n 1 16 LEU n 1 17 GLN n 1 18 ALA n 1 19 TRP n 1 20 LYS n 1 21 ASP n 1 22 ILE n 1 23 SER n 1 24 GLY n 1 25 ALA n 1 26 ASP n 1 27 ASP n 1 28 PHE n 1 29 THR n 1 30 THR n 1 31 THR n 1 32 ASP n 1 33 SER n 1 34 PHE n 1 35 LEU n 1 36 GLY n 1 37 HIS n 1 38 GLY n 1 39 GLY n 1 40 ASN n 1 41 4HH n 1 42 LEU n 1 43 HIS n 1 44 PHE n 1 45 VAL n 1 46 GLN n 1 47 LEU n 1 48 ALA n 1 49 SER n 1 50 ARG n 1 51 LEU n 1 52 GLN n 1 53 LYS n 1 54 ILE n 1 55 PHE n 1 56 GLY n 1 57 VAL n 1 58 GLU n 1 59 VAL n 1 60 SER n 1 61 THR n 1 62 GLU n 1 63 ASP n 1 64 VAL n 1 65 PHE n 1 66 ARG n 1 67 HIS n 1 68 GLY n 1 69 THR n 1 70 VAL n 1 71 GLU n 1 72 GLN n 1 73 LEU n 1 74 ALA n 1 75 ARG n 1 76 PHE n 1 77 VAL n 1 78 GLU n 1 79 GLN n 1 80 SER n 1 81 ARG n 1 82 ASP n 1 83 THR n 1 84 GLY n 1 85 ARG n 1 86 ASN n 1 87 PRO n 1 88 ALA n 1 89 ALA n 1 90 GLN n 1 91 THR n 1 92 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 92 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces regensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 68263 _entity_src_gen.pdbx_gene_src_variant FH6421 _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4HH 'L-peptide linking' n "4'-phosphopanthetheine-serine" 'O-[(S)-hydroxy{[(3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl]oxy}phosphoryl]-L-serine' 'C14 H28 N3 O9 P S' 445.426 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 PRO 2 -2 -2 PRO PRO A . n A 1 3 MET 3 -1 -1 MET MET A . n A 1 4 ALA 4 0 0 ALA ALA A . n A 1 5 THR 5 1 1 THR THR A . n A 1 6 ALA 6 2 2 ALA ALA A . n A 1 7 VAL 7 3 3 VAL VAL A . n A 1 8 GLN 8 4 4 GLN GLN A . n A 1 9 ASN 9 5 5 ASN ASN A . n A 1 10 PRO 10 6 6 PRO PRO A . n A 1 11 LEU 11 7 7 LEU LEU A . n A 1 12 GLU 12 8 8 GLU GLU A . n A 1 13 THR 13 9 9 THR THR A . n A 1 14 VAL 14 10 10 VAL VAL A . n A 1 15 VAL 15 11 11 VAL VAL A . n A 1 16 LEU 16 12 12 LEU LEU A . n A 1 17 GLN 17 13 13 GLN GLN A . n A 1 18 ALA 18 14 14 ALA ALA A . n A 1 19 TRP 19 15 15 TRP TRP A . n A 1 20 LYS 20 16 16 LYS LYS A . n A 1 21 ASP 21 17 17 ASP ASP A . n A 1 22 ILE 22 18 18 ILE ILE A . n A 1 23 SER 23 19 19 SER SER A . n A 1 24 GLY 24 20 20 GLY GLY A . n A 1 25 ALA 25 21 21 ALA ALA A . n A 1 26 ASP 26 22 22 ASP ASP A . n A 1 27 ASP 27 23 23 ASP ASP A . n A 1 28 PHE 28 24 24 PHE PHE A . n A 1 29 THR 29 25 25 THR THR A . n A 1 30 THR 30 26 26 THR THR A . n A 1 31 THR 31 27 27 THR THR A . n A 1 32 ASP 32 28 28 ASP ASP A . n A 1 33 SER 33 29 29 SER SER A . n A 1 34 PHE 34 30 30 PHE PHE A . n A 1 35 LEU 35 31 31 LEU LEU A . n A 1 36 GLY 36 32 32 GLY GLY A . n A 1 37 HIS 37 33 33 HIS HIS A . n A 1 38 GLY 38 34 34 GLY GLY A . n A 1 39 GLY 39 35 35 GLY GLY A . n A 1 40 ASN 40 36 36 ASN ASN A . n A 1 41 4HH 41 37 37 4HH SPP A . n A 1 42 LEU 42 38 38 LEU LEU A . n A 1 43 HIS 43 39 39 HIS HIS A . n A 1 44 PHE 44 40 40 PHE PHE A . n A 1 45 VAL 45 41 41 VAL VAL A . n A 1 46 GLN 46 42 42 GLN GLN A . n A 1 47 LEU 47 43 43 LEU LEU A . n A 1 48 ALA 48 44 44 ALA ALA A . n A 1 49 SER 49 45 45 SER SER A . n A 1 50 ARG 50 46 46 ARG ARG A . n A 1 51 LEU 51 47 47 LEU LEU A . n A 1 52 GLN 52 48 48 GLN GLN A . n A 1 53 LYS 53 49 49 LYS LYS A . n A 1 54 ILE 54 50 50 ILE ILE A . n A 1 55 PHE 55 51 51 PHE PHE A . n A 1 56 GLY 56 52 52 GLY GLY A . n A 1 57 VAL 57 53 53 VAL VAL A . n A 1 58 GLU 58 54 54 GLU GLU A . n A 1 59 VAL 59 55 55 VAL VAL A . n A 1 60 SER 60 56 56 SER SER A . n A 1 61 THR 61 57 57 THR THR A . n A 1 62 GLU 62 58 58 GLU GLU A . n A 1 63 ASP 63 59 59 ASP ASP A . n A 1 64 VAL 64 60 60 VAL VAL A . n A 1 65 PHE 65 61 61 PHE PHE A . n A 1 66 ARG 66 62 62 ARG ARG A . n A 1 67 HIS 67 63 63 HIS HIS A . n A 1 68 GLY 68 64 64 GLY GLY A . n A 1 69 THR 69 65 65 THR THR A . n A 1 70 VAL 70 66 66 VAL VAL A . n A 1 71 GLU 71 67 67 GLU GLU A . n A 1 72 GLN 72 68 68 GLN GLN A . n A 1 73 LEU 73 69 69 LEU LEU A . n A 1 74 ALA 74 70 70 ALA ALA A . n A 1 75 ARG 75 71 71 ARG ARG A . n A 1 76 PHE 76 72 72 PHE PHE A . n A 1 77 VAL 77 73 73 VAL VAL A . n A 1 78 GLU 78 74 74 GLU GLU A . n A 1 79 GLN 79 75 75 GLN GLN A . n A 1 80 SER 80 76 76 SER SER A . n A 1 81 ARG 81 77 77 ARG ARG A . n A 1 82 ASP 82 78 78 ASP ASP A . n A 1 83 THR 83 79 79 THR THR A . n A 1 84 GLY 84 80 80 GLY GLY A . n A 1 85 ARG 85 81 81 ARG ARG A . n A 1 86 ASN 86 82 82 ASN ASN A . n A 1 87 PRO 87 83 83 PRO PRO A . n A 1 88 ALA 88 84 84 ALA ALA A . n A 1 89 ALA 89 85 85 ALA ALA A . n A 1 90 GLN 90 86 86 GLN GLN A . n A 1 91 THR 91 87 87 THR THR A . n A 1 92 GLN 92 88 88 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8QPY _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8QPY _struct.title 'Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8QPY _struct_keywords.text 'Non-ribosomal peptide synthetase, Tomaymycin, PCP, phosphopantetheine, Donor, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8QPY _struct_ref.pdbx_db_accession 8QPY _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8QPY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8QPY _struct_ref_seq.db_align_beg -3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -3 _struct_ref_seq.pdbx_auth_seq_align_end 88 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 10 ? SER A 23 ? PRO A 6 SER A 19 1 ? 14 HELX_P HELX_P2 AA2 LEU A 42 ? PHE A 55 ? LEU A 38 PHE A 51 1 ? 14 HELX_P HELX_P3 AA3 THR A 61 ? HIS A 67 ? THR A 57 HIS A 63 1 ? 7 HELX_P HELX_P4 AA4 VAL A 70 ? SER A 80 ? VAL A 66 SER A 76 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASN 40 C ? ? ? 1_555 A 4HH 41 N ? ? A ASN 36 A 4HH 37 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale2 covale both ? A 4HH 41 C ? ? ? 1_555 A LEU 42 N ? ? A 4HH 37 A LEU 38 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O A LEU 31 ? ? H A HIS 33 ? ? 1.53 2 7 O A PHE 30 ? ? H A GLY 32 ? ? 1.59 3 7 HG1 A THR 25 ? ? OD1 A ASP 28 ? ? 1.60 4 8 O A LEU 31 ? ? H A HIS 33 ? ? 1.56 5 9 O A LEU 31 ? ? H A HIS 33 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 0 ? ? -86.28 -70.66 2 1 ALA A 2 ? ? 66.93 -82.71 3 1 ASP A 23 ? ? -82.14 35.36 4 1 LEU A 31 ? ? -58.47 45.16 5 1 4HH A 37 ? ? -82.80 -143.31 6 1 LEU A 38 ? ? -40.81 -13.94 7 2 VAL A 3 ? ? 67.26 99.03 8 2 ASP A 22 ? ? -149.02 -49.69 9 2 LEU A 31 ? ? -60.50 48.20 10 2 ASN A 36 ? ? -131.55 -35.80 11 2 4HH A 37 ? ? -104.74 -142.73 12 2 LEU A 38 ? ? -38.72 -15.30 13 2 ARG A 81 ? ? -68.48 88.53 14 2 ASN A 82 ? ? 55.52 82.14 15 2 ALA A 84 ? ? -152.64 47.98 16 2 GLN A 86 ? ? 55.93 86.35 17 3 PRO A -2 ? ? -60.43 -71.00 18 3 MET A -1 ? ? -151.88 -39.87 19 3 THR A 1 ? ? 75.98 -63.59 20 3 ASP A 23 ? ? -82.77 40.57 21 3 LEU A 31 ? ? -60.85 47.45 22 3 4HH A 37 ? ? -106.56 -141.39 23 3 LEU A 38 ? ? -40.07 -15.43 24 3 ASN A 82 ? ? -156.10 62.11 25 3 GLN A 86 ? ? -157.06 -56.47 26 4 ALA A 2 ? ? -119.06 59.56 27 4 4HH A 37 ? ? -110.57 -143.51 28 4 LEU A 38 ? ? -41.27 -17.12 29 4 ALA A 84 ? ? -151.46 63.07 30 5 ASP A 22 ? ? -138.25 -54.50 31 5 ASP A 23 ? ? -81.44 41.39 32 5 4HH A 37 ? ? -110.86 -143.64 33 5 LEU A 38 ? ? -40.05 -16.96 34 6 MET A -1 ? ? 64.83 -83.48 35 6 GLN A 4 ? ? 72.78 -52.86 36 6 ASP A 23 ? ? -81.56 40.38 37 6 LEU A 31 ? ? -59.35 48.75 38 6 4HH A 37 ? ? -110.26 -141.22 39 6 LEU A 38 ? ? -37.13 -16.53 40 6 THR A 79 ? ? -103.89 -78.14 41 6 ARG A 81 ? ? -128.69 -156.72 42 6 ALA A 84 ? ? -138.09 -52.76 43 7 ASP A 22 ? ? -113.25 -76.07 44 7 ASP A 23 ? ? -85.94 40.25 45 7 LEU A 31 ? ? -56.70 49.15 46 7 4HH A 37 ? ? -110.04 -143.22 47 7 LEU A 38 ? ? -40.98 -15.73 48 7 ASN A 82 ? ? 55.84 89.75 49 7 ALA A 84 ? ? -153.86 22.36 50 7 GLN A 86 ? ? -170.65 85.20 51 8 PRO A -2 ? ? -91.75 49.07 52 8 THR A 1 ? ? 71.83 75.58 53 8 ALA A 2 ? ? 67.27 135.11 54 8 ASP A 23 ? ? -88.26 38.57 55 8 ASN A 36 ? ? -156.59 -35.02 56 8 4HH A 37 ? ? -98.05 -143.09 57 8 LEU A 38 ? ? -41.46 -16.75 58 8 GLN A 86 ? ? 57.80 86.71 59 9 VAL A 3 ? ? 55.20 165.94 60 9 ASP A 23 ? ? -99.84 40.81 61 9 4HH A 37 ? ? -110.60 -141.27 62 9 LEU A 38 ? ? -39.09 -17.07 63 9 ASN A 82 ? ? 62.82 77.42 64 9 ALA A 84 ? ? -148.17 -12.03 65 10 THR A 1 ? ? -176.58 141.19 66 10 ASP A 22 ? ? -126.88 -73.96 67 10 ASP A 23 ? ? -83.65 40.51 68 10 4HH A 37 ? ? -111.15 -142.05 69 10 LEU A 38 ? ? -38.54 -17.28 70 10 ALA A 84 ? ? -165.11 66.33 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id 4HH _pdbx_struct_mod_residue.label_seq_id 41 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id 4HH _pdbx_struct_mod_residue.auth_seq_id 37 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_entry_details.entry_id 8QPY _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # _pdbx_nmr_ensemble.entry_id 8QPY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8QPY _pdbx_nmr_representative.conformer_id 9 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;500 uM [U-13C; U-15N] APCP, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 10 v/v [U-2H] D2O, 0.02 % w/v sodium azide, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C15N_sample solution 'Main sample used for assignment and collection of distance restraints.' 2 ;500 uM [U-13C; U-15N] APCP, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 0.02 w/v sodium azide, 100 % v/v [U-2H] D2O, 100% D2O ; '100% D2O' 13C15N_sample_D2O solution 'Additional sample (dissolved in D2O-based buffer) used for collection of distance restraints.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 APCP 500 ? uM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 DTT 5 ? mM 'natural abundance' 1 D2O 10 ? v/v '[U-2H]' 1 'sodium azide' 0.02 ? '% w/v' 'natural abundance' 2 APCP 500 ? uM '[U-13C; U-15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 'sodium chloride' 150 ? mM 'natural abundance' 2 DTT 5 ? mM 'natural abundance' 2 'sodium azide' 0.02 ? w/v 'natural abundance' 2 D2O 100 ? '% v/v' '[U-2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 265 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D HNCO' 1 isotropic 3 1 1 '3D HNCA' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 7 1 1 '3D C(CO)NH' 1 isotropic 8 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '3D HBHA(CO)NH' 1 isotropic 10 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 1 '2D 1H-13C HSQC' 3 isotropic 12 1 1 '2D hbcbcgcdhdgp' 1 isotropic 13 1 1 '2D hbcbcgcdcehegp' 1 isotropic 14 1 2 '2D 1H-13C HSQC' 2 isotropic 15 1 2 '3D 1H-13C NOESY' 2 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 8QPY 'simulated annealing' ? 7 8QPY 'torsion angle dynamics' ? 8 8QPY 'molecular dynamics' ? 9 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.2 'Bruker Biospin' 2 processing NMRPipe 10.2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'peak picking' 'CcpNmr Analysis' 2.4 CCPN 4 'chemical shift assignment' 'CcpNmr Analysis' 2.4 CCPN 5 'data analysis' 'CcpNmr Analysis' 2.4 CCPN 6 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 7 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 8 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 9 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 4HH O O N N 1 4HH C C N N 2 4HH CA C N S 3 4HH N N N N 4 4HH CB C N N 5 4HH OG O N N 6 4HH CJ C N N 7 4HH CK C N N 8 4HH CL1 C N N 9 4HH CL2 C N N 10 4HH CL3 C N N 11 4HH CM C N R 12 4HH OM O N N 13 4HH NN N N N 14 4HH ON O N N 15 4HH P P N N 16 4HH O1P O N N 17 4HH O2P O N N 18 4HH O3P O N N 19 4HH CO C N N 20 4HH CP C N N 21 4HH CQ C N N 22 4HH CS C N N 23 4HH CT C N N 24 4HH NR N N N 25 4HH OR O N N 26 4HH SU S N N 27 4HH HA H N N 28 4HH H H N N 29 4HH H2 H N N 30 4HH HB3 H N N 31 4HH HB2 H N N 32 4HH HJ3 H N N 33 4HH HJ2 H N N 34 4HH HL13 H N N 35 4HH HL12 H N N 36 4HH HL11 H N N 37 4HH HL21 H N N 38 4HH HL23 H N N 39 4HH HL22 H N N 40 4HH HL3 H N N 41 4HH HM H N N 42 4HH HN H N N 43 4HH H4 H N N 44 4HH HO2 H N N 45 4HH HO3 H N N 46 4HH HP3 H N N 47 4HH HP2 H N N 48 4HH HS2 H N N 49 4HH HS3 H N N 50 4HH HT3 H N N 51 4HH HT2 H N N 52 4HH HR H N N 53 4HH HU H N N 54 4HH OXT O N N 55 4HH HXT H N N 56 ALA N N N N 57 ALA CA C N S 58 ALA C C N N 59 ALA O O N N 60 ALA CB C N N 61 ALA OXT O N N 62 ALA H H N N 63 ALA H2 H N N 64 ALA HA H N N 65 ALA HB1 H N N 66 ALA HB2 H N N 67 ALA HB3 H N N 68 ALA HXT H N N 69 ARG N N N N 70 ARG CA C N S 71 ARG C C N N 72 ARG O O N N 73 ARG CB C N N 74 ARG CG C N N 75 ARG CD C N N 76 ARG NE N N N 77 ARG CZ C N N 78 ARG NH1 N N N 79 ARG NH2 N N N 80 ARG OXT O N N 81 ARG H H N N 82 ARG H2 H N N 83 ARG HA H N N 84 ARG HB2 H N N 85 ARG HB3 H N N 86 ARG HG2 H N N 87 ARG HG3 H N N 88 ARG HD2 H N N 89 ARG HD3 H N N 90 ARG HE H N N 91 ARG HH11 H N N 92 ARG HH12 H N N 93 ARG HH21 H N N 94 ARG HH22 H N N 95 ARG HXT H N N 96 ASN N N N N 97 ASN CA C N S 98 ASN C C N N 99 ASN O O N N 100 ASN CB C N N 101 ASN CG C N N 102 ASN OD1 O N N 103 ASN ND2 N N N 104 ASN OXT O N N 105 ASN H H N N 106 ASN H2 H N N 107 ASN HA H N N 108 ASN HB2 H N N 109 ASN HB3 H N N 110 ASN HD21 H N N 111 ASN HD22 H N N 112 ASN HXT H N N 113 ASP N N N N 114 ASP CA C N S 115 ASP C C N N 116 ASP O O N N 117 ASP CB C N N 118 ASP CG C N N 119 ASP OD1 O N N 120 ASP OD2 O N N 121 ASP OXT O N N 122 ASP H H N N 123 ASP H2 H N N 124 ASP HA H N N 125 ASP HB2 H N N 126 ASP HB3 H N N 127 ASP HD2 H N N 128 ASP HXT H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 ILE N N N N 200 ILE CA C N S 201 ILE C C N N 202 ILE O O N N 203 ILE CB C N S 204 ILE CG1 C N N 205 ILE CG2 C N N 206 ILE CD1 C N N 207 ILE OXT O N N 208 ILE H H N N 209 ILE H2 H N N 210 ILE HA H N N 211 ILE HB H N N 212 ILE HG12 H N N 213 ILE HG13 H N N 214 ILE HG21 H N N 215 ILE HG22 H N N 216 ILE HG23 H N N 217 ILE HD11 H N N 218 ILE HD12 H N N 219 ILE HD13 H N N 220 ILE HXT H N N 221 LEU N N N N 222 LEU CA C N S 223 LEU C C N N 224 LEU O O N N 225 LEU CB C N N 226 LEU CG C N N 227 LEU CD1 C N N 228 LEU CD2 C N N 229 LEU OXT O N N 230 LEU H H N N 231 LEU H2 H N N 232 LEU HA H N N 233 LEU HB2 H N N 234 LEU HB3 H N N 235 LEU HG H N N 236 LEU HD11 H N N 237 LEU HD12 H N N 238 LEU HD13 H N N 239 LEU HD21 H N N 240 LEU HD22 H N N 241 LEU HD23 H N N 242 LEU HXT H N N 243 LYS N N N N 244 LYS CA C N S 245 LYS C C N N 246 LYS O O N N 247 LYS CB C N N 248 LYS CG C N N 249 LYS CD C N N 250 LYS CE C N N 251 LYS NZ N N N 252 LYS OXT O N N 253 LYS H H N N 254 LYS H2 H N N 255 LYS HA H N N 256 LYS HB2 H N N 257 LYS HB3 H N N 258 LYS HG2 H N N 259 LYS HG3 H N N 260 LYS HD2 H N N 261 LYS HD3 H N N 262 LYS HE2 H N N 263 LYS HE3 H N N 264 LYS HZ1 H N N 265 LYS HZ2 H N N 266 LYS HZ3 H N N 267 LYS HXT H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 VAL N N N N 387 VAL CA C N S 388 VAL C C N N 389 VAL O O N N 390 VAL CB C N N 391 VAL CG1 C N N 392 VAL CG2 C N N 393 VAL OXT O N N 394 VAL H H N N 395 VAL H2 H N N 396 VAL HA H N N 397 VAL HB H N N 398 VAL HG11 H N N 399 VAL HG12 H N N 400 VAL HG13 H N N 401 VAL HG21 H N N 402 VAL HG22 H N N 403 VAL HG23 H N N 404 VAL HXT H N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 4HH SU CT sing N N 1 4HH CB CA sing N N 2 4HH CB OG sing N N 3 4HH CL1 CK sing N N 4 4HH CT CS sing N N 5 4HH CA N sing N N 6 4HH CA C sing N N 7 4HH O2P P doub N N 8 4HH O C doub N N 9 4HH CS NR sing N N 10 4HH O3P P sing N N 11 4HH O3P CJ sing N N 12 4HH OG P sing N N 13 4HH P O1P sing N N 14 4HH CK CL2 sing N N 15 4HH CK CJ sing N N 16 4HH CK CM sing N N 17 4HH CP CQ sing N N 18 4HH CP CO sing N N 19 4HH NN CL3 sing N N 20 4HH NN CO sing N N 21 4HH NR CQ sing N N 22 4HH CL3 CM sing N N 23 4HH CL3 ON doub N N 24 4HH CQ OR doub N N 25 4HH CM OM sing N N 26 4HH CA HA sing N N 27 4HH N H sing N N 28 4HH N H2 sing N N 29 4HH CB HB3 sing N N 30 4HH CB HB2 sing N N 31 4HH CJ HJ3 sing N N 32 4HH CJ HJ2 sing N N 33 4HH CL1 HL13 sing N N 34 4HH CL1 HL12 sing N N 35 4HH CL1 HL11 sing N N 36 4HH CL2 HL21 sing N N 37 4HH CL2 HL23 sing N N 38 4HH CL2 HL22 sing N N 39 4HH CM HL3 sing N N 40 4HH OM HM sing N N 41 4HH NN HN sing N N 42 4HH O1P H4 sing N N 43 4HH CO HO2 sing N N 44 4HH CO HO3 sing N N 45 4HH CP HP3 sing N N 46 4HH CP HP2 sing N N 47 4HH CS HS2 sing N N 48 4HH CS HS3 sing N N 49 4HH CT HT3 sing N N 50 4HH CT HT2 sing N N 51 4HH NR HR sing N N 52 4HH SU HU sing N N 53 4HH C OXT sing N N 54 4HH OXT HXT sing N N 55 ALA N CA sing N N 56 ALA N H sing N N 57 ALA N H2 sing N N 58 ALA CA C sing N N 59 ALA CA CB sing N N 60 ALA CA HA sing N N 61 ALA C O doub N N 62 ALA C OXT sing N N 63 ALA CB HB1 sing N N 64 ALA CB HB2 sing N N 65 ALA CB HB3 sing N N 66 ALA OXT HXT sing N N 67 ARG N CA sing N N 68 ARG N H sing N N 69 ARG N H2 sing N N 70 ARG CA C sing N N 71 ARG CA CB sing N N 72 ARG CA HA sing N N 73 ARG C O doub N N 74 ARG C OXT sing N N 75 ARG CB CG sing N N 76 ARG CB HB2 sing N N 77 ARG CB HB3 sing N N 78 ARG CG CD sing N N 79 ARG CG HG2 sing N N 80 ARG CG HG3 sing N N 81 ARG CD NE sing N N 82 ARG CD HD2 sing N N 83 ARG CD HD3 sing N N 84 ARG NE CZ sing N N 85 ARG NE HE sing N N 86 ARG CZ NH1 sing N N 87 ARG CZ NH2 doub N N 88 ARG NH1 HH11 sing N N 89 ARG NH1 HH12 sing N N 90 ARG NH2 HH21 sing N N 91 ARG NH2 HH22 sing N N 92 ARG OXT HXT sing N N 93 ASN N CA sing N N 94 ASN N H sing N N 95 ASN N H2 sing N N 96 ASN CA C sing N N 97 ASN CA CB sing N N 98 ASN CA HA sing N N 99 ASN C O doub N N 100 ASN C OXT sing N N 101 ASN CB CG sing N N 102 ASN CB HB2 sing N N 103 ASN CB HB3 sing N N 104 ASN CG OD1 doub N N 105 ASN CG ND2 sing N N 106 ASN ND2 HD21 sing N N 107 ASN ND2 HD22 sing N N 108 ASN OXT HXT sing N N 109 ASP N CA sing N N 110 ASP N H sing N N 111 ASP N H2 sing N N 112 ASP CA C sing N N 113 ASP CA CB sing N N 114 ASP CA HA sing N N 115 ASP C O doub N N 116 ASP C OXT sing N N 117 ASP CB CG sing N N 118 ASP CB HB2 sing N N 119 ASP CB HB3 sing N N 120 ASP CG OD1 doub N N 121 ASP CG OD2 sing N N 122 ASP OD2 HD2 sing N N 123 ASP OXT HXT sing N N 124 GLN N CA sing N N 125 GLN N H sing N N 126 GLN N H2 sing N N 127 GLN CA C sing N N 128 GLN CA CB sing N N 129 GLN CA HA sing N N 130 GLN C O doub N N 131 GLN C OXT sing N N 132 GLN CB CG sing N N 133 GLN CB HB2 sing N N 134 GLN CB HB3 sing N N 135 GLN CG CD sing N N 136 GLN CG HG2 sing N N 137 GLN CG HG3 sing N N 138 GLN CD OE1 doub N N 139 GLN CD NE2 sing N N 140 GLN NE2 HE21 sing N N 141 GLN NE2 HE22 sing N N 142 GLN OXT HXT sing N N 143 GLU N CA sing N N 144 GLU N H sing N N 145 GLU N H2 sing N N 146 GLU CA C sing N N 147 GLU CA CB sing N N 148 GLU CA HA sing N N 149 GLU C O doub N N 150 GLU C OXT sing N N 151 GLU CB CG sing N N 152 GLU CB HB2 sing N N 153 GLU CB HB3 sing N N 154 GLU CG CD sing N N 155 GLU CG HG2 sing N N 156 GLU CG HG3 sing N N 157 GLU CD OE1 doub N N 158 GLU CD OE2 sing N N 159 GLU OE2 HE2 sing N N 160 GLU OXT HXT sing N N 161 GLY N CA sing N N 162 GLY N H sing N N 163 GLY N H2 sing N N 164 GLY CA C sing N N 165 GLY CA HA2 sing N N 166 GLY CA HA3 sing N N 167 GLY C O doub N N 168 GLY C OXT sing N N 169 GLY OXT HXT sing N N 170 HIS N CA sing N N 171 HIS N H sing N N 172 HIS N H2 sing N N 173 HIS CA C sing N N 174 HIS CA CB sing N N 175 HIS CA HA sing N N 176 HIS C O doub N N 177 HIS C OXT sing N N 178 HIS CB CG sing N N 179 HIS CB HB2 sing N N 180 HIS CB HB3 sing N N 181 HIS CG ND1 sing Y N 182 HIS CG CD2 doub Y N 183 HIS ND1 CE1 doub Y N 184 HIS ND1 HD1 sing N N 185 HIS CD2 NE2 sing Y N 186 HIS CD2 HD2 sing N N 187 HIS CE1 NE2 sing Y N 188 HIS CE1 HE1 sing N N 189 HIS NE2 HE2 sing N N 190 HIS OXT HXT sing N N 191 ILE N CA sing N N 192 ILE N H sing N N 193 ILE N H2 sing N N 194 ILE CA C sing N N 195 ILE CA CB sing N N 196 ILE CA HA sing N N 197 ILE C O doub N N 198 ILE C OXT sing N N 199 ILE CB CG1 sing N N 200 ILE CB CG2 sing N N 201 ILE CB HB sing N N 202 ILE CG1 CD1 sing N N 203 ILE CG1 HG12 sing N N 204 ILE CG1 HG13 sing N N 205 ILE CG2 HG21 sing N N 206 ILE CG2 HG22 sing N N 207 ILE CG2 HG23 sing N N 208 ILE CD1 HD11 sing N N 209 ILE CD1 HD12 sing N N 210 ILE CD1 HD13 sing N N 211 ILE OXT HXT sing N N 212 LEU N CA sing N N 213 LEU N H sing N N 214 LEU N H2 sing N N 215 LEU CA C sing N N 216 LEU CA CB sing N N 217 LEU CA HA sing N N 218 LEU C O doub N N 219 LEU C OXT sing N N 220 LEU CB CG sing N N 221 LEU CB HB2 sing N N 222 LEU CB HB3 sing N N 223 LEU CG CD1 sing N N 224 LEU CG CD2 sing N N 225 LEU CG HG sing N N 226 LEU CD1 HD11 sing N N 227 LEU CD1 HD12 sing N N 228 LEU CD1 HD13 sing N N 229 LEU CD2 HD21 sing N N 230 LEU CD2 HD22 sing N N 231 LEU CD2 HD23 sing N N 232 LEU OXT HXT sing N N 233 LYS N CA sing N N 234 LYS N H sing N N 235 LYS N H2 sing N N 236 LYS CA C sing N N 237 LYS CA CB sing N N 238 LYS CA HA sing N N 239 LYS C O doub N N 240 LYS C OXT sing N N 241 LYS CB CG sing N N 242 LYS CB HB2 sing N N 243 LYS CB HB3 sing N N 244 LYS CG CD sing N N 245 LYS CG HG2 sing N N 246 LYS CG HG3 sing N N 247 LYS CD CE sing N N 248 LYS CD HD2 sing N N 249 LYS CD HD3 sing N N 250 LYS CE NZ sing N N 251 LYS CE HE2 sing N N 252 LYS CE HE3 sing N N 253 LYS NZ HZ1 sing N N 254 LYS NZ HZ2 sing N N 255 LYS NZ HZ3 sing N N 256 LYS OXT HXT sing N N 257 MET N CA sing N N 258 MET N H sing N N 259 MET N H2 sing N N 260 MET CA C sing N N 261 MET CA CB sing N N 262 MET CA HA sing N N 263 MET C O doub N N 264 MET C OXT sing N N 265 MET CB CG sing N N 266 MET CB HB2 sing N N 267 MET CB HB3 sing N N 268 MET CG SD sing N N 269 MET CG HG2 sing N N 270 MET CG HG3 sing N N 271 MET SD CE sing N N 272 MET CE HE1 sing N N 273 MET CE HE2 sing N N 274 MET CE HE3 sing N N 275 MET OXT HXT sing N N 276 PHE N CA sing N N 277 PHE N H sing N N 278 PHE N H2 sing N N 279 PHE CA C sing N N 280 PHE CA CB sing N N 281 PHE CA HA sing N N 282 PHE C O doub N N 283 PHE C OXT sing N N 284 PHE CB CG sing N N 285 PHE CB HB2 sing N N 286 PHE CB HB3 sing N N 287 PHE CG CD1 doub Y N 288 PHE CG CD2 sing Y N 289 PHE CD1 CE1 sing Y N 290 PHE CD1 HD1 sing N N 291 PHE CD2 CE2 doub Y N 292 PHE CD2 HD2 sing N N 293 PHE CE1 CZ doub Y N 294 PHE CE1 HE1 sing N N 295 PHE CE2 CZ sing Y N 296 PHE CE2 HE2 sing N N 297 PHE CZ HZ sing N N 298 PHE OXT HXT sing N N 299 PRO N CA sing N N 300 PRO N CD sing N N 301 PRO N H sing N N 302 PRO CA C sing N N 303 PRO CA CB sing N N 304 PRO CA HA sing N N 305 PRO C O doub N N 306 PRO C OXT sing N N 307 PRO CB CG sing N N 308 PRO CB HB2 sing N N 309 PRO CB HB3 sing N N 310 PRO CG CD sing N N 311 PRO CG HG2 sing N N 312 PRO CG HG3 sing N N 313 PRO CD HD2 sing N N 314 PRO CD HD3 sing N N 315 PRO OXT HXT sing N N 316 SER N CA sing N N 317 SER N H sing N N 318 SER N H2 sing N N 319 SER CA C sing N N 320 SER CA CB sing N N 321 SER CA HA sing N N 322 SER C O doub N N 323 SER C OXT sing N N 324 SER CB OG sing N N 325 SER CB HB2 sing N N 326 SER CB HB3 sing N N 327 SER OG HG sing N N 328 SER OXT HXT sing N N 329 THR N CA sing N N 330 THR N H sing N N 331 THR N H2 sing N N 332 THR CA C sing N N 333 THR CA CB sing N N 334 THR CA HA sing N N 335 THR C O doub N N 336 THR C OXT sing N N 337 THR CB OG1 sing N N 338 THR CB CG2 sing N N 339 THR CB HB sing N N 340 THR OG1 HG1 sing N N 341 THR CG2 HG21 sing N N 342 THR CG2 HG22 sing N N 343 THR CG2 HG23 sing N N 344 THR OXT HXT sing N N 345 TRP N CA sing N N 346 TRP N H sing N N 347 TRP N H2 sing N N 348 TRP CA C sing N N 349 TRP CA CB sing N N 350 TRP CA HA sing N N 351 TRP C O doub N N 352 TRP C OXT sing N N 353 TRP CB CG sing N N 354 TRP CB HB2 sing N N 355 TRP CB HB3 sing N N 356 TRP CG CD1 doub Y N 357 TRP CG CD2 sing Y N 358 TRP CD1 NE1 sing Y N 359 TRP CD1 HD1 sing N N 360 TRP CD2 CE2 doub Y N 361 TRP CD2 CE3 sing Y N 362 TRP NE1 CE2 sing Y N 363 TRP NE1 HE1 sing N N 364 TRP CE2 CZ2 sing Y N 365 TRP CE3 CZ3 doub Y N 366 TRP CE3 HE3 sing N N 367 TRP CZ2 CH2 doub Y N 368 TRP CZ2 HZ2 sing N N 369 TRP CZ3 CH2 sing Y N 370 TRP CZ3 HZ3 sing N N 371 TRP CH2 HH2 sing N N 372 TRP OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number CA294/16-1 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 4HH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 4HH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? 3 'AVANCE III HD' ? Bruker 850 ? # _atom_sites.entry_id 8QPY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_