data_8QPY
#
_entry.id 8QPY
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.395
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 8QPY pdb_00008qpy 10.2210/pdb8qpy/pdb
WWPDB D_1292133510 ? ?
BMRB 34868 ? 10.13018/BMR34868
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
1 'Structure model' 1 0 2024-06-26
2 'Structure model' 1 1 2024-07-03
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
_pdbx_audit_revision_group.ordinal 1
_pdbx_audit_revision_group.revision_ordinal 2
_pdbx_audit_revision_group.data_content_type 'Structure model'
_pdbx_audit_revision_group.group 'Database references'
#
loop_
_pdbx_audit_revision_category.ordinal
_pdbx_audit_revision_category.revision_ordinal
_pdbx_audit_revision_category.data_content_type
_pdbx_audit_revision_category.category
1 2 'Structure model' citation
2 2 'Structure model' citation_author
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.page_first'
2 2 'Structure model' '_citation.page_last'
3 2 'Structure model' '_citation.pdbx_database_id_PubMed'
4 2 'Structure model' '_citation.title'
5 2 'Structure model' '_citation_author.identifier_ORCID'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf ?
_pdbx_database_status.status_code_mr .
_pdbx_database_status.entry_id 8QPY
_pdbx_database_status.recvd_initial_deposition_date 2023-10-03
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBE
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs .
_pdbx_database_status.status_code_nmr_data REL
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible Y
#
_pdbx_database_related.db_name BMRB
_pdbx_database_related.details
'Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase'
_pdbx_database_related.db_id 34868
_pdbx_database_related.content_type unspecified
#
_pdbx_contact_author.id 2
_pdbx_contact_author.email t.carlomagno@bham.ac.uk
_pdbx_contact_author.name_first Teresa
_pdbx_contact_author.name_last Carlomagno
_pdbx_contact_author.name_mi ?
_pdbx_contact_author.role 'principal investigator/group leader'
_pdbx_contact_author.identifier_ORCID 0000-0002-2437-2760
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Karanth, M.N.' 1 0000-0003-3392-6523
'Kirkpatrick, J.P.' 2 0000-0002-9761-3377
'Carlomagno, T.' 3 0000-0002-2437-2760
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country US
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'Sci Adv'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 2375-2548
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 10
_citation.language ?
_citation.page_first eadm9404
_citation.page_last eadm9404
_citation.title
'The specificity of intermodular recognition in a prototypical nonribosomal peptide synthetase depends on an adaptor domain.'
_citation.year 2024
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1126/sciadv.adm9404
_citation.pdbx_database_id_PubMed 38896613
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Karanth, M.N.' 1 0000-0003-3392-6523
primary 'Kirkpatrick, J.P.' 2 0000-0002-9761-3377
primary 'Krausze, J.' 3 0000-0001-5333-8046
primary 'Schmelz, S.' 4 0000-0002-2511-7593
primary 'Scrima, A.' 5 0000-0003-2760-611X
primary 'Carlomagno, T.' 6 0000-0002-2437-2760
#
_entity.id 1
_entity.type polymer
_entity.src_method man
_entity.pdbx_description 'Carrier protein TomAPCP'
_entity.formula_weight 10380.378
_entity.pdbx_number_of_molecules 1
_entity.pdbx_ec ?
_entity.pdbx_mutation ?
_entity.pdbx_fragment ?
_entity.details
;First four residues (GPMA) in the protein are from cloning artifacts. Therefore, the appropriate residue numbering has the first residue (G) designated as residue-number '-3', so that the fifth residue has residue-number '1'. A special modified residue SPP is designated for the serine residue covalently linked to a 4'-phosphopantetheine prosthetic group.
;
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer yes
_entity_poly.pdbx_seq_one_letter_code
;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGN(4HH)LHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARF
VEQSRDTGRNPAAQTQ
;
_entity_poly.pdbx_seq_one_letter_code_can
;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGNXLHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARFVEQS
RDTGRNPAAQTQ
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY n
1 2 PRO n
1 3 MET n
1 4 ALA n
1 5 THR n
1 6 ALA n
1 7 VAL n
1 8 GLN n
1 9 ASN n
1 10 PRO n
1 11 LEU n
1 12 GLU n
1 13 THR n
1 14 VAL n
1 15 VAL n
1 16 LEU n
1 17 GLN n
1 18 ALA n
1 19 TRP n
1 20 LYS n
1 21 ASP n
1 22 ILE n
1 23 SER n
1 24 GLY n
1 25 ALA n
1 26 ASP n
1 27 ASP n
1 28 PHE n
1 29 THR n
1 30 THR n
1 31 THR n
1 32 ASP n
1 33 SER n
1 34 PHE n
1 35 LEU n
1 36 GLY n
1 37 HIS n
1 38 GLY n
1 39 GLY n
1 40 ASN n
1 41 4HH n
1 42 LEU n
1 43 HIS n
1 44 PHE n
1 45 VAL n
1 46 GLN n
1 47 LEU n
1 48 ALA n
1 49 SER n
1 50 ARG n
1 51 LEU n
1 52 GLN n
1 53 LYS n
1 54 ILE n
1 55 PHE n
1 56 GLY n
1 57 VAL n
1 58 GLU n
1 59 VAL n
1 60 SER n
1 61 THR n
1 62 GLU n
1 63 ASP n
1 64 VAL n
1 65 PHE n
1 66 ARG n
1 67 HIS n
1 68 GLY n
1 69 THR n
1 70 VAL n
1 71 GLU n
1 72 GLN n
1 73 LEU n
1 74 ALA n
1 75 ARG n
1 76 PHE n
1 77 VAL n
1 78 GLU n
1 79 GLN n
1 80 SER n
1 81 ARG n
1 82 ASP n
1 83 THR n
1 84 GLY n
1 85 ARG n
1 86 ASN n
1 87 PRO n
1 88 ALA n
1 89 ALA n
1 90 GLN n
1 91 THR n
1 92 GLN n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 92
_entity_src_gen.gene_src_common_name ?
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene ?
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces regensis'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 68263
_entity_src_gen.pdbx_gene_src_variant FH6421
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type ?
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name ?
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
4HH 'L-peptide linking' n "4'-phosphopanthetheine-serine"
'O-[(S)-hydroxy{[(3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl]oxy}phosphoryl]-L-serine'
'C14 H28 N3 O9 P S' 445.426
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLY 1 -3 -3 GLY GLY A . n
A 1 2 PRO 2 -2 -2 PRO PRO A . n
A 1 3 MET 3 -1 -1 MET MET A . n
A 1 4 ALA 4 0 0 ALA ALA A . n
A 1 5 THR 5 1 1 THR THR A . n
A 1 6 ALA 6 2 2 ALA ALA A . n
A 1 7 VAL 7 3 3 VAL VAL A . n
A 1 8 GLN 8 4 4 GLN GLN A . n
A 1 9 ASN 9 5 5 ASN ASN A . n
A 1 10 PRO 10 6 6 PRO PRO A . n
A 1 11 LEU 11 7 7 LEU LEU A . n
A 1 12 GLU 12 8 8 GLU GLU A . n
A 1 13 THR 13 9 9 THR THR A . n
A 1 14 VAL 14 10 10 VAL VAL A . n
A 1 15 VAL 15 11 11 VAL VAL A . n
A 1 16 LEU 16 12 12 LEU LEU A . n
A 1 17 GLN 17 13 13 GLN GLN A . n
A 1 18 ALA 18 14 14 ALA ALA A . n
A 1 19 TRP 19 15 15 TRP TRP A . n
A 1 20 LYS 20 16 16 LYS LYS A . n
A 1 21 ASP 21 17 17 ASP ASP A . n
A 1 22 ILE 22 18 18 ILE ILE A . n
A 1 23 SER 23 19 19 SER SER A . n
A 1 24 GLY 24 20 20 GLY GLY A . n
A 1 25 ALA 25 21 21 ALA ALA A . n
A 1 26 ASP 26 22 22 ASP ASP A . n
A 1 27 ASP 27 23 23 ASP ASP A . n
A 1 28 PHE 28 24 24 PHE PHE A . n
A 1 29 THR 29 25 25 THR THR A . n
A 1 30 THR 30 26 26 THR THR A . n
A 1 31 THR 31 27 27 THR THR A . n
A 1 32 ASP 32 28 28 ASP ASP A . n
A 1 33 SER 33 29 29 SER SER A . n
A 1 34 PHE 34 30 30 PHE PHE A . n
A 1 35 LEU 35 31 31 LEU LEU A . n
A 1 36 GLY 36 32 32 GLY GLY A . n
A 1 37 HIS 37 33 33 HIS HIS A . n
A 1 38 GLY 38 34 34 GLY GLY A . n
A 1 39 GLY 39 35 35 GLY GLY A . n
A 1 40 ASN 40 36 36 ASN ASN A . n
A 1 41 4HH 41 37 37 4HH SPP A . n
A 1 42 LEU 42 38 38 LEU LEU A . n
A 1 43 HIS 43 39 39 HIS HIS A . n
A 1 44 PHE 44 40 40 PHE PHE A . n
A 1 45 VAL 45 41 41 VAL VAL A . n
A 1 46 GLN 46 42 42 GLN GLN A . n
A 1 47 LEU 47 43 43 LEU LEU A . n
A 1 48 ALA 48 44 44 ALA ALA A . n
A 1 49 SER 49 45 45 SER SER A . n
A 1 50 ARG 50 46 46 ARG ARG A . n
A 1 51 LEU 51 47 47 LEU LEU A . n
A 1 52 GLN 52 48 48 GLN GLN A . n
A 1 53 LYS 53 49 49 LYS LYS A . n
A 1 54 ILE 54 50 50 ILE ILE A . n
A 1 55 PHE 55 51 51 PHE PHE A . n
A 1 56 GLY 56 52 52 GLY GLY A . n
A 1 57 VAL 57 53 53 VAL VAL A . n
A 1 58 GLU 58 54 54 GLU GLU A . n
A 1 59 VAL 59 55 55 VAL VAL A . n
A 1 60 SER 60 56 56 SER SER A . n
A 1 61 THR 61 57 57 THR THR A . n
A 1 62 GLU 62 58 58 GLU GLU A . n
A 1 63 ASP 63 59 59 ASP ASP A . n
A 1 64 VAL 64 60 60 VAL VAL A . n
A 1 65 PHE 65 61 61 PHE PHE A . n
A 1 66 ARG 66 62 62 ARG ARG A . n
A 1 67 HIS 67 63 63 HIS HIS A . n
A 1 68 GLY 68 64 64 GLY GLY A . n
A 1 69 THR 69 65 65 THR THR A . n
A 1 70 VAL 70 66 66 VAL VAL A . n
A 1 71 GLU 71 67 67 GLU GLU A . n
A 1 72 GLN 72 68 68 GLN GLN A . n
A 1 73 LEU 73 69 69 LEU LEU A . n
A 1 74 ALA 74 70 70 ALA ALA A . n
A 1 75 ARG 75 71 71 ARG ARG A . n
A 1 76 PHE 76 72 72 PHE PHE A . n
A 1 77 VAL 77 73 73 VAL VAL A . n
A 1 78 GLU 78 74 74 GLU GLU A . n
A 1 79 GLN 79 75 75 GLN GLN A . n
A 1 80 SER 80 76 76 SER SER A . n
A 1 81 ARG 81 77 77 ARG ARG A . n
A 1 82 ASP 82 78 78 ASP ASP A . n
A 1 83 THR 83 79 79 THR THR A . n
A 1 84 GLY 84 80 80 GLY GLY A . n
A 1 85 ARG 85 81 81 ARG ARG A . n
A 1 86 ASN 86 82 82 ASN ASN A . n
A 1 87 PRO 87 83 83 PRO PRO A . n
A 1 88 ALA 88 84 84 ALA ALA A . n
A 1 89 ALA 89 85 85 ALA ALA A . n
A 1 90 GLN 90 86 86 GLN GLN A . n
A 1 91 THR 91 87 87 THR THR A . n
A 1 92 GLN 92 88 88 GLN GLN A . n
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 8QPY
_exptl.crystals_number ?
_exptl.details ?
_exptl.method 'SOLUTION NMR'
_exptl.method_details ?
#
_struct.entry_id 8QPY
_struct.title
'Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 8QPY
_struct_keywords.text
'Non-ribosomal peptide synthetase, Tomaymycin, PCP, phosphopantetheine, Donor, BIOSYNTHETIC PROTEIN'
_struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN'
#
_struct_asym.id A
_struct_asym.pdbx_blank_PDB_chainid_flag N
_struct_asym.pdbx_modified N
_struct_asym.entity_id 1
_struct_asym.details ?
#
_struct_ref.id 1
_struct_ref.db_name PDB
_struct_ref.db_code 8QPY
_struct_ref.pdbx_db_accession 8QPY
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code ?
_struct_ref.pdbx_align_begin 1
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 8QPY
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 1
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 92
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession 8QPY
_struct_ref_seq.db_align_beg -3
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 88
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg -3
_struct_ref_seq.pdbx_auth_seq_align_end 88
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_defined_assembly
_pdbx_struct_assembly.method_details ?
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration'
_pdbx_struct_assembly_auth_evidence.details 'not applicable'
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation ?
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 PRO A 10 ? SER A 23 ? PRO A 6 SER A 19 1 ? 14
HELX_P HELX_P2 AA2 LEU A 42 ? PHE A 55 ? LEU A 38 PHE A 51 1 ? 14
HELX_P HELX_P3 AA3 THR A 61 ? HIS A 67 ? THR A 57 HIS A 63 1 ? 7
HELX_P HELX_P4 AA4 VAL A 70 ? SER A 80 ? VAL A 66 SER A 76 1 ? 11
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
loop_
_struct_conn.id
_struct_conn.conn_type_id
_struct_conn.pdbx_leaving_atom_flag
_struct_conn.pdbx_PDB_id
_struct_conn.ptnr1_label_asym_id
_struct_conn.ptnr1_label_comp_id
_struct_conn.ptnr1_label_seq_id
_struct_conn.ptnr1_label_atom_id
_struct_conn.pdbx_ptnr1_label_alt_id
_struct_conn.pdbx_ptnr1_PDB_ins_code
_struct_conn.pdbx_ptnr1_standard_comp_id
_struct_conn.ptnr1_symmetry
_struct_conn.ptnr2_label_asym_id
_struct_conn.ptnr2_label_comp_id
_struct_conn.ptnr2_label_seq_id
_struct_conn.ptnr2_label_atom_id
_struct_conn.pdbx_ptnr2_label_alt_id
_struct_conn.pdbx_ptnr2_PDB_ins_code
_struct_conn.ptnr1_auth_asym_id
_struct_conn.ptnr1_auth_comp_id
_struct_conn.ptnr1_auth_seq_id
_struct_conn.ptnr2_auth_asym_id
_struct_conn.ptnr2_auth_comp_id
_struct_conn.ptnr2_auth_seq_id
_struct_conn.ptnr2_symmetry
_struct_conn.pdbx_ptnr3_label_atom_id
_struct_conn.pdbx_ptnr3_label_seq_id
_struct_conn.pdbx_ptnr3_label_comp_id
_struct_conn.pdbx_ptnr3_label_asym_id
_struct_conn.pdbx_ptnr3_label_alt_id
_struct_conn.pdbx_ptnr3_PDB_ins_code
_struct_conn.details
_struct_conn.pdbx_dist_value
_struct_conn.pdbx_value_order
_struct_conn.pdbx_role
covale1 covale both ? A ASN 40 C ? ? ? 1_555 A 4HH 41 N ? ? A ASN 36 A 4HH 37 1_555 ? ? ? ? ? ? ? 1.312 ? ?
covale2 covale both ? A 4HH 41 C ? ? ? 1_555 A LEU 42 N ? ? A 4HH 37 A LEU 38 1_555 ? ? ? ? ? ? ? 1.334 ? ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
loop_
_pdbx_validate_close_contact.id
_pdbx_validate_close_contact.PDB_model_num
_pdbx_validate_close_contact.auth_atom_id_1
_pdbx_validate_close_contact.auth_asym_id_1
_pdbx_validate_close_contact.auth_comp_id_1
_pdbx_validate_close_contact.auth_seq_id_1
_pdbx_validate_close_contact.PDB_ins_code_1
_pdbx_validate_close_contact.label_alt_id_1
_pdbx_validate_close_contact.auth_atom_id_2
_pdbx_validate_close_contact.auth_asym_id_2
_pdbx_validate_close_contact.auth_comp_id_2
_pdbx_validate_close_contact.auth_seq_id_2
_pdbx_validate_close_contact.PDB_ins_code_2
_pdbx_validate_close_contact.label_alt_id_2
_pdbx_validate_close_contact.dist
1 4 O A LEU 31 ? ? H A HIS 33 ? ? 1.53
2 7 O A PHE 30 ? ? H A GLY 32 ? ? 1.59
3 7 HG1 A THR 25 ? ? OD1 A ASP 28 ? ? 1.60
4 8 O A LEU 31 ? ? H A HIS 33 ? ? 1.56
5 9 O A LEU 31 ? ? H A HIS 33 ? ? 1.55
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ALA A 0 ? ? -86.28 -70.66
2 1 ALA A 2 ? ? 66.93 -82.71
3 1 ASP A 23 ? ? -82.14 35.36
4 1 LEU A 31 ? ? -58.47 45.16
5 1 4HH A 37 ? ? -82.80 -143.31
6 1 LEU A 38 ? ? -40.81 -13.94
7 2 VAL A 3 ? ? 67.26 99.03
8 2 ASP A 22 ? ? -149.02 -49.69
9 2 LEU A 31 ? ? -60.50 48.20
10 2 ASN A 36 ? ? -131.55 -35.80
11 2 4HH A 37 ? ? -104.74 -142.73
12 2 LEU A 38 ? ? -38.72 -15.30
13 2 ARG A 81 ? ? -68.48 88.53
14 2 ASN A 82 ? ? 55.52 82.14
15 2 ALA A 84 ? ? -152.64 47.98
16 2 GLN A 86 ? ? 55.93 86.35
17 3 PRO A -2 ? ? -60.43 -71.00
18 3 MET A -1 ? ? -151.88 -39.87
19 3 THR A 1 ? ? 75.98 -63.59
20 3 ASP A 23 ? ? -82.77 40.57
21 3 LEU A 31 ? ? -60.85 47.45
22 3 4HH A 37 ? ? -106.56 -141.39
23 3 LEU A 38 ? ? -40.07 -15.43
24 3 ASN A 82 ? ? -156.10 62.11
25 3 GLN A 86 ? ? -157.06 -56.47
26 4 ALA A 2 ? ? -119.06 59.56
27 4 4HH A 37 ? ? -110.57 -143.51
28 4 LEU A 38 ? ? -41.27 -17.12
29 4 ALA A 84 ? ? -151.46 63.07
30 5 ASP A 22 ? ? -138.25 -54.50
31 5 ASP A 23 ? ? -81.44 41.39
32 5 4HH A 37 ? ? -110.86 -143.64
33 5 LEU A 38 ? ? -40.05 -16.96
34 6 MET A -1 ? ? 64.83 -83.48
35 6 GLN A 4 ? ? 72.78 -52.86
36 6 ASP A 23 ? ? -81.56 40.38
37 6 LEU A 31 ? ? -59.35 48.75
38 6 4HH A 37 ? ? -110.26 -141.22
39 6 LEU A 38 ? ? -37.13 -16.53
40 6 THR A 79 ? ? -103.89 -78.14
41 6 ARG A 81 ? ? -128.69 -156.72
42 6 ALA A 84 ? ? -138.09 -52.76
43 7 ASP A 22 ? ? -113.25 -76.07
44 7 ASP A 23 ? ? -85.94 40.25
45 7 LEU A 31 ? ? -56.70 49.15
46 7 4HH A 37 ? ? -110.04 -143.22
47 7 LEU A 38 ? ? -40.98 -15.73
48 7 ASN A 82 ? ? 55.84 89.75
49 7 ALA A 84 ? ? -153.86 22.36
50 7 GLN A 86 ? ? -170.65 85.20
51 8 PRO A -2 ? ? -91.75 49.07
52 8 THR A 1 ? ? 71.83 75.58
53 8 ALA A 2 ? ? 67.27 135.11
54 8 ASP A 23 ? ? -88.26 38.57
55 8 ASN A 36 ? ? -156.59 -35.02
56 8 4HH A 37 ? ? -98.05 -143.09
57 8 LEU A 38 ? ? -41.46 -16.75
58 8 GLN A 86 ? ? 57.80 86.71
59 9 VAL A 3 ? ? 55.20 165.94
60 9 ASP A 23 ? ? -99.84 40.81
61 9 4HH A 37 ? ? -110.60 -141.27
62 9 LEU A 38 ? ? -39.09 -17.07
63 9 ASN A 82 ? ? 62.82 77.42
64 9 ALA A 84 ? ? -148.17 -12.03
65 10 THR A 1 ? ? -176.58 141.19
66 10 ASP A 22 ? ? -126.88 -73.96
67 10 ASP A 23 ? ? -83.65 40.51
68 10 4HH A 37 ? ? -111.15 -142.05
69 10 LEU A 38 ? ? -38.54 -17.28
70 10 ALA A 84 ? ? -165.11 66.33
#
_pdbx_struct_mod_residue.id 1
_pdbx_struct_mod_residue.label_asym_id A
_pdbx_struct_mod_residue.label_comp_id 4HH
_pdbx_struct_mod_residue.label_seq_id 41
_pdbx_struct_mod_residue.auth_asym_id A
_pdbx_struct_mod_residue.auth_comp_id 4HH
_pdbx_struct_mod_residue.auth_seq_id 37
_pdbx_struct_mod_residue.PDB_ins_code ?
_pdbx_struct_mod_residue.parent_comp_id SER
_pdbx_struct_mod_residue.details 'modified residue'
#
_pdbx_entry_details.entry_id 8QPY
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.has_protein_modification ?
#
_pdbx_nmr_ensemble.entry_id 8QPY
_pdbx_nmr_ensemble.conformers_calculated_total_number 100
_pdbx_nmr_ensemble.conformers_submitted_total_number 10
_pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy'
_pdbx_nmr_ensemble.representative_conformer ?
_pdbx_nmr_ensemble.average_constraints_per_residue ?
_pdbx_nmr_ensemble.average_constraint_violations_per_residue ?
_pdbx_nmr_ensemble.maximum_distance_constraint_violation ?
_pdbx_nmr_ensemble.average_distance_constraint_violation ?
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ?
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ?
_pdbx_nmr_ensemble.distance_constraint_violation_method ?
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ?
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ?
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ?
#
_pdbx_nmr_representative.entry_id 8QPY
_pdbx_nmr_representative.conformer_id 9
_pdbx_nmr_representative.selection_criteria 'closest to the average'
#
loop_
_pdbx_nmr_sample_details.solution_id
_pdbx_nmr_sample_details.contents
_pdbx_nmr_sample_details.solvent_system
_pdbx_nmr_sample_details.label
_pdbx_nmr_sample_details.type
_pdbx_nmr_sample_details.details
1
;500 uM [U-13C; U-15N] APCP, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 10 v/v [U-2H] D2O, 0.02 % w/v sodium azide, 90% H2O/10% D2O
;
'90% H2O/10% D2O' 13C15N_sample solution 'Main sample used for assignment and collection of distance restraints.'
2
;500 uM [U-13C; U-15N] APCP, 50 mM sodium phosphate, 150 mM sodium chloride, 5 mM DTT, 0.02 w/v sodium azide, 100 % v/v [U-2H] D2O, 100% D2O
;
'100% D2O' 13C15N_sample_D2O solution
'Additional sample (dissolved in D2O-based buffer) used for collection of distance restraints.'
#
loop_
_pdbx_nmr_exptl_sample.solution_id
_pdbx_nmr_exptl_sample.component
_pdbx_nmr_exptl_sample.concentration
_pdbx_nmr_exptl_sample.concentration_range
_pdbx_nmr_exptl_sample.concentration_units
_pdbx_nmr_exptl_sample.isotopic_labeling
1 APCP 500 ? uM '[U-13C; U-15N]'
1 'sodium phosphate' 50 ? mM 'natural abundance'
1 'sodium chloride' 150 ? mM 'natural abundance'
1 DTT 5 ? mM 'natural abundance'
1 D2O 10 ? v/v '[U-2H]'
1 'sodium azide' 0.02 ? '% w/v' 'natural abundance'
2 APCP 500 ? uM '[U-13C; U-15N]'
2 'sodium phosphate' 50 ? mM 'natural abundance'
2 'sodium chloride' 150 ? mM 'natural abundance'
2 DTT 5 ? mM 'natural abundance'
2 'sodium azide' 0.02 ? w/v 'natural abundance'
2 D2O 100 ? '% v/v' '[U-2H]'
#
_pdbx_nmr_exptl_sample_conditions.conditions_id 1
_pdbx_nmr_exptl_sample_conditions.temperature 308
_pdbx_nmr_exptl_sample_conditions.pressure_units atm
_pdbx_nmr_exptl_sample_conditions.pressure 1
_pdbx_nmr_exptl_sample_conditions.pH 7.0
_pdbx_nmr_exptl_sample_conditions.ionic_strength 265
_pdbx_nmr_exptl_sample_conditions.details ?
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err ?
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM
_pdbx_nmr_exptl_sample_conditions.label conditions_1
_pdbx_nmr_exptl_sample_conditions.pH_err ?
_pdbx_nmr_exptl_sample_conditions.pH_units pH
_pdbx_nmr_exptl_sample_conditions.pressure_err ?
_pdbx_nmr_exptl_sample_conditions.temperature_err ?
_pdbx_nmr_exptl_sample_conditions.temperature_units K
#
loop_
_pdbx_nmr_exptl.experiment_id
_pdbx_nmr_exptl.conditions_id
_pdbx_nmr_exptl.solution_id
_pdbx_nmr_exptl.type
_pdbx_nmr_exptl.spectrometer_id
_pdbx_nmr_exptl.sample_state
1 1 1 '2D 1H-15N HSQC' 1 isotropic
2 1 1 '3D HNCO' 1 isotropic
3 1 1 '3D HNCA' 1 isotropic
4 1 1 '3D CBCA(CO)NH' 1 isotropic
5 1 1 '3D HNCACB' 1 isotropic
6 1 1 '3D H(CCO)NH' 1 isotropic
7 1 1 '3D C(CO)NH' 1 isotropic
8 1 1 '3D HCCH-TOCSY' 1 isotropic
9 1 1 '3D HBHA(CO)NH' 1 isotropic
10 1 1 '3D 1H-15N NOESY' 1 isotropic
11 1 1 '2D 1H-13C HSQC' 3 isotropic
12 1 1 '2D hbcbcgcdhdgp' 1 isotropic
13 1 1 '2D hbcbcgcdcehegp' 1 isotropic
14 1 2 '2D 1H-13C HSQC' 2 isotropic
15 1 2 '3D 1H-13C NOESY' 2 isotropic
#
loop_
_pdbx_nmr_refine.entry_id
_pdbx_nmr_refine.method
_pdbx_nmr_refine.details
_pdbx_nmr_refine.software_ordinal
8QPY 'simulated annealing' ? 7
8QPY 'torsion angle dynamics' ? 8
8QPY 'molecular dynamics' ? 9
#
loop_
_pdbx_nmr_software.ordinal
_pdbx_nmr_software.classification
_pdbx_nmr_software.name
_pdbx_nmr_software.version
_pdbx_nmr_software.authors
1 collection TopSpin 3.2 'Bruker Biospin'
2 processing NMRPipe 10.2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'
3 'peak picking' 'CcpNmr Analysis' 2.4 CCPN
4 'chemical shift assignment' 'CcpNmr Analysis' 2.4 CCPN
5 'data analysis' 'CcpNmr Analysis' 2.4 CCPN
6 'structure calculation' ARIA 2.3
;Linge, O'Donoghue and Nilges
;
7 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read'
8 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read'
9 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read'
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
4HH O O N N 1
4HH C C N N 2
4HH CA C N S 3
4HH N N N N 4
4HH CB C N N 5
4HH OG O N N 6
4HH CJ C N N 7
4HH CK C N N 8
4HH CL1 C N N 9
4HH CL2 C N N 10
4HH CL3 C N N 11
4HH CM C N R 12
4HH OM O N N 13
4HH NN N N N 14
4HH ON O N N 15
4HH P P N N 16
4HH O1P O N N 17
4HH O2P O N N 18
4HH O3P O N N 19
4HH CO C N N 20
4HH CP C N N 21
4HH CQ C N N 22
4HH CS C N N 23
4HH CT C N N 24
4HH NR N N N 25
4HH OR O N N 26
4HH SU S N N 27
4HH HA H N N 28
4HH H H N N 29
4HH H2 H N N 30
4HH HB3 H N N 31
4HH HB2 H N N 32
4HH HJ3 H N N 33
4HH HJ2 H N N 34
4HH HL13 H N N 35
4HH HL12 H N N 36
4HH HL11 H N N 37
4HH HL21 H N N 38
4HH HL23 H N N 39
4HH HL22 H N N 40
4HH HL3 H N N 41
4HH HM H N N 42
4HH HN H N N 43
4HH H4 H N N 44
4HH HO2 H N N 45
4HH HO3 H N N 46
4HH HP3 H N N 47
4HH HP2 H N N 48
4HH HS2 H N N 49
4HH HS3 H N N 50
4HH HT3 H N N 51
4HH HT2 H N N 52
4HH HR H N N 53
4HH HU H N N 54
4HH OXT O N N 55
4HH HXT H N N 56
ALA N N N N 57
ALA CA C N S 58
ALA C C N N 59
ALA O O N N 60
ALA CB C N N 61
ALA OXT O N N 62
ALA H H N N 63
ALA H2 H N N 64
ALA HA H N N 65
ALA HB1 H N N 66
ALA HB2 H N N 67
ALA HB3 H N N 68
ALA HXT H N N 69
ARG N N N N 70
ARG CA C N S 71
ARG C C N N 72
ARG O O N N 73
ARG CB C N N 74
ARG CG C N N 75
ARG CD C N N 76
ARG NE N N N 77
ARG CZ C N N 78
ARG NH1 N N N 79
ARG NH2 N N N 80
ARG OXT O N N 81
ARG H H N N 82
ARG H2 H N N 83
ARG HA H N N 84
ARG HB2 H N N 85
ARG HB3 H N N 86
ARG HG2 H N N 87
ARG HG3 H N N 88
ARG HD2 H N N 89
ARG HD3 H N N 90
ARG HE H N N 91
ARG HH11 H N N 92
ARG HH12 H N N 93
ARG HH21 H N N 94
ARG HH22 H N N 95
ARG HXT H N N 96
ASN N N N N 97
ASN CA C N S 98
ASN C C N N 99
ASN O O N N 100
ASN CB C N N 101
ASN CG C N N 102
ASN OD1 O N N 103
ASN ND2 N N N 104
ASN OXT O N N 105
ASN H H N N 106
ASN H2 H N N 107
ASN HA H N N 108
ASN HB2 H N N 109
ASN HB3 H N N 110
ASN HD21 H N N 111
ASN HD22 H N N 112
ASN HXT H N N 113
ASP N N N N 114
ASP CA C N S 115
ASP C C N N 116
ASP O O N N 117
ASP CB C N N 118
ASP CG C N N 119
ASP OD1 O N N 120
ASP OD2 O N N 121
ASP OXT O N N 122
ASP H H N N 123
ASP H2 H N N 124
ASP HA H N N 125
ASP HB2 H N N 126
ASP HB3 H N N 127
ASP HD2 H N N 128
ASP HXT H N N 129
GLN N N N N 130
GLN CA C N S 131
GLN C C N N 132
GLN O O N N 133
GLN CB C N N 134
GLN CG C N N 135
GLN CD C N N 136
GLN OE1 O N N 137
GLN NE2 N N N 138
GLN OXT O N N 139
GLN H H N N 140
GLN H2 H N N 141
GLN HA H N N 142
GLN HB2 H N N 143
GLN HB3 H N N 144
GLN HG2 H N N 145
GLN HG3 H N N 146
GLN HE21 H N N 147
GLN HE22 H N N 148
GLN HXT H N N 149
GLU N N N N 150
GLU CA C N S 151
GLU C C N N 152
GLU O O N N 153
GLU CB C N N 154
GLU CG C N N 155
GLU CD C N N 156
GLU OE1 O N N 157
GLU OE2 O N N 158
GLU OXT O N N 159
GLU H H N N 160
GLU H2 H N N 161
GLU HA H N N 162
GLU HB2 H N N 163
GLU HB3 H N N 164
GLU HG2 H N N 165
GLU HG3 H N N 166
GLU HE2 H N N 167
GLU HXT H N N 168
GLY N N N N 169
GLY CA C N N 170
GLY C C N N 171
GLY O O N N 172
GLY OXT O N N 173
GLY H H N N 174
GLY H2 H N N 175
GLY HA2 H N N 176
GLY HA3 H N N 177
GLY HXT H N N 178
HIS N N N N 179
HIS CA C N S 180
HIS C C N N 181
HIS O O N N 182
HIS CB C N N 183
HIS CG C Y N 184
HIS ND1 N Y N 185
HIS CD2 C Y N 186
HIS CE1 C Y N 187
HIS NE2 N Y N 188
HIS OXT O N N 189
HIS H H N N 190
HIS H2 H N N 191
HIS HA H N N 192
HIS HB2 H N N 193
HIS HB3 H N N 194
HIS HD1 H N N 195
HIS HD2 H N N 196
HIS HE1 H N N 197
HIS HE2 H N N 198
HIS HXT H N N 199
ILE N N N N 200
ILE CA C N S 201
ILE C C N N 202
ILE O O N N 203
ILE CB C N S 204
ILE CG1 C N N 205
ILE CG2 C N N 206
ILE CD1 C N N 207
ILE OXT O N N 208
ILE H H N N 209
ILE H2 H N N 210
ILE HA H N N 211
ILE HB H N N 212
ILE HG12 H N N 213
ILE HG13 H N N 214
ILE HG21 H N N 215
ILE HG22 H N N 216
ILE HG23 H N N 217
ILE HD11 H N N 218
ILE HD12 H N N 219
ILE HD13 H N N 220
ILE HXT H N N 221
LEU N N N N 222
LEU CA C N S 223
LEU C C N N 224
LEU O O N N 225
LEU CB C N N 226
LEU CG C N N 227
LEU CD1 C N N 228
LEU CD2 C N N 229
LEU OXT O N N 230
LEU H H N N 231
LEU H2 H N N 232
LEU HA H N N 233
LEU HB2 H N N 234
LEU HB3 H N N 235
LEU HG H N N 236
LEU HD11 H N N 237
LEU HD12 H N N 238
LEU HD13 H N N 239
LEU HD21 H N N 240
LEU HD22 H N N 241
LEU HD23 H N N 242
LEU HXT H N N 243
LYS N N N N 244
LYS CA C N S 245
LYS C C N N 246
LYS O O N N 247
LYS CB C N N 248
LYS CG C N N 249
LYS CD C N N 250
LYS CE C N N 251
LYS NZ N N N 252
LYS OXT O N N 253
LYS H H N N 254
LYS H2 H N N 255
LYS HA H N N 256
LYS HB2 H N N 257
LYS HB3 H N N 258
LYS HG2 H N N 259
LYS HG3 H N N 260
LYS HD2 H N N 261
LYS HD3 H N N 262
LYS HE2 H N N 263
LYS HE3 H N N 264
LYS HZ1 H N N 265
LYS HZ2 H N N 266
LYS HZ3 H N N 267
LYS HXT H N N 268
MET N N N N 269
MET CA C N S 270
MET C C N N 271
MET O O N N 272
MET CB C N N 273
MET CG C N N 274
MET SD S N N 275
MET CE C N N 276
MET OXT O N N 277
MET H H N N 278
MET H2 H N N 279
MET HA H N N 280
MET HB2 H N N 281
MET HB3 H N N 282
MET HG2 H N N 283
MET HG3 H N N 284
MET HE1 H N N 285
MET HE2 H N N 286
MET HE3 H N N 287
MET HXT H N N 288
PHE N N N N 289
PHE CA C N S 290
PHE C C N N 291
PHE O O N N 292
PHE CB C N N 293
PHE CG C Y N 294
PHE CD1 C Y N 295
PHE CD2 C Y N 296
PHE CE1 C Y N 297
PHE CE2 C Y N 298
PHE CZ C Y N 299
PHE OXT O N N 300
PHE H H N N 301
PHE H2 H N N 302
PHE HA H N N 303
PHE HB2 H N N 304
PHE HB3 H N N 305
PHE HD1 H N N 306
PHE HD2 H N N 307
PHE HE1 H N N 308
PHE HE2 H N N 309
PHE HZ H N N 310
PHE HXT H N N 311
PRO N N N N 312
PRO CA C N S 313
PRO C C N N 314
PRO O O N N 315
PRO CB C N N 316
PRO CG C N N 317
PRO CD C N N 318
PRO OXT O N N 319
PRO H H N N 320
PRO HA H N N 321
PRO HB2 H N N 322
PRO HB3 H N N 323
PRO HG2 H N N 324
PRO HG3 H N N 325
PRO HD2 H N N 326
PRO HD3 H N N 327
PRO HXT H N N 328
SER N N N N 329
SER CA C N S 330
SER C C N N 331
SER O O N N 332
SER CB C N N 333
SER OG O N N 334
SER OXT O N N 335
SER H H N N 336
SER H2 H N N 337
SER HA H N N 338
SER HB2 H N N 339
SER HB3 H N N 340
SER HG H N N 341
SER HXT H N N 342
THR N N N N 343
THR CA C N S 344
THR C C N N 345
THR O O N N 346
THR CB C N R 347
THR OG1 O N N 348
THR CG2 C N N 349
THR OXT O N N 350
THR H H N N 351
THR H2 H N N 352
THR HA H N N 353
THR HB H N N 354
THR HG1 H N N 355
THR HG21 H N N 356
THR HG22 H N N 357
THR HG23 H N N 358
THR HXT H N N 359
TRP N N N N 360
TRP CA C N S 361
TRP C C N N 362
TRP O O N N 363
TRP CB C N N 364
TRP CG C Y N 365
TRP CD1 C Y N 366
TRP CD2 C Y N 367
TRP NE1 N Y N 368
TRP CE2 C Y N 369
TRP CE3 C Y N 370
TRP CZ2 C Y N 371
TRP CZ3 C Y N 372
TRP CH2 C Y N 373
TRP OXT O N N 374
TRP H H N N 375
TRP H2 H N N 376
TRP HA H N N 377
TRP HB2 H N N 378
TRP HB3 H N N 379
TRP HD1 H N N 380
TRP HE1 H N N 381
TRP HE3 H N N 382
TRP HZ2 H N N 383
TRP HZ3 H N N 384
TRP HH2 H N N 385
TRP HXT H N N 386
VAL N N N N 387
VAL CA C N S 388
VAL C C N N 389
VAL O O N N 390
VAL CB C N N 391
VAL CG1 C N N 392
VAL CG2 C N N 393
VAL OXT O N N 394
VAL H H N N 395
VAL H2 H N N 396
VAL HA H N N 397
VAL HB H N N 398
VAL HG11 H N N 399
VAL HG12 H N N 400
VAL HG13 H N N 401
VAL HG21 H N N 402
VAL HG22 H N N 403
VAL HG23 H N N 404
VAL HXT H N N 405
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
4HH SU CT sing N N 1
4HH CB CA sing N N 2
4HH CB OG sing N N 3
4HH CL1 CK sing N N 4
4HH CT CS sing N N 5
4HH CA N sing N N 6
4HH CA C sing N N 7
4HH O2P P doub N N 8
4HH O C doub N N 9
4HH CS NR sing N N 10
4HH O3P P sing N N 11
4HH O3P CJ sing N N 12
4HH OG P sing N N 13
4HH P O1P sing N N 14
4HH CK CL2 sing N N 15
4HH CK CJ sing N N 16
4HH CK CM sing N N 17
4HH CP CQ sing N N 18
4HH CP CO sing N N 19
4HH NN CL3 sing N N 20
4HH NN CO sing N N 21
4HH NR CQ sing N N 22
4HH CL3 CM sing N N 23
4HH CL3 ON doub N N 24
4HH CQ OR doub N N 25
4HH CM OM sing N N 26
4HH CA HA sing N N 27
4HH N H sing N N 28
4HH N H2 sing N N 29
4HH CB HB3 sing N N 30
4HH CB HB2 sing N N 31
4HH CJ HJ3 sing N N 32
4HH CJ HJ2 sing N N 33
4HH CL1 HL13 sing N N 34
4HH CL1 HL12 sing N N 35
4HH CL1 HL11 sing N N 36
4HH CL2 HL21 sing N N 37
4HH CL2 HL23 sing N N 38
4HH CL2 HL22 sing N N 39
4HH CM HL3 sing N N 40
4HH OM HM sing N N 41
4HH NN HN sing N N 42
4HH O1P H4 sing N N 43
4HH CO HO2 sing N N 44
4HH CO HO3 sing N N 45
4HH CP HP3 sing N N 46
4HH CP HP2 sing N N 47
4HH CS HS2 sing N N 48
4HH CS HS3 sing N N 49
4HH CT HT3 sing N N 50
4HH CT HT2 sing N N 51
4HH NR HR sing N N 52
4HH SU HU sing N N 53
4HH C OXT sing N N 54
4HH OXT HXT sing N N 55
ALA N CA sing N N 56
ALA N H sing N N 57
ALA N H2 sing N N 58
ALA CA C sing N N 59
ALA CA CB sing N N 60
ALA CA HA sing N N 61
ALA C O doub N N 62
ALA C OXT sing N N 63
ALA CB HB1 sing N N 64
ALA CB HB2 sing N N 65
ALA CB HB3 sing N N 66
ALA OXT HXT sing N N 67
ARG N CA sing N N 68
ARG N H sing N N 69
ARG N H2 sing N N 70
ARG CA C sing N N 71
ARG CA CB sing N N 72
ARG CA HA sing N N 73
ARG C O doub N N 74
ARG C OXT sing N N 75
ARG CB CG sing N N 76
ARG CB HB2 sing N N 77
ARG CB HB3 sing N N 78
ARG CG CD sing N N 79
ARG CG HG2 sing N N 80
ARG CG HG3 sing N N 81
ARG CD NE sing N N 82
ARG CD HD2 sing N N 83
ARG CD HD3 sing N N 84
ARG NE CZ sing N N 85
ARG NE HE sing N N 86
ARG CZ NH1 sing N N 87
ARG CZ NH2 doub N N 88
ARG NH1 HH11 sing N N 89
ARG NH1 HH12 sing N N 90
ARG NH2 HH21 sing N N 91
ARG NH2 HH22 sing N N 92
ARG OXT HXT sing N N 93
ASN N CA sing N N 94
ASN N H sing N N 95
ASN N H2 sing N N 96
ASN CA C sing N N 97
ASN CA CB sing N N 98
ASN CA HA sing N N 99
ASN C O doub N N 100
ASN C OXT sing N N 101
ASN CB CG sing N N 102
ASN CB HB2 sing N N 103
ASN CB HB3 sing N N 104
ASN CG OD1 doub N N 105
ASN CG ND2 sing N N 106
ASN ND2 HD21 sing N N 107
ASN ND2 HD22 sing N N 108
ASN OXT HXT sing N N 109
ASP N CA sing N N 110
ASP N H sing N N 111
ASP N H2 sing N N 112
ASP CA C sing N N 113
ASP CA CB sing N N 114
ASP CA HA sing N N 115
ASP C O doub N N 116
ASP C OXT sing N N 117
ASP CB CG sing N N 118
ASP CB HB2 sing N N 119
ASP CB HB3 sing N N 120
ASP CG OD1 doub N N 121
ASP CG OD2 sing N N 122
ASP OD2 HD2 sing N N 123
ASP OXT HXT sing N N 124
GLN N CA sing N N 125
GLN N H sing N N 126
GLN N H2 sing N N 127
GLN CA C sing N N 128
GLN CA CB sing N N 129
GLN CA HA sing N N 130
GLN C O doub N N 131
GLN C OXT sing N N 132
GLN CB CG sing N N 133
GLN CB HB2 sing N N 134
GLN CB HB3 sing N N 135
GLN CG CD sing N N 136
GLN CG HG2 sing N N 137
GLN CG HG3 sing N N 138
GLN CD OE1 doub N N 139
GLN CD NE2 sing N N 140
GLN NE2 HE21 sing N N 141
GLN NE2 HE22 sing N N 142
GLN OXT HXT sing N N 143
GLU N CA sing N N 144
GLU N H sing N N 145
GLU N H2 sing N N 146
GLU CA C sing N N 147
GLU CA CB sing N N 148
GLU CA HA sing N N 149
GLU C O doub N N 150
GLU C OXT sing N N 151
GLU CB CG sing N N 152
GLU CB HB2 sing N N 153
GLU CB HB3 sing N N 154
GLU CG CD sing N N 155
GLU CG HG2 sing N N 156
GLU CG HG3 sing N N 157
GLU CD OE1 doub N N 158
GLU CD OE2 sing N N 159
GLU OE2 HE2 sing N N 160
GLU OXT HXT sing N N 161
GLY N CA sing N N 162
GLY N H sing N N 163
GLY N H2 sing N N 164
GLY CA C sing N N 165
GLY CA HA2 sing N N 166
GLY CA HA3 sing N N 167
GLY C O doub N N 168
GLY C OXT sing N N 169
GLY OXT HXT sing N N 170
HIS N CA sing N N 171
HIS N H sing N N 172
HIS N H2 sing N N 173
HIS CA C sing N N 174
HIS CA CB sing N N 175
HIS CA HA sing N N 176
HIS C O doub N N 177
HIS C OXT sing N N 178
HIS CB CG sing N N 179
HIS CB HB2 sing N N 180
HIS CB HB3 sing N N 181
HIS CG ND1 sing Y N 182
HIS CG CD2 doub Y N 183
HIS ND1 CE1 doub Y N 184
HIS ND1 HD1 sing N N 185
HIS CD2 NE2 sing Y N 186
HIS CD2 HD2 sing N N 187
HIS CE1 NE2 sing Y N 188
HIS CE1 HE1 sing N N 189
HIS NE2 HE2 sing N N 190
HIS OXT HXT sing N N 191
ILE N CA sing N N 192
ILE N H sing N N 193
ILE N H2 sing N N 194
ILE CA C sing N N 195
ILE CA CB sing N N 196
ILE CA HA sing N N 197
ILE C O doub N N 198
ILE C OXT sing N N 199
ILE CB CG1 sing N N 200
ILE CB CG2 sing N N 201
ILE CB HB sing N N 202
ILE CG1 CD1 sing N N 203
ILE CG1 HG12 sing N N 204
ILE CG1 HG13 sing N N 205
ILE CG2 HG21 sing N N 206
ILE CG2 HG22 sing N N 207
ILE CG2 HG23 sing N N 208
ILE CD1 HD11 sing N N 209
ILE CD1 HD12 sing N N 210
ILE CD1 HD13 sing N N 211
ILE OXT HXT sing N N 212
LEU N CA sing N N 213
LEU N H sing N N 214
LEU N H2 sing N N 215
LEU CA C sing N N 216
LEU CA CB sing N N 217
LEU CA HA sing N N 218
LEU C O doub N N 219
LEU C OXT sing N N 220
LEU CB CG sing N N 221
LEU CB HB2 sing N N 222
LEU CB HB3 sing N N 223
LEU CG CD1 sing N N 224
LEU CG CD2 sing N N 225
LEU CG HG sing N N 226
LEU CD1 HD11 sing N N 227
LEU CD1 HD12 sing N N 228
LEU CD1 HD13 sing N N 229
LEU CD2 HD21 sing N N 230
LEU CD2 HD22 sing N N 231
LEU CD2 HD23 sing N N 232
LEU OXT HXT sing N N 233
LYS N CA sing N N 234
LYS N H sing N N 235
LYS N H2 sing N N 236
LYS CA C sing N N 237
LYS CA CB sing N N 238
LYS CA HA sing N N 239
LYS C O doub N N 240
LYS C OXT sing N N 241
LYS CB CG sing N N 242
LYS CB HB2 sing N N 243
LYS CB HB3 sing N N 244
LYS CG CD sing N N 245
LYS CG HG2 sing N N 246
LYS CG HG3 sing N N 247
LYS CD CE sing N N 248
LYS CD HD2 sing N N 249
LYS CD HD3 sing N N 250
LYS CE NZ sing N N 251
LYS CE HE2 sing N N 252
LYS CE HE3 sing N N 253
LYS NZ HZ1 sing N N 254
LYS NZ HZ2 sing N N 255
LYS NZ HZ3 sing N N 256
LYS OXT HXT sing N N 257
MET N CA sing N N 258
MET N H sing N N 259
MET N H2 sing N N 260
MET CA C sing N N 261
MET CA CB sing N N 262
MET CA HA sing N N 263
MET C O doub N N 264
MET C OXT sing N N 265
MET CB CG sing N N 266
MET CB HB2 sing N N 267
MET CB HB3 sing N N 268
MET CG SD sing N N 269
MET CG HG2 sing N N 270
MET CG HG3 sing N N 271
MET SD CE sing N N 272
MET CE HE1 sing N N 273
MET CE HE2 sing N N 274
MET CE HE3 sing N N 275
MET OXT HXT sing N N 276
PHE N CA sing N N 277
PHE N H sing N N 278
PHE N H2 sing N N 279
PHE CA C sing N N 280
PHE CA CB sing N N 281
PHE CA HA sing N N 282
PHE C O doub N N 283
PHE C OXT sing N N 284
PHE CB CG sing N N 285
PHE CB HB2 sing N N 286
PHE CB HB3 sing N N 287
PHE CG CD1 doub Y N 288
PHE CG CD2 sing Y N 289
PHE CD1 CE1 sing Y N 290
PHE CD1 HD1 sing N N 291
PHE CD2 CE2 doub Y N 292
PHE CD2 HD2 sing N N 293
PHE CE1 CZ doub Y N 294
PHE CE1 HE1 sing N N 295
PHE CE2 CZ sing Y N 296
PHE CE2 HE2 sing N N 297
PHE CZ HZ sing N N 298
PHE OXT HXT sing N N 299
PRO N CA sing N N 300
PRO N CD sing N N 301
PRO N H sing N N 302
PRO CA C sing N N 303
PRO CA CB sing N N 304
PRO CA HA sing N N 305
PRO C O doub N N 306
PRO C OXT sing N N 307
PRO CB CG sing N N 308
PRO CB HB2 sing N N 309
PRO CB HB3 sing N N 310
PRO CG CD sing N N 311
PRO CG HG2 sing N N 312
PRO CG HG3 sing N N 313
PRO CD HD2 sing N N 314
PRO CD HD3 sing N N 315
PRO OXT HXT sing N N 316
SER N CA sing N N 317
SER N H sing N N 318
SER N H2 sing N N 319
SER CA C sing N N 320
SER CA CB sing N N 321
SER CA HA sing N N 322
SER C O doub N N 323
SER C OXT sing N N 324
SER CB OG sing N N 325
SER CB HB2 sing N N 326
SER CB HB3 sing N N 327
SER OG HG sing N N 328
SER OXT HXT sing N N 329
THR N CA sing N N 330
THR N H sing N N 331
THR N H2 sing N N 332
THR CA C sing N N 333
THR CA CB sing N N 334
THR CA HA sing N N 335
THR C O doub N N 336
THR C OXT sing N N 337
THR CB OG1 sing N N 338
THR CB CG2 sing N N 339
THR CB HB sing N N 340
THR OG1 HG1 sing N N 341
THR CG2 HG21 sing N N 342
THR CG2 HG22 sing N N 343
THR CG2 HG23 sing N N 344
THR OXT HXT sing N N 345
TRP N CA sing N N 346
TRP N H sing N N 347
TRP N H2 sing N N 348
TRP CA C sing N N 349
TRP CA CB sing N N 350
TRP CA HA sing N N 351
TRP C O doub N N 352
TRP C OXT sing N N 353
TRP CB CG sing N N 354
TRP CB HB2 sing N N 355
TRP CB HB3 sing N N 356
TRP CG CD1 doub Y N 357
TRP CG CD2 sing Y N 358
TRP CD1 NE1 sing Y N 359
TRP CD1 HD1 sing N N 360
TRP CD2 CE2 doub Y N 361
TRP CD2 CE3 sing Y N 362
TRP NE1 CE2 sing Y N 363
TRP NE1 HE1 sing N N 364
TRP CE2 CZ2 sing Y N 365
TRP CE3 CZ3 doub Y N 366
TRP CE3 HE3 sing N N 367
TRP CZ2 CH2 doub Y N 368
TRP CZ2 HZ2 sing N N 369
TRP CZ3 CH2 sing Y N 370
TRP CZ3 HZ3 sing N N 371
TRP CH2 HH2 sing N N 372
TRP OXT HXT sing N N 373
VAL N CA sing N N 374
VAL N H sing N N 375
VAL N H2 sing N N 376
VAL CA C sing N N 377
VAL CA CB sing N N 378
VAL CA HA sing N N 379
VAL C O doub N N 380
VAL C OXT sing N N 381
VAL CB CG1 sing N N 382
VAL CB CG2 sing N N 383
VAL CB HB sing N N 384
VAL CG1 HG11 sing N N 385
VAL CG1 HG12 sing N N 386
VAL CG1 HG13 sing N N 387
VAL CG2 HG21 sing N N 388
VAL CG2 HG22 sing N N 389
VAL CG2 HG23 sing N N 390
VAL OXT HXT sing N N 391
#
_pdbx_audit_support.funding_organization 'German Research Foundation (DFG)'
_pdbx_audit_support.country Germany
_pdbx_audit_support.grant_number CA294/16-1
_pdbx_audit_support.ordinal 1
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id 4HH
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id 4HH
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_nmr_spectrometer.spectrometer_id
_pdbx_nmr_spectrometer.model
_pdbx_nmr_spectrometer.type
_pdbx_nmr_spectrometer.manufacturer
_pdbx_nmr_spectrometer.field_strength
_pdbx_nmr_spectrometer.details
1 'AVANCE III' ? Bruker 600 ?
2 'AVANCE III' ? Bruker 800 ?
3 'AVANCE III HD' ? Bruker 850 ?
#
_atom_sites.entry_id 8QPY
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.Cartn_transform_axes ?
_atom_sites.fract_transf_matrix[1][1] 1.000000
_atom_sites.fract_transf_matrix[1][2] 0.000000
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] 0.000000
_atom_sites.fract_transf_matrix[2][2] 1.000000
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] 0.000000
_atom_sites.fract_transf_matrix[3][3] 1.000000
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
C
H
N
O
P
S
#
loop_