data_8QRX # _entry.id 8QRX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8QRX pdb_00008qrx 10.2210/pdb8qrx/pdb WWPDB D_1292133649 ? ? BMRB 34869 ? 10.13018/BMR34869 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-06-26 2 'Structure model' 1 1 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8QRX _pdbx_database_status.recvd_initial_deposition_date 2023-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details ;Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase in its substrate-loaded state ; _pdbx_database_related.db_id 34869 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email t.carlomagno@bham.ac.uk _pdbx_contact_author.name_first Teresa _pdbx_contact_author.name_last Carlomagno _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2437-2760 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Karanth, M.N.' 1 0000-0003-3392-6523 'Kirkpatrick, J.P.' 2 0000-0002-9761-3377 'Carlomagno, T.' 3 0000-0002-2437-2760 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first eadm9404 _citation.page_last eadm9404 _citation.title 'The specificity of intermodular recognition in a prototypical nonribosomal peptide synthetase depends on an adaptor domain.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.adm9404 _citation.pdbx_database_id_PubMed 38896613 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Karanth, M.N.' 1 0000-0003-3392-6523 primary 'Kirkpatrick, J.P.' 2 0000-0002-9761-3377 primary 'Krausze, J.' 3 0000-0001-5333-8046 primary 'Schmelz, S.' 4 0000-0002-2511-7593 primary 'Scrima, A.' 5 0000-0003-2760-611X primary 'Carlomagno, T.' 6 0000-0002-2437-2760 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TomAPCP substrate-loaded from the Tomaymycin non-ribosomal peptide synthetase' _entity.formula_weight 10483.499 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ;First four residues (GPMA) in the protein are from cloning artifacts. Therefore, the appropriate residue numbering has the first residue (G) designated as residue-number '-3', so that the fifth residue has residue-number '1'. A special modified residue SPA is designated for the serine residue covalently linked to a 4'-phosphopantetheine-anthranilate prosthetic group. ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGN(WP9)LHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARF VEQSRDTGRNPAAQTQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGNXLHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARFVEQS RDTGRNPAAQTQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ALA n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 GLN n 1 9 ASN n 1 10 PRO n 1 11 LEU n 1 12 GLU n 1 13 THR n 1 14 VAL n 1 15 VAL n 1 16 LEU n 1 17 GLN n 1 18 ALA n 1 19 TRP n 1 20 LYS n 1 21 ASP n 1 22 ILE n 1 23 SER n 1 24 GLY n 1 25 ALA n 1 26 ASP n 1 27 ASP n 1 28 PHE n 1 29 THR n 1 30 THR n 1 31 THR n 1 32 ASP n 1 33 SER n 1 34 PHE n 1 35 LEU n 1 36 GLY n 1 37 HIS n 1 38 GLY n 1 39 GLY n 1 40 ASN n 1 41 WP9 n 1 42 LEU n 1 43 HIS n 1 44 PHE n 1 45 VAL n 1 46 GLN n 1 47 LEU n 1 48 ALA n 1 49 SER n 1 50 ARG n 1 51 LEU n 1 52 GLN n 1 53 LYS n 1 54 ILE n 1 55 PHE n 1 56 GLY n 1 57 VAL n 1 58 GLU n 1 59 VAL n 1 60 SER n 1 61 THR n 1 62 GLU n 1 63 ASP n 1 64 VAL n 1 65 PHE n 1 66 ARG n 1 67 HIS n 1 68 GLY n 1 69 THR n 1 70 VAL n 1 71 GLU n 1 72 GLN n 1 73 LEU n 1 74 ALA n 1 75 ARG n 1 76 PHE n 1 77 VAL n 1 78 GLU n 1 79 GLN n 1 80 SER n 1 81 ARG n 1 82 ASP n 1 83 THR n 1 84 GLY n 1 85 ARG n 1 86 ASN n 1 87 PRO n 1 88 ALA n 1 89 ALA n 1 90 GLN n 1 91 THR n 1 92 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 92 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces regensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 68263 _entity_src_gen.pdbx_gene_src_variant FH6421 _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 WP9 non-polymer . ;~{S}-[2-[3-[[(2~{R})-4-[[(2~{S})-2-azanyl-3-oxidanylidene-propoxy]-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-azanylbenzenecarbothioate ; ? 'C21 H33 N4 O9 P S' 548.547 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 PRO 2 -2 -2 PRO PRO A . n A 1 3 MET 3 -1 -1 MET MET A . n A 1 4 ALA 4 0 0 ALA ALA A . n A 1 5 THR 5 1 1 THR THR A . n A 1 6 ALA 6 2 2 ALA ALA A . n A 1 7 VAL 7 3 3 VAL VAL A . n A 1 8 GLN 8 4 4 GLN GLN A . n A 1 9 ASN 9 5 5 ASN ASN A . n A 1 10 PRO 10 6 6 PRO PRO A . n A 1 11 LEU 11 7 7 LEU LEU A . n A 1 12 GLU 12 8 8 GLU GLU A . n A 1 13 THR 13 9 9 THR THR A . n A 1 14 VAL 14 10 10 VAL VAL A . n A 1 15 VAL 15 11 11 VAL VAL A . n A 1 16 LEU 16 12 12 LEU LEU A . n A 1 17 GLN 17 13 13 GLN GLN A . n A 1 18 ALA 18 14 14 ALA ALA A . n A 1 19 TRP 19 15 15 TRP TRP A . n A 1 20 LYS 20 16 16 LYS LYS A . n A 1 21 ASP 21 17 17 ASP ASP A . n A 1 22 ILE 22 18 18 ILE ILE A . n A 1 23 SER 23 19 19 SER SER A . n A 1 24 GLY 24 20 20 GLY GLY A . n A 1 25 ALA 25 21 21 ALA ALA A . n A 1 26 ASP 26 22 22 ASP ASP A . n A 1 27 ASP 27 23 23 ASP ASP A . n A 1 28 PHE 28 24 24 PHE PHE A . n A 1 29 THR 29 25 25 THR THR A . n A 1 30 THR 30 26 26 THR THR A . n A 1 31 THR 31 27 27 THR THR A . n A 1 32 ASP 32 28 28 ASP ASP A . n A 1 33 SER 33 29 29 SER SER A . n A 1 34 PHE 34 30 30 PHE PHE A . n A 1 35 LEU 35 31 31 LEU LEU A . n A 1 36 GLY 36 32 32 GLY GLY A . n A 1 37 HIS 37 33 33 HIS HIS A . n A 1 38 GLY 38 34 34 GLY GLY A . n A 1 39 GLY 39 35 35 GLY GLY A . n A 1 40 ASN 40 36 36 ASN ASN A . n A 1 41 WP9 41 37 37 WP9 SPA A . n A 1 42 LEU 42 38 38 LEU LEU A . n A 1 43 HIS 43 39 39 HIS HIS A . n A 1 44 PHE 44 40 40 PHE PHE A . n A 1 45 VAL 45 41 41 VAL VAL A . n A 1 46 GLN 46 42 42 GLN GLN A . n A 1 47 LEU 47 43 43 LEU LEU A . n A 1 48 ALA 48 44 44 ALA ALA A . n A 1 49 SER 49 45 45 SER SER A . n A 1 50 ARG 50 46 46 ARG ARG A . n A 1 51 LEU 51 47 47 LEU LEU A . n A 1 52 GLN 52 48 48 GLN GLN A . n A 1 53 LYS 53 49 49 LYS LYS A . n A 1 54 ILE 54 50 50 ILE ILE A . n A 1 55 PHE 55 51 51 PHE PHE A . n A 1 56 GLY 56 52 52 GLY GLY A . n A 1 57 VAL 57 53 53 VAL VAL A . n A 1 58 GLU 58 54 54 GLU GLU A . n A 1 59 VAL 59 55 55 VAL VAL A . n A 1 60 SER 60 56 56 SER SER A . n A 1 61 THR 61 57 57 THR THR A . n A 1 62 GLU 62 58 58 GLU GLU A . n A 1 63 ASP 63 59 59 ASP ASP A . n A 1 64 VAL 64 60 60 VAL VAL A . n A 1 65 PHE 65 61 61 PHE PHE A . n A 1 66 ARG 66 62 62 ARG ARG A . n A 1 67 HIS 67 63 63 HIS HIS A . n A 1 68 GLY 68 64 64 GLY GLY A . n A 1 69 THR 69 65 65 THR THR A . n A 1 70 VAL 70 66 66 VAL VAL A . n A 1 71 GLU 71 67 67 GLU GLU A . n A 1 72 GLN 72 68 68 GLN GLN A . n A 1 73 LEU 73 69 69 LEU LEU A . n A 1 74 ALA 74 70 70 ALA ALA A . n A 1 75 ARG 75 71 71 ARG ARG A . n A 1 76 PHE 76 72 72 PHE PHE A . n A 1 77 VAL 77 73 73 VAL VAL A . n A 1 78 GLU 78 74 74 GLU GLU A . n A 1 79 GLN 79 75 75 GLN GLN A . n A 1 80 SER 80 76 76 SER SER A . n A 1 81 ARG 81 77 77 ARG ARG A . n A 1 82 ASP 82 78 78 ASP ASP A . n A 1 83 THR 83 79 79 THR THR A . n A 1 84 GLY 84 80 80 GLY GLY A . n A 1 85 ARG 85 81 81 ARG ARG A . n A 1 86 ASN 86 82 82 ASN ASN A . n A 1 87 PRO 87 83 83 PRO PRO A . n A 1 88 ALA 88 84 84 ALA ALA A . n A 1 89 ALA 89 85 85 ALA ALA A . n A 1 90 GLN 90 86 86 GLN GLN A . n A 1 91 THR 91 87 87 THR THR A . n A 1 92 GLN 92 88 88 GLN GLN A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8QRX _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8QRX _struct.title ;Solution NMR structure of the peptidyl carrier domain TomAPCP from the Tomaymycin non-ribosomal peptide synthetase in its substrate-loaded state ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8QRX _struct_keywords.text ;Non-ribosomal peptide synthetase, NRPS, Tomaymycin, Peptidyl carrier protein, PCP, phosphopantetheine, Donor, loaded, substrate-loaded, BIOSYNTHETIC PROTEIN ; _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8QRX _struct_ref.pdbx_db_accession 8QRX _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8QRX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8QRX _struct_ref_seq.db_align_beg -3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 88 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -3 _struct_ref_seq.pdbx_auth_seq_align_end 88 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 11 ? SER A 23 ? LEU A 7 SER A 19 1 ? 13 HELX_P HELX_P2 AA2 WP9 A 41 ? PHE A 55 ? WP9 A 37 PHE A 51 1 ? 15 HELX_P HELX_P3 AA3 THR A 61 ? HIS A 67 ? THR A 57 HIS A 63 1 ? 7 HELX_P HELX_P4 AA4 VAL A 70 ? THR A 83 ? VAL A 66 THR A 79 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A ASN 40 C ? ? ? 1_555 A WP9 41 N ? ? A ASN 36 A WP9 37 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale one ? A WP9 41 C ? ? ? 1_555 A LEU 42 N ? ? A WP9 37 A LEU 38 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OD1 A ASP 28 ? ? HD1 A HIS 33 ? ? 1.59 2 5 HG1 A THR 25 ? ? OD2 A ASP 28 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A -2 ? ? -58.62 108.64 2 1 ASN A 82 ? ? 60.27 85.16 3 2 ALA A 2 ? ? -164.27 48.64 4 2 THR A 87 ? ? -153.74 -71.87 5 3 MET A -1 ? ? 74.00 -61.72 6 3 ALA A 2 ? ? -161.89 104.33 7 4 GLN A 4 ? ? -109.94 60.68 8 4 ASN A 5 ? ? 63.65 72.28 9 4 ARG A 81 ? ? -121.58 -53.85 10 4 ASN A 82 ? ? 54.17 81.40 11 5 ALA A 0 ? ? 69.73 146.96 12 5 THR A 1 ? ? 74.60 -51.71 13 5 ALA A 2 ? ? -99.97 44.45 14 5 ALA A 85 ? ? -99.40 41.70 15 6 ALA A 0 ? ? 179.84 -74.15 16 6 ALA A 2 ? ? 63.32 -175.92 17 6 GLN A 4 ? ? -139.46 -60.54 18 7 ASN A 5 ? ? -164.97 65.38 19 7 THR A 87 ? ? 74.10 -65.35 20 8 THR A 1 ? ? -107.85 -70.48 21 8 PRO A 6 ? ? -79.77 -117.58 22 8 ALA A 84 ? ? -54.04 102.06 23 9 ASP A 23 ? ? -90.03 30.54 24 9 ASN A 82 ? ? 68.64 121.84 25 9 ALA A 85 ? ? 66.19 120.43 26 9 GLN A 86 ? ? 62.79 -161.52 27 9 THR A 87 ? ? 70.17 33.76 28 10 THR A 1 ? ? 67.60 86.67 29 10 GLN A 4 ? ? 69.05 -83.84 30 10 PRO A 6 ? ? -60.37 -77.55 31 10 ASN A 82 ? ? 71.93 120.57 # _pdbx_entry_details.entry_id 8QRX _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # _pdbx_nmr_ensemble.entry_id 8QRX _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8QRX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;350 uM [U-13C; U-15N] TomAPCP substrate-loaded, 50 mM sodium phosphate, 150 mM sodium chloride, 0.02 w/v sodium azide, 10 v/v [U-2H] D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C15N_sample solution ? 3 ;100 uM [U-13C; U-15N] TomAPCP substrate-loaded, 50 mM sodium phosphate, 150 mM sodium chloride, 0.02 w/v sodium azide, 10 v/v [U-2H] D2O, 90% H2O/10% D2O ; '90% H2O/10% D2O' 13C15N_sample_2 solution ? 2 ;500 uM [U-13C; U-15N] TomAPCP substrate-loaded, 50 mM sodium phosphate, 150 mM sodium chloride, 0.02 % w/v sodium azide, 100 v/v [U-2H] D2O, 100% D2O ; '100% D2O' 13C15N_D2O_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'TomAPCP substrate-loaded' 350 ? uM '[U-13C; U-15N]' 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 150 ? mM 'natural abundance' 1 'sodium azide' 0.02 ? w/v 'natural abundance' 1 D2O 10 ? v/v '[U-2H]' 3 'TomAPCP substrate-loaded' 100 ? uM '[U-13C; U-15N]' 3 'sodium phosphate' 50 ? mM 'natural abundance' 3 'sodium chloride' 150 ? mM 'natural abundance' 3 'sodium azide' 0.02 ? w/v 'natural abundance' 3 D2O 10 ? v/v '[U-2H]' 2 'TomAPCP substrate-loaded' 500 ? uM '[U-13C; U-15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 'sodium chloride' 150 ? mM 'natural abundance' 2 'sodium azide' 0.02 ? '% w/v' 'natural abundance' 2 D2O 100 ? v/v '[U-2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 265 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 3 '2D 1H-13C HSQC' 2 isotropic 3 1 2 '2D 1H-13C HSQC' 2 isotropic 4 1 1 '3D 1H-15N NOESY' 1 isotropic 5 1 2 '3D 1H-13C NOESY' 2 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 8QRX 'simulated annealing' ? 7 8QRX 'torsion angle dynamics' ? 8 8QRX 'molecular dynamics' ? 9 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 3.2 'Bruker Biospin' 2 processing NMRPipe 10.2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'peak picking' 'CcpNmr Analysis' 2.4 CCPN 4 'chemical shift assignment' 'CcpNmr Analysis' 2.4 CCPN 5 'data analysis' 'CcpNmr Analysis' 2.4 CCPN 6 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 7 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 8 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 9 'structure calculation' CNS 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 WP9 N N N N 350 WP9 CA C N S 351 WP9 C C N N 352 WP9 O O N N 353 WP9 CB C N N 354 WP9 OG O N N 355 WP9 P24 P N N 356 WP9 C11 C N N 357 WP9 O11 O N N 358 WP9 C12 C Y N 359 WP9 C13 C Y N 360 WP9 N13 N N N 361 WP9 C14 C Y N 362 WP9 C15 C Y N 363 WP9 C16 C Y N 364 WP9 C17 C Y N 365 WP9 O23 O N N 366 WP9 O26 O N N 367 WP9 O27 O N N 368 WP9 C28 C N N 369 WP9 C29 C N N 370 WP9 C30 C N N 371 WP9 C31 C N N 372 WP9 C32 C N R 373 WP9 O33 O N N 374 WP9 C34 C N N 375 WP9 O35 O N N 376 WP9 N36 N N N 377 WP9 C37 C N N 378 WP9 C38 C N N 379 WP9 C39 C N N 380 WP9 O40 O N N 381 WP9 N41 N N N 382 WP9 C42 C N N 383 WP9 C43 C N N 384 WP9 S44 S N N 385 WP9 HN H N N 386 WP9 H1 H N N 387 WP9 HA H N N 388 WP9 H3 H N N 389 WP9 HB1 H N N 390 WP9 HB2 H N N 391 WP9 H131 H N N 392 WP9 H132 H N N 393 WP9 H14 H N N 394 WP9 H15 H N N 395 WP9 H16 H N N 396 WP9 H17 H N N 397 WP9 H4 H N N 398 WP9 H281 H N N 399 WP9 H282 H N N 400 WP9 H302 H N N 401 WP9 H303 H N N 402 WP9 H301 H N N 403 WP9 H312 H N N 404 WP9 H313 H N N 405 WP9 H311 H N N 406 WP9 H32 H N N 407 WP9 H33 H N N 408 WP9 H36 H N N 409 WP9 H371 H N N 410 WP9 H372 H N N 411 WP9 H381 H N N 412 WP9 H382 H N N 413 WP9 H41 H N N 414 WP9 H422 H N N 415 WP9 H421 H N N 416 WP9 H431 H N N 417 WP9 H432 H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 VAL N CA sing N N 319 VAL N H sing N N 320 VAL N H2 sing N N 321 VAL CA C sing N N 322 VAL CA CB sing N N 323 VAL CA HA sing N N 324 VAL C O doub N N 325 VAL C OXT sing N N 326 VAL CB CG1 sing N N 327 VAL CB CG2 sing N N 328 VAL CB HB sing N N 329 VAL CG1 HG11 sing N N 330 VAL CG1 HG12 sing N N 331 VAL CG1 HG13 sing N N 332 VAL CG2 HG21 sing N N 333 VAL CG2 HG22 sing N N 334 VAL CG2 HG23 sing N N 335 VAL OXT HXT sing N N 336 WP9 C17 C15 doub Y N 337 WP9 C17 C16 sing Y N 338 WP9 C15 C13 sing Y N 339 WP9 C16 C14 doub Y N 340 WP9 C13 N13 sing N N 341 WP9 C13 C12 doub Y N 342 WP9 C14 C12 sing Y N 343 WP9 C12 C11 sing N N 344 WP9 O11 C11 doub N N 345 WP9 C11 S44 sing N N 346 WP9 O33 C32 sing N N 347 WP9 C32 C34 sing N N 348 WP9 C32 C29 sing N N 349 WP9 S44 C43 sing N N 350 WP9 C43 C42 sing N N 351 WP9 C31 C29 sing N N 352 WP9 C34 N36 sing N N 353 WP9 C34 O35 doub N N 354 WP9 N36 C37 sing N N 355 WP9 O23 P24 doub N N 356 WP9 CB CA sing N N 357 WP9 CB OG sing N N 358 WP9 C29 C28 sing N N 359 WP9 C29 C30 sing N N 360 WP9 O27 P24 sing N N 361 WP9 O27 C28 sing N N 362 WP9 C37 C38 sing N N 363 WP9 CA N sing N N 364 WP9 CA C sing N N 365 WP9 C42 N41 sing N N 366 WP9 P24 OG sing N N 367 WP9 P24 O26 sing N N 368 WP9 N41 C39 sing N N 369 WP9 O40 C39 doub N N 370 WP9 C39 C38 sing N N 371 WP9 C O doub N N 372 WP9 N HN sing N N 373 WP9 N H1 sing N N 374 WP9 CA HA sing N N 375 WP9 C H3 sing N N 376 WP9 CB HB1 sing N N 377 WP9 CB HB2 sing N N 378 WP9 N13 H131 sing N N 379 WP9 N13 H132 sing N N 380 WP9 C14 H14 sing N N 381 WP9 C15 H15 sing N N 382 WP9 C16 H16 sing N N 383 WP9 C17 H17 sing N N 384 WP9 O26 H4 sing N N 385 WP9 C28 H281 sing N N 386 WP9 C28 H282 sing N N 387 WP9 C30 H302 sing N N 388 WP9 C30 H303 sing N N 389 WP9 C30 H301 sing N N 390 WP9 C31 H312 sing N N 391 WP9 C31 H313 sing N N 392 WP9 C31 H311 sing N N 393 WP9 C32 H32 sing N N 394 WP9 O33 H33 sing N N 395 WP9 N36 H36 sing N N 396 WP9 C37 H371 sing N N 397 WP9 C37 H372 sing N N 398 WP9 C38 H381 sing N N 399 WP9 C38 H382 sing N N 400 WP9 N41 H41 sing N N 401 WP9 C42 H422 sing N N 402 WP9 C42 H421 sing N N 403 WP9 C43 H431 sing N N 404 WP9 C43 H432 sing N N 405 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number CA294/16-1 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id WP9 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id WP9 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III HD' ? Bruker 850 ? # _atom_sites.entry_id 8QRX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O P S # loop_