data_8R27 # _entry.id 8R27 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8R27 pdb_00008r27 10.2210/pdb8r27/pdb WWPDB D_1292134462 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8R27 _pdbx_database_status.recvd_initial_deposition_date 2023-11-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'complexed with another inhibitor' 7QFM unspecified PDB 'complexed with another inhibitor' 7QB2 unspecified PDB 'complexed with another inhibitor' 7Z6U unspecified PDB 'complexed with another inhibitor' 8AFR unspecified PDB 'complexed with another inhibitor' 8R0H unspecified PDB 'complexed with another inhibitor' 8R0Q unspecified PDB 'complexed with another inhibitor' 8R0W unspecified PDB 'complexed with another inhibitor' 8R0Y unspecified PDB 'complexed with another inhibitor' 8R10 unspecified PDB 'complexed with another inhibitor' 8R18 unspecified PDB 'complexed with another inhibitor' 8R1K unspecified PDB 'complexed with another inhibitor' 8R1N unspecified PDB 'complexed with another inhibitor' 8R1P unspecified PDB 'complexed with another inhibitor' 8R1T unspecified PDB 'complexed with another inhibitor' 8R1W unspecified PDB 'complexed with another inhibitor' 8R25 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email wibke.diederich@staff.uni-marburg.de _pdbx_contact_author.name_first Wibke _pdbx_contact_author.name_last Diederich _pdbx_contact_author.name_mi E. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5671-6575 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hochban, P.M.M.' 1 0000-0003-3526-7314 'Heine, A.' 2 0000-0002-5285-4089 'Diederich, W.E.' 3 0000-0001-5671-6575 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Pim1 in complex with (Z)-4-(1-cyano-2-(4-hydroxyphenyl)vinyl)benzoic acid and Pimtide' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hochban, P.M.M.' 1 0000-0003-3526-7314 primary 'Heyder, L.' 2 ? primary 'Heine, A.' 3 0000-0002-5285-4089 primary 'Diederich, W.E.' 4 0000-0001-5671-6575 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase pim-1' 35670.477 1 2.7.11.1 R250G ? ? 2 polymer syn Pimtide 1592.850 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn '4-[(~{Z})-1-cyanoprop-1-enyl]benzoic acid' 187.195 1 ? ? ? ? 5 water nat water 18.015 112 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; ;SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIGGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; A ? 2 'polypeptide(L)' no no ARKRRRHPSGPPTA ARKRRRHPSGPPTA B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 '4-[(~{Z})-1-cyanoprop-1-enyl]benzoic acid' XJW 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 LEU n 1 4 LEU n 1 5 SER n 1 6 LYS n 1 7 ILE n 1 8 ASN n 1 9 SER n 1 10 LEU n 1 11 ALA n 1 12 HIS n 1 13 LEU n 1 14 ARG n 1 15 ALA n 1 16 ALA n 1 17 PRO n 1 18 CYS n 1 19 ASN n 1 20 ASP n 1 21 LEU n 1 22 HIS n 1 23 ALA n 1 24 THR n 1 25 LYS n 1 26 LEU n 1 27 ALA n 1 28 PRO n 1 29 GLY n 1 30 LYS n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 PRO n 1 35 LEU n 1 36 GLU n 1 37 SER n 1 38 GLN n 1 39 TYR n 1 40 GLN n 1 41 VAL n 1 42 GLY n 1 43 PRO n 1 44 LEU n 1 45 LEU n 1 46 GLY n 1 47 SER n 1 48 GLY n 1 49 GLY n 1 50 PHE n 1 51 GLY n 1 52 SER n 1 53 VAL n 1 54 TYR n 1 55 SER n 1 56 GLY n 1 57 ILE n 1 58 ARG n 1 59 VAL n 1 60 SER n 1 61 ASP n 1 62 ASN n 1 63 LEU n 1 64 PRO n 1 65 VAL n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 HIS n 1 70 VAL n 1 71 GLU n 1 72 LYS n 1 73 ASP n 1 74 ARG n 1 75 ILE n 1 76 SER n 1 77 ASP n 1 78 TRP n 1 79 GLY n 1 80 GLU n 1 81 LEU n 1 82 PRO n 1 83 ASN n 1 84 GLY n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 PRO n 1 89 MET n 1 90 GLU n 1 91 VAL n 1 92 VAL n 1 93 LEU n 1 94 LEU n 1 95 LYS n 1 96 LYS n 1 97 VAL n 1 98 SER n 1 99 SER n 1 100 GLY n 1 101 PHE n 1 102 SER n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 ARG n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TRP n 1 111 PHE n 1 112 GLU n 1 113 ARG n 1 114 PRO n 1 115 ASP n 1 116 SER n 1 117 PHE n 1 118 VAL n 1 119 LEU n 1 120 ILE n 1 121 LEU n 1 122 GLU n 1 123 ARG n 1 124 PRO n 1 125 GLU n 1 126 PRO n 1 127 VAL n 1 128 GLN n 1 129 ASP n 1 130 LEU n 1 131 PHE n 1 132 ASP n 1 133 PHE n 1 134 ILE n 1 135 THR n 1 136 GLU n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 LEU n 1 141 GLN n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 ALA n 1 146 ARG n 1 147 SER n 1 148 PHE n 1 149 PHE n 1 150 TRP n 1 151 GLN n 1 152 VAL n 1 153 LEU n 1 154 GLU n 1 155 ALA n 1 156 VAL n 1 157 ARG n 1 158 HIS n 1 159 CYS n 1 160 HIS n 1 161 ASN n 1 162 CYS n 1 163 GLY n 1 164 VAL n 1 165 LEU n 1 166 HIS n 1 167 ARG n 1 168 ASP n 1 169 ILE n 1 170 LYS n 1 171 ASP n 1 172 GLU n 1 173 ASN n 1 174 ILE n 1 175 LEU n 1 176 ILE n 1 177 ASP n 1 178 LEU n 1 179 ASN n 1 180 ARG n 1 181 GLY n 1 182 GLU n 1 183 LEU n 1 184 LYS n 1 185 LEU n 1 186 ILE n 1 187 ASP n 1 188 PHE n 1 189 GLY n 1 190 SER n 1 191 GLY n 1 192 ALA n 1 193 LEU n 1 194 LEU n 1 195 LYS n 1 196 ASP n 1 197 THR n 1 198 VAL n 1 199 TYR n 1 200 THR n 1 201 ASP n 1 202 PHE n 1 203 ASP n 1 204 GLY n 1 205 THR n 1 206 ARG n 1 207 VAL n 1 208 TYR n 1 209 SER n 1 210 PRO n 1 211 PRO n 1 212 GLU n 1 213 TRP n 1 214 ILE n 1 215 ARG n 1 216 TYR n 1 217 HIS n 1 218 ARG n 1 219 TYR n 1 220 HIS n 1 221 GLY n 1 222 ARG n 1 223 SER n 1 224 ALA n 1 225 ALA n 1 226 VAL n 1 227 TRP n 1 228 SER n 1 229 LEU n 1 230 GLY n 1 231 ILE n 1 232 LEU n 1 233 LEU n 1 234 TYR n 1 235 ASP n 1 236 MET n 1 237 VAL n 1 238 CYS n 1 239 GLY n 1 240 ASP n 1 241 ILE n 1 242 PRO n 1 243 PHE n 1 244 GLU n 1 245 HIS n 1 246 ASP n 1 247 GLU n 1 248 GLU n 1 249 ILE n 1 250 ILE n 1 251 GLY n 1 252 GLY n 1 253 GLN n 1 254 VAL n 1 255 PHE n 1 256 PHE n 1 257 ARG n 1 258 GLN n 1 259 ARG n 1 260 VAL n 1 261 SER n 1 262 SEP n 1 263 GLU n 1 264 CYS n 1 265 GLN n 1 266 HIS n 1 267 LEU n 1 268 ILE n 1 269 ARG n 1 270 TRP n 1 271 CYS n 1 272 LEU n 1 273 ALA n 1 274 LEU n 1 275 ARG n 1 276 PRO n 1 277 SER n 1 278 ASP n 1 279 ARG n 1 280 PRO n 1 281 THR n 1 282 PHE n 1 283 GLU n 1 284 GLU n 1 285 ILE n 1 286 GLN n 1 287 ASN n 1 288 HIS n 1 289 PRO n 1 290 TRP n 1 291 MET n 1 292 GLN n 1 293 ASP n 1 294 VAL n 1 295 LEU n 1 296 LEU n 1 297 PRO n 1 298 GLN n 1 299 GLU n 1 300 THR n 1 301 ALA n 1 302 GLU n 1 303 ILE n 1 304 HIS n 1 305 LEU n 1 306 HIS n 1 307 SER n 1 308 LEU n 1 309 SER n 1 310 PRO n 1 311 GLY n 1 312 PRO n 1 313 SER n 2 1 ALA n 2 2 ARG n 2 3 LYS n 2 4 ARG n 2 5 ARG n 2 6 ARG n 2 7 HIS n 2 8 PRO n 2 9 SER n 2 10 GLY n 2 11 PRO n 2 12 PRO n 2 13 THR n 2 14 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 313 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 14 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XJW non-polymer . '4-[(~{Z})-1-cyanoprop-1-enyl]benzoic acid' ? 'C11 H9 N O2' 187.195 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 LEU 3 2 ? ? ? A . n A 1 4 LEU 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 LYS 6 5 ? ? ? A . n A 1 7 ILE 7 6 ? ? ? A . n A 1 8 ASN 8 7 ? ? ? A . n A 1 9 SER 9 8 ? ? ? A . n A 1 10 LEU 10 9 ? ? ? A . n A 1 11 ALA 11 10 ? ? ? A . n A 1 12 HIS 12 11 ? ? ? A . n A 1 13 LEU 13 12 ? ? ? A . n A 1 14 ARG 14 13 ? ? ? A . n A 1 15 ALA 15 14 ? ? ? A . n A 1 16 ALA 16 15 ? ? ? A . n A 1 17 PRO 17 16 ? ? ? A . n A 1 18 CYS 18 17 ? ? ? A . n A 1 19 ASN 19 18 ? ? ? A . n A 1 20 ASP 20 19 ? ? ? A . n A 1 21 LEU 21 20 ? ? ? A . n A 1 22 HIS 22 21 ? ? ? A . n A 1 23 ALA 23 22 ? ? ? A . n A 1 24 THR 24 23 ? ? ? A . n A 1 25 LYS 25 24 ? ? ? A . n A 1 26 LEU 26 25 ? ? ? A . n A 1 27 ALA 27 26 ? ? ? A . n A 1 28 PRO 28 27 ? ? ? A . n A 1 29 GLY 29 28 ? ? ? A . n A 1 30 LYS 30 29 ? ? ? A . n A 1 31 GLU 31 30 ? ? ? A . n A 1 32 LYS 32 31 ? ? ? A . n A 1 33 GLU 33 32 ? ? ? A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 GLY 48 47 47 GLY GLY A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 ASN 62 61 61 ASN ASN A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 PRO 64 63 63 PRO PRO A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 ILE 75 74 74 ILE ILE A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 TRP 78 77 77 TRP TRP A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 PRO 82 81 ? ? ? A . n A 1 83 ASN 83 82 82 ASN ASN A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 THR 85 84 84 THR THR A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 PRO 88 87 87 PRO PRO A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 SER 98 97 97 SER SER A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 TRP 110 109 109 TRP TRP A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 GLU 112 111 111 GLU GLU A . n A 1 113 ARG 113 112 112 ARG ARG A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 ASP 115 114 114 ASP ASP A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ILE 120 119 119 ILE ILE A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PRO 126 125 125 PRO PRO A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 GLN 128 127 127 GLN GLN A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 PHE 131 130 130 PHE PHE A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 THR 135 134 134 THR THR A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 ARG 137 136 136 ARG ARG A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 ALA 139 138 138 ALA ALA A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 GLN 141 140 140 GLN GLN A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 LEU 144 143 143 LEU LEU A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 ARG 146 145 145 ARG ARG A . n A 1 147 SER 147 146 146 SER SER A . n A 1 148 PHE 148 147 147 PHE PHE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 TRP 150 149 149 TRP TRP A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 HIS 158 157 157 HIS HIS A . n A 1 159 CYS 159 158 158 CYS CYS A . n A 1 160 HIS 160 159 159 HIS HIS A . n A 1 161 ASN 161 160 160 ASN ASN A . n A 1 162 CYS 162 161 161 CYS CYS A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 VAL 164 163 163 VAL VAL A . n A 1 165 LEU 165 164 164 LEU LEU A . n A 1 166 HIS 166 165 165 HIS HIS A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 ILE 169 168 168 ILE ILE A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 ASP 171 170 170 ASP ASP A . n A 1 172 GLU 172 171 171 GLU GLU A . n A 1 173 ASN 173 172 172 ASN ASN A . n A 1 174 ILE 174 173 173 ILE ILE A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 ILE 176 175 175 ILE ILE A . n A 1 177 ASP 177 176 176 ASP ASP A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 ASN 179 178 178 ASN ASN A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLY 181 180 180 GLY GLY A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 ILE 186 185 185 ILE ILE A . n A 1 187 ASP 187 186 186 ASP ASP A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 SER 190 189 189 SER SER A . n A 1 191 GLY 191 190 190 GLY GLY A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 LEU 194 193 193 LEU LEU A . n A 1 195 LYS 195 194 194 LYS LYS A . n A 1 196 ASP 196 195 195 ASP ASP A . n A 1 197 THR 197 196 196 THR THR A . n A 1 198 VAL 198 197 197 VAL VAL A . n A 1 199 TYR 199 198 198 TYR TYR A . n A 1 200 THR 200 199 199 THR THR A . n A 1 201 ASP 201 200 200 ASP ASP A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 ASP 203 202 202 ASP ASP A . n A 1 204 GLY 204 203 203 GLY GLY A . n A 1 205 THR 205 204 204 THR THR A . n A 1 206 ARG 206 205 205 ARG ARG A . n A 1 207 VAL 207 206 206 VAL VAL A . n A 1 208 TYR 208 207 207 TYR TYR A . n A 1 209 SER 209 208 208 SER SER A . n A 1 210 PRO 210 209 209 PRO PRO A . n A 1 211 PRO 211 210 210 PRO PRO A . n A 1 212 GLU 212 211 211 GLU GLU A . n A 1 213 TRP 213 212 212 TRP TRP A . n A 1 214 ILE 214 213 213 ILE ILE A . n A 1 215 ARG 215 214 214 ARG ARG A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 HIS 217 216 216 HIS HIS A . n A 1 218 ARG 218 217 217 ARG ARG A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 HIS 220 219 219 HIS HIS A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 ARG 222 221 221 ARG ARG A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 ALA 225 224 224 ALA ALA A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 TRP 227 226 226 TRP TRP A . n A 1 228 SER 228 227 227 SER SER A . n A 1 229 LEU 229 228 228 LEU LEU A . n A 1 230 GLY 230 229 229 GLY GLY A . n A 1 231 ILE 231 230 230 ILE ILE A . n A 1 232 LEU 232 231 231 LEU LEU A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 TYR 234 233 233 TYR TYR A . n A 1 235 ASP 235 234 234 ASP ASP A . n A 1 236 MET 236 235 235 MET MET A . n A 1 237 VAL 237 236 236 VAL VAL A . n A 1 238 CYS 238 237 237 CYS CYS A . n A 1 239 GLY 239 238 238 GLY GLY A . n A 1 240 ASP 240 239 239 ASP ASP A . n A 1 241 ILE 241 240 240 ILE ILE A . n A 1 242 PRO 242 241 241 PRO PRO A . n A 1 243 PHE 243 242 242 PHE PHE A . n A 1 244 GLU 244 243 243 GLU GLU A . n A 1 245 HIS 245 244 244 HIS HIS A . n A 1 246 ASP 246 245 245 ASP ASP A . n A 1 247 GLU 247 246 246 GLU GLU A . n A 1 248 GLU 248 247 247 GLU GLU A . n A 1 249 ILE 249 248 248 ILE ILE A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 GLY 251 250 250 GLY GLY A . n A 1 252 GLY 252 251 251 GLY GLY A . n A 1 253 GLN 253 252 252 GLN GLN A . n A 1 254 VAL 254 253 253 VAL VAL A . n A 1 255 PHE 255 254 254 PHE PHE A . n A 1 256 PHE 256 255 255 PHE PHE A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 GLN 258 257 257 GLN GLN A . n A 1 259 ARG 259 258 258 ARG ARG A . n A 1 260 VAL 260 259 259 VAL VAL A . n A 1 261 SER 261 260 260 SER SER A . n A 1 262 SEP 262 261 261 SEP SEP A . n A 1 263 GLU 263 262 262 GLU GLU A . n A 1 264 CYS 264 263 263 CYS CYS A . n A 1 265 GLN 265 264 264 GLN GLN A . n A 1 266 HIS 266 265 265 HIS HIS A . n A 1 267 LEU 267 266 266 LEU LEU A . n A 1 268 ILE 268 267 267 ILE ILE A . n A 1 269 ARG 269 268 268 ARG ARG A . n A 1 270 TRP 270 269 269 TRP TRP A . n A 1 271 CYS 271 270 270 CYS CYS A . n A 1 272 LEU 272 271 271 LEU LEU A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 LEU 274 273 273 LEU LEU A . n A 1 275 ARG 275 274 274 ARG ARG A . n A 1 276 PRO 276 275 275 PRO PRO A . n A 1 277 SER 277 276 276 SER SER A . n A 1 278 ASP 278 277 277 ASP ASP A . n A 1 279 ARG 279 278 278 ARG ARG A . n A 1 280 PRO 280 279 279 PRO PRO A . n A 1 281 THR 281 280 280 THR THR A . n A 1 282 PHE 282 281 281 PHE PHE A . n A 1 283 GLU 283 282 282 GLU GLU A . n A 1 284 GLU 284 283 283 GLU GLU A . n A 1 285 ILE 285 284 284 ILE ILE A . n A 1 286 GLN 286 285 285 GLN GLN A . n A 1 287 ASN 287 286 286 ASN ASN A . n A 1 288 HIS 288 287 287 HIS HIS A . n A 1 289 PRO 289 288 288 PRO PRO A . n A 1 290 TRP 290 289 289 TRP TRP A . n A 1 291 MET 291 290 290 MET MET A . n A 1 292 GLN 292 291 291 GLN GLN A . n A 1 293 ASP 293 292 292 ASP ASP A . n A 1 294 VAL 294 293 293 VAL VAL A . n A 1 295 LEU 295 294 294 LEU LEU A . n A 1 296 LEU 296 295 295 LEU LEU A . n A 1 297 PRO 297 296 296 PRO PRO A . n A 1 298 GLN 298 297 297 GLN GLN A . n A 1 299 GLU 299 298 298 GLU GLU A . n A 1 300 THR 300 299 299 THR THR A . n A 1 301 ALA 301 300 300 ALA ALA A . n A 1 302 GLU 302 301 301 GLU GLU A . n A 1 303 ILE 303 302 302 ILE ILE A . n A 1 304 HIS 304 303 303 HIS HIS A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 HIS 306 305 305 HIS HIS A . n A 1 307 SER 307 306 ? ? ? A . n A 1 308 LEU 308 307 ? ? ? A . n A 1 309 SER 309 308 ? ? ? A . n A 1 310 PRO 310 309 ? ? ? A . n A 1 311 GLY 311 310 ? ? ? A . n A 1 312 PRO 312 311 ? ? ? A . n A 1 313 SER 313 312 ? ? ? A . n B 2 1 ALA 1 1 ? ? ? B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 LYS 3 3 3 LYS LYS B . n B 2 4 ARG 4 4 4 ARG ARG B . n B 2 5 ARG 5 5 5 ARG ARG B . n B 2 6 ARG 6 6 6 ARG ARG B . n B 2 7 HIS 7 7 7 HIS HIS B . n B 2 8 PRO 8 8 8 PRO PRO B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 GLY 10 10 ? ? ? B . n B 2 11 PRO 11 11 ? ? ? B . n B 2 12 PRO 12 12 ? ? ? B . n B 2 13 THR 13 13 ? ? ? B . n B 2 14 ALA 14 14 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id XJW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id XJW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 401 1 GOL GOL A . D 4 XJW 1 402 1 XJW 526 A . E 5 HOH 1 501 89 HOH HOH A . E 5 HOH 2 502 131 HOH HOH A . E 5 HOH 3 503 132 HOH HOH A . E 5 HOH 4 504 98 HOH HOH A . E 5 HOH 5 505 74 HOH HOH A . E 5 HOH 6 506 63 HOH HOH A . E 5 HOH 7 507 59 HOH HOH A . E 5 HOH 8 508 101 HOH HOH A . E 5 HOH 9 509 102 HOH HOH A . E 5 HOH 10 510 55 HOH HOH A . E 5 HOH 11 511 36 HOH HOH A . E 5 HOH 12 512 118 HOH HOH A . E 5 HOH 13 513 110 HOH HOH A . E 5 HOH 14 514 31 HOH HOH A . E 5 HOH 15 515 92 HOH HOH A . E 5 HOH 16 516 24 HOH HOH A . E 5 HOH 17 517 99 HOH HOH A . E 5 HOH 18 518 5 HOH HOH A . E 5 HOH 19 519 8 HOH HOH A . E 5 HOH 20 520 69 HOH HOH A . E 5 HOH 21 521 61 HOH HOH A . E 5 HOH 22 522 20 HOH HOH A . E 5 HOH 23 523 23 HOH HOH A . E 5 HOH 24 524 4 HOH HOH A . E 5 HOH 25 525 71 HOH HOH A . E 5 HOH 26 526 126 HOH HOH A . E 5 HOH 27 527 66 HOH HOH A . E 5 HOH 28 528 105 HOH HOH A . E 5 HOH 29 529 49 HOH HOH A . E 5 HOH 30 530 46 HOH HOH A . E 5 HOH 31 531 121 HOH HOH A . E 5 HOH 32 532 76 HOH HOH A . E 5 HOH 33 533 38 HOH HOH A . E 5 HOH 34 534 19 HOH HOH A . E 5 HOH 35 535 21 HOH HOH A . E 5 HOH 36 536 12 HOH HOH A . E 5 HOH 37 537 40 HOH HOH A . E 5 HOH 38 538 75 HOH HOH A . E 5 HOH 39 539 18 HOH HOH A . E 5 HOH 40 540 9 HOH HOH A . E 5 HOH 41 541 42 HOH HOH A . E 5 HOH 42 542 100 HOH HOH A . E 5 HOH 43 543 10 HOH HOH A . E 5 HOH 44 544 28 HOH HOH A . E 5 HOH 45 545 39 HOH HOH A . E 5 HOH 46 546 22 HOH HOH A . E 5 HOH 47 547 133 HOH HOH A . E 5 HOH 48 548 14 HOH HOH A . E 5 HOH 49 549 25 HOH HOH A . E 5 HOH 50 550 97 HOH HOH A . E 5 HOH 51 551 50 HOH HOH A . E 5 HOH 52 552 15 HOH HOH A . E 5 HOH 53 553 30 HOH HOH A . E 5 HOH 54 554 85 HOH HOH A . E 5 HOH 55 555 6 HOH HOH A . E 5 HOH 56 556 57 HOH HOH A . E 5 HOH 57 557 33 HOH HOH A . E 5 HOH 58 558 7 HOH HOH A . E 5 HOH 59 559 11 HOH HOH A . E 5 HOH 60 560 123 HOH HOH A . E 5 HOH 61 561 87 HOH HOH A . E 5 HOH 62 562 44 HOH HOH A . E 5 HOH 63 563 35 HOH HOH A . E 5 HOH 64 564 119 HOH HOH A . E 5 HOH 65 565 2 HOH HOH A . E 5 HOH 66 566 34 HOH HOH A . E 5 HOH 67 567 128 HOH HOH A . E 5 HOH 68 568 48 HOH HOH A . E 5 HOH 69 569 134 HOH HOH A . E 5 HOH 70 570 95 HOH HOH A . E 5 HOH 71 571 120 HOH HOH A . E 5 HOH 72 572 26 HOH HOH A . E 5 HOH 73 573 64 HOH HOH A . E 5 HOH 74 574 104 HOH HOH A . E 5 HOH 75 575 91 HOH HOH A . E 5 HOH 76 576 53 HOH HOH A . E 5 HOH 77 577 60 HOH HOH A . E 5 HOH 78 578 124 HOH HOH A . E 5 HOH 79 579 52 HOH HOH A . E 5 HOH 80 580 117 HOH HOH A . E 5 HOH 81 581 106 HOH HOH A . E 5 HOH 82 582 37 HOH HOH A . E 5 HOH 83 583 43 HOH HOH A . E 5 HOH 84 584 1 HOH HOH A . E 5 HOH 85 585 13 HOH HOH A . E 5 HOH 86 586 29 HOH HOH A . E 5 HOH 87 587 88 HOH HOH A . E 5 HOH 88 588 41 HOH HOH A . E 5 HOH 89 589 16 HOH HOH A . E 5 HOH 90 590 114 HOH HOH A . E 5 HOH 91 591 17 HOH HOH A . E 5 HOH 92 592 54 HOH HOH A . E 5 HOH 93 593 111 HOH HOH A . E 5 HOH 94 594 84 HOH HOH A . E 5 HOH 95 595 115 HOH HOH A . E 5 HOH 96 596 116 HOH HOH A . E 5 HOH 97 597 56 HOH HOH A . E 5 HOH 98 598 79 HOH HOH A . E 5 HOH 99 599 80 HOH HOH A . E 5 HOH 100 600 86 HOH HOH A . E 5 HOH 101 601 51 HOH HOH A . E 5 HOH 102 602 103 HOH HOH A . E 5 HOH 103 603 81 HOH HOH A . E 5 HOH 104 604 122 HOH HOH A . E 5 HOH 105 605 62 HOH HOH A . E 5 HOH 106 606 45 HOH HOH A . E 5 HOH 107 607 77 HOH HOH A . E 5 HOH 108 608 112 HOH HOH A . F 5 HOH 1 101 65 HOH HOH B . F 5 HOH 2 102 32 HOH HOH B . F 5 HOH 3 103 109 HOH HOH B . F 5 HOH 4 104 47 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 34 ? CG ? A LEU 35 CG 2 1 Y 1 A LEU 34 ? CD1 ? A LEU 35 CD1 3 1 Y 1 A LEU 34 ? CD2 ? A LEU 35 CD2 4 1 Y 1 A GLU 35 ? CG ? A GLU 36 CG 5 1 Y 1 A GLU 35 ? CD ? A GLU 36 CD 6 1 Y 1 A GLU 35 ? OE1 ? A GLU 36 OE1 7 1 Y 1 A GLU 35 ? OE2 ? A GLU 36 OE2 8 1 Y 1 A SER 36 ? OG ? A SER 37 OG 9 1 Y 1 A GLN 39 ? CG ? A GLN 40 CG 10 1 Y 1 A GLN 39 ? CD ? A GLN 40 CD 11 1 Y 1 A GLN 39 ? OE1 ? A GLN 40 OE1 12 1 Y 1 A GLN 39 ? NE2 ? A GLN 40 NE2 13 1 Y 1 A SER 54 ? OG ? A SER 55 OG 14 1 Y 1 A ILE 56 ? CD1 ? A ILE 57 CD1 15 1 Y 1 A VAL 58 ? CG1 ? A VAL 59 CG1 16 1 Y 1 A VAL 58 ? CG2 ? A VAL 59 CG2 17 1 Y 1 A SER 59 ? OG ? A SER 60 OG 18 1 Y 1 A ASP 72 ? OD1 ? A ASP 73 OD1 19 1 Y 1 A ARG 73 ? CG ? A ARG 74 CG 20 1 Y 1 A ARG 73 ? CD ? A ARG 74 CD 21 1 Y 1 A ARG 73 ? NE ? A ARG 74 NE 22 1 Y 1 A ARG 73 ? CZ ? A ARG 74 CZ 23 1 Y 1 A ARG 73 ? NH1 ? A ARG 74 NH1 24 1 Y 1 A ARG 73 ? NH2 ? A ARG 74 NH2 25 1 Y 1 A SER 75 ? OG ? A SER 76 OG 26 1 Y 1 A ASP 76 ? OD1 ? A ASP 77 OD1 27 1 Y 1 A ASP 76 ? OD2 ? A ASP 77 OD2 28 1 Y 1 A GLU 79 ? CG ? A GLU 80 CG 29 1 Y 1 A GLU 79 ? CD ? A GLU 80 CD 30 1 Y 1 A GLU 79 ? OE1 ? A GLU 80 OE1 31 1 Y 1 A GLU 79 ? OE2 ? A GLU 80 OE2 32 1 Y 1 A LEU 80 ? CG ? A LEU 81 CG 33 1 Y 1 A LEU 80 ? CD1 ? A LEU 81 CD1 34 1 Y 1 A LEU 80 ? CD2 ? A LEU 81 CD2 35 1 Y 1 A ASN 82 ? CG ? A ASN 83 CG 36 1 Y 1 A ASN 82 ? OD1 ? A ASN 83 OD1 37 1 Y 1 A ASN 82 ? ND2 ? A ASN 83 ND2 38 1 Y 1 A THR 84 ? OG1 ? A THR 85 OG1 39 1 Y 1 A THR 84 ? CG2 ? A THR 85 CG2 40 1 Y 1 A ARG 85 ? CD ? A ARG 86 CD 41 1 Y 1 A ARG 85 ? NE ? A ARG 86 NE 42 1 Y 1 A ARG 85 ? CZ ? A ARG 86 CZ 43 1 Y 1 A ARG 85 ? NH1 ? A ARG 86 NH1 44 1 Y 1 A ARG 85 ? NH2 ? A ARG 86 NH2 45 1 Y 1 A LYS 94 ? CG ? A LYS 95 CG 46 1 Y 1 A LYS 94 ? CD ? A LYS 95 CD 47 1 Y 1 A LYS 94 ? CE ? A LYS 95 CE 48 1 Y 1 A LYS 94 ? NZ ? A LYS 95 NZ 49 1 Y 1 A SER 98 ? OG ? A SER 99 OG 50 1 Y 1 A SER 101 ? OG ? A SER 102 OG 51 1 Y 1 A ARG 105 ? CZ ? A ARG 106 CZ 52 1 Y 1 A ARG 105 ? NH1 ? A ARG 106 NH1 53 1 Y 1 A ARG 105 ? NH2 ? A ARG 106 NH2 54 1 Y 1 A GLU 124 ? CG ? A GLU 125 CG 55 1 Y 1 A GLU 124 ? CD ? A GLU 125 CD 56 1 Y 1 A GLU 124 ? OE1 ? A GLU 125 OE1 57 1 Y 1 A GLU 124 ? OE2 ? A GLU 125 OE2 58 1 Y 1 A ASP 202 ? OD1 ? A ASP 203 OD1 59 1 Y 1 A ASP 202 ? OD2 ? A ASP 203 OD2 60 1 Y 1 A ARG 214 ? NH1 ? A ARG 215 NH1 61 1 Y 1 A ARG 214 ? NH2 ? A ARG 215 NH2 62 1 Y 1 A ARG 217 ? NH1 ? A ARG 218 NH1 63 1 Y 1 A ARG 217 ? NH2 ? A ARG 218 NH2 64 1 Y 1 A GLN 252 ? NE2 ? A GLN 253 NE2 65 1 Y 1 A GLU 262 ? OE1 ? A GLU 263 OE1 66 1 Y 1 A ARG 274 ? CD ? A ARG 275 CD 67 1 Y 1 A ARG 274 ? NE ? A ARG 275 NE 68 1 Y 1 A ARG 274 ? CZ ? A ARG 275 CZ 69 1 Y 1 A ARG 274 ? NH1 ? A ARG 275 NH1 70 1 Y 1 A ARG 274 ? NH2 ? A ARG 275 NH2 71 1 Y 1 A GLN 297 ? CG ? A GLN 298 CG 72 1 Y 1 A GLN 297 ? CD ? A GLN 298 CD 73 1 Y 1 A GLN 297 ? OE1 ? A GLN 298 OE1 74 1 Y 1 A GLN 297 ? NE2 ? A GLN 298 NE2 75 1 Y 1 B LYS 3 ? CG ? B LYS 3 CG 76 1 Y 1 B LYS 3 ? CD ? B LYS 3 CD 77 1 Y 1 B LYS 3 ? CE ? B LYS 3 CE 78 1 Y 1 B LYS 3 ? NZ ? B LYS 3 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 3.1.9 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 3.1.9 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.7.1 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8R27 _cell.details ? _cell.formula_units_Z ? _cell.length_a 97.085 _cell.length_a_esd ? _cell.length_b 97.085 _cell.length_b_esd ? _cell.length_c 80.116 _cell.length_c_esd ? _cell.volume 653964.479 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8R27 _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall 'P 65' _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8R27 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.1 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.9 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM bis-tris-propane (pH 7.0), 10% ethylene glycol, 0.3% DMSO, 20% PEG3350, 200 mM Mg(OAc)2' _exptl_crystal_grow.pdbx_pH_range 6.8-7.2 _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-10-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 39.59 _reflns.entry_id 8R27 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 48.54 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 30949 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 1.96 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4915 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.87 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.93 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8R27 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.95 _refine.ls_d_res_low 48.54 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30944 _refine.ls_number_reflns_R_free 1548 _refine.ls_number_reflns_R_work 29396 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.66 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1658 _refine.ls_R_factor_R_free 0.1920 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1645 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.3059 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1974 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 48.54 _refine_hist.number_atoms_solvent 112 _refine_hist.number_atoms_total 2344 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2212 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0072 ? 2309 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7797 ? 3134 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0552 ? 335 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0099 ? 413 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 26.2120 ? 836 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.95 2.01 . . 138 2612 96.90 . . . . 0.2366 . . . . . . . . . . . 0.2858 'X-RAY DIFFRACTION' 2.01 2.08 . . 138 2632 98.30 . . . . 0.1890 . . . . . . . . . . . 0.2391 'X-RAY DIFFRACTION' 2.08 2.17 . . 141 2671 98.42 . . . . 0.1777 . . . . . . . . . . . 0.1959 'X-RAY DIFFRACTION' 2.17 2.27 . . 139 2642 98.83 . . . . 0.1647 . . . . . . . . . . . 0.1947 'X-RAY DIFFRACTION' 2.27 2.39 . . 141 2681 99.05 . . . . 0.1523 . . . . . . . . . . . 0.1763 'X-RAY DIFFRACTION' 2.39 2.54 . . 141 2677 99.16 . . . . 0.1640 . . . . . . . . . . . 0.2253 'X-RAY DIFFRACTION' 2.54 2.73 . . 139 2650 97.79 . . . . 0.1717 . . . . . . . . . . . 0.2116 'X-RAY DIFFRACTION' 2.73 3.01 . . 142 2692 99.40 . . . . 0.1671 . . . . . . . . . . . 0.1847 'X-RAY DIFFRACTION' 3.01 3.44 . . 142 2702 99.65 . . . . 0.1631 . . . . . . . . . . . 0.2117 'X-RAY DIFFRACTION' 3.44 4.33 . . 142 2701 98.96 . . . . 0.1526 . . . . . . . . . . . 0.1483 'X-RAY DIFFRACTION' 4.34 48.54 . . 145 2736 98.97 . . . . 0.1656 . . . . . . . . . . . 0.2027 # _struct.entry_id 8R27 _struct.title 'Pim1 in complex with (Z)-4-(1-cyano-2-(4-hydroxyphenyl)vinyl)benzoic acid and Pimtide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8R27 _struct_keywords.text ;SERINE KINASE, KINASE, COMPLEX, PIM1, PIM, PIM-1, INHIBITOR, TUMORIGENISIS, CANCER, PIMTIDE, PROTO ONCOGEN, ATP, PHOSPHORYLATION, APOPTOSIS, CELL CYCLE, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP PIM1_HUMAN P11309 P11309-1 1 ;MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGEL PNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHN CGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS ; 1 2 PDB 8R27 8R27 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8R27 A 2 ? 313 ? P11309 1 ? 312 ? 1 312 2 2 8R27 B 1 ? 14 ? 8R27 1 ? 14 ? 1 14 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8R27 SER A 1 ? UNP P11309 ? ? 'expression tag' 0 1 1 8R27 GLY A 251 ? UNP P11309 ARG 250 'engineered mutation' 250 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1330 ? 1 MORE 3 ? 1 'SSA (A^2)' 12740 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 34 ? GLN A 38 ? PRO A 33 GLN A 37 1 ? 5 HELX_P HELX_P2 AA2 GLY A 46 ? GLY A 49 ? GLY A 45 GLY A 48 5 ? 4 HELX_P HELX_P3 AA3 ASP A 73 ? ILE A 75 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P4 AA4 MET A 89 ? SER A 98 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P5 AA5 LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P6 AA6 GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P7 AA7 LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P8 AA8 THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P9 AA9 PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P10 AB1 HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P11 AB2 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P12 AB3 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P13 AB4 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P14 AB5 THR A 281 ? ASN A 287 ? THR A 280 ASN A 286 1 ? 7 HELX_P HELX_P15 AB6 HIS A 288 ? GLN A 292 ? HIS A 287 GLN A 291 5 ? 5 HELX_P HELX_P16 AB7 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 261 C ? ? ? 1_555 A SEP 262 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A SEP 262 C ? ? ? 1_555 A GLU 263 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SEP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 262 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SEP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 261 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id SER _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SEP _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 125 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 126 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.97 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 39 ? LEU A 44 ? TYR A 38 LEU A 43 AA1 2 SER A 52 ? ARG A 58 ? SER A 51 ARG A 57 AA1 3 PRO A 64 ? GLU A 71 ? PRO A 63 GLU A 70 AA1 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 AA1 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 AA2 1 TRP A 78 ? GLU A 80 ? TRP A 77 GLU A 79 AA2 2 ARG A 86 ? PRO A 88 ? ARG A 85 PRO A 87 AA3 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 AA3 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 AA3 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 AA4 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 AA4 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 42 ? N GLY A 41 O SER A 55 ? O SER A 54 AA1 2 3 N TYR A 54 ? N TYR A 53 O ILE A 67 ? O ILE A 66 AA1 3 4 N LYS A 68 ? N LYS A 67 O LEU A 119 ? O LEU A 118 AA1 4 5 O ILE A 120 ? O ILE A 119 N LEU A 108 ? N LEU A 107 AA2 1 2 N GLY A 79 ? N GLY A 78 O VAL A 87 ? O VAL A 86 AA3 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 AA3 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 AA4 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 # _pdbx_entry_details.entry_id 8R27 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 60 ? ? -145.70 19.52 2 1 SER A 98 ? ? -169.42 -167.28 3 1 ASP A 167 ? ? -144.75 41.28 4 1 ASP A 186 ? ? 60.12 79.82 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 262 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+5/6 3 y,-x+y,z+1/6 4 -y,x-y,z+2/3 5 -x+y,-x,z+1/3 6 -x,-y,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 47.1882942486 -127.951633401 0.215916267009 0.265851279508 ? -0.010361715534 ? -0.00011293044749 ? 0.345694031241 ? -0.0300514005378 ? 0.307790179174 ? 1.79384309264 ? -0.291287809347 ? -0.373102976249 ? 1.38909814662 ? -0.581728243418 ? 2.83352509177 ? 0.0158912262869 ? -0.0784638919823 ? 0.0438043429775 ? 0.12900935602 ? 0.0782063929239 ? -0.023185304332 ? 0.115150418569 ? 0.134148445735 ? -2.52049247499e-06 ? 2 'X-RAY DIFFRACTION' ? refined 40.5718950703 -119.843016565 12.7082932785 0.561196880631 ? 0.105387841673 ? 0.0760048190666 ? 0.561542391799 ? -0.0753080112647 ? 0.490539963378 ? 0.57596727487 ? 0.389430016737 ? 0.0323959208163 ? 0.296681098079 ? -0.0766372752505 ? 0.297713139607 ? 0.478076283813 ? -0.690734481308 ? 0.200055582755 ? 0.584946448244 ? -0.175629661668 ? -0.240573182425 ? -0.597948530933 ? 0.406552341407 ? -0.0145385400589 ? 3 'X-RAY DIFFRACTION' ? refined 20.298775393 -115.49699222 -3.44908552562 0.56690066578 ? 0.217215962058 ? -0.00861966518891 ? 0.882779134933 ? -0.085724143826 ? 0.814523639705 ? 0.327165452603 ? 0.783118002688 ? 0.106180168591 ? 1.87831707364 ? 0.256336133313 ? 0.0350662260767 ? 0.0765599775948 ? -0.261122120146 ? 0.165181153653 ? 0.740778287854 ? -0.434209143823 ? -0.0303345068285 ? 0.176650192904 ? 0.290564209173 ? -0.0825952262591 ? 4 'X-RAY DIFFRACTION' ? refined 29.297102945 -113.703034407 -10.284610227 0.357697600925 ? 0.0542471090101 ? 0.0346205075539 ? 0.52178159162 ? 0.0339045386225 ? 0.474837175311 ? 0.466886867905 ? -0.416845908388 ? -0.0800986269507 ? 0.47704485579 ? 0.0547207720148 ? 0.49326807763 ? 0.469739651825 ? 0.320893036224 ? 0.352482210845 ? -0.237611476287 ? -0.430445644236 ? 0.0145425501596 ? -0.390780747311 ? -0.449698570391 ? 0.00837852311504 ? 5 'X-RAY DIFFRACTION' ? refined 29.9535606069 -122.526641942 -3.5985643646 0.333272864381 ? 0.000756081188929 ? 0.0207338747508 ? 0.480794129667 ? 0.0119867915483 ? 0.389827810746 ? 0.840365328743 ? -0.486652818528 ? -0.274589902675 ? 0.815750984606 ? 0.91205875212 ? 1.15337781463 ? 0.0849587054796 ? -0.179323815906 ? -0.061084462692 ? -0.181676426972 ? 0.0864148956789 ? 0.333725720443 ? 0.129882541694 ? -0.735917637243 ? 0.0105010436112 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 108 A 141 ? A 272 A 305 ? ? ;chain 'A' and (resid 141 through 305 ) ; 2 'X-RAY DIFFRACTION' 2 C 1 B 2 ? C 8 B 9 ? ? ;chain 'B' and (resid 2 through 9 ) ; 3 'X-RAY DIFFRACTION' 3 A 1 A 33 ? A 18 A 50 ? ? ;chain 'A' and (resid 33 through 50 ) ; 4 'X-RAY DIFFRACTION' 4 A 19 A 51 ? A 63 A 96 ? ? ;chain 'A' and (resid 51 through 96 ) ; 5 'X-RAY DIFFRACTION' 5 A 64 A 97 ? A 107 A 140 ? ? ;chain 'A' and (resid 97 through 140 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 0 ? A SER 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A LEU 2 ? A LEU 3 4 1 Y 1 A LEU 3 ? A LEU 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A LYS 5 ? A LYS 6 7 1 Y 1 A ILE 6 ? A ILE 7 8 1 Y 1 A ASN 7 ? A ASN 8 9 1 Y 1 A SER 8 ? A SER 9 10 1 Y 1 A LEU 9 ? A LEU 10 11 1 Y 1 A ALA 10 ? A ALA 11 12 1 Y 1 A HIS 11 ? A HIS 12 13 1 Y 1 A LEU 12 ? A LEU 13 14 1 Y 1 A ARG 13 ? A ARG 14 15 1 Y 1 A ALA 14 ? A ALA 15 16 1 Y 1 A ALA 15 ? A ALA 16 17 1 Y 1 A PRO 16 ? A PRO 17 18 1 Y 1 A CYS 17 ? A CYS 18 19 1 Y 1 A ASN 18 ? A ASN 19 20 1 Y 1 A ASP 19 ? A ASP 20 21 1 Y 1 A LEU 20 ? A LEU 21 22 1 Y 1 A HIS 21 ? A HIS 22 23 1 Y 1 A ALA 22 ? A ALA 23 24 1 Y 1 A THR 23 ? A THR 24 25 1 Y 1 A LYS 24 ? A LYS 25 26 1 Y 1 A LEU 25 ? A LEU 26 27 1 Y 1 A ALA 26 ? A ALA 27 28 1 Y 1 A PRO 27 ? A PRO 28 29 1 Y 1 A GLY 28 ? A GLY 29 30 1 Y 1 A LYS 29 ? A LYS 30 31 1 Y 1 A GLU 30 ? A GLU 31 32 1 Y 1 A LYS 31 ? A LYS 32 33 1 Y 1 A GLU 32 ? A GLU 33 34 1 Y 1 A PRO 81 ? A PRO 82 35 1 Y 1 A SER 306 ? A SER 307 36 1 Y 1 A LEU 307 ? A LEU 308 37 1 Y 1 A SER 308 ? A SER 309 38 1 Y 1 A PRO 309 ? A PRO 310 39 1 Y 1 A GLY 310 ? A GLY 311 40 1 Y 1 A PRO 311 ? A PRO 312 41 1 Y 1 A SER 312 ? A SER 313 42 1 Y 1 B ALA 1 ? B ALA 1 43 1 Y 1 B GLY 10 ? B GLY 10 44 1 Y 1 B PRO 11 ? B PRO 11 45 1 Y 1 B PRO 12 ? B PRO 12 46 1 Y 1 B THR 13 ? B THR 13 47 1 Y 1 B ALA 14 ? B ALA 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SEP N N N N 304 SEP CA C N S 305 SEP CB C N N 306 SEP OG O N N 307 SEP C C N N 308 SEP O O N N 309 SEP OXT O N N 310 SEP P P N N 311 SEP O1P O N N 312 SEP O2P O N N 313 SEP O3P O N N 314 SEP H H N N 315 SEP H2 H N N 316 SEP HA H N N 317 SEP HB2 H N N 318 SEP HB3 H N N 319 SEP HXT H N N 320 SEP HOP2 H N N 321 SEP HOP3 H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 XJW C3 C N N 424 XJW C4 C N N 425 XJW C5 C N N 426 XJW C6 C N N 427 XJW C7 C Y N 428 XJW C8 C Y N 429 XJW C9 C Y N 430 XJW C12 C Y N 431 XJW C13 C Y N 432 XJW N N N N 433 XJW C10 C Y N 434 XJW C11 C N N 435 XJW O1 O N N 436 XJW O2 O N N 437 XJW H1 H N N 438 XJW H2 H N N 439 XJW H9 H N N 440 XJW H3 H N N 441 XJW H4 H N N 442 XJW H5 H N N 443 XJW H7 H N N 444 XJW H8 H N N 445 XJW H6 H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SEP N CA sing N N 290 SEP N H sing N N 291 SEP N H2 sing N N 292 SEP CA CB sing N N 293 SEP CA C sing N N 294 SEP CA HA sing N N 295 SEP CB OG sing N N 296 SEP CB HB2 sing N N 297 SEP CB HB3 sing N N 298 SEP OG P sing N N 299 SEP C O doub N N 300 SEP C OXT sing N N 301 SEP OXT HXT sing N N 302 SEP P O1P doub N N 303 SEP P O2P sing N N 304 SEP P O3P sing N N 305 SEP O2P HOP2 sing N N 306 SEP O3P HOP3 sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 XJW C3 C4 sing N N 407 XJW C4 C5 doub N Z 408 XJW C6 C5 sing N N 409 XJW N C6 trip N N 410 XJW C5 C7 sing N N 411 XJW C7 C8 doub Y N 412 XJW C8 C9 sing Y N 413 XJW C9 C10 doub Y N 414 XJW C10 C11 sing N N 415 XJW O1 C11 sing N N 416 XJW C11 O2 doub N N 417 XJW C12 C10 sing Y N 418 XJW C13 C12 doub Y N 419 XJW C7 C13 sing Y N 420 XJW C3 H1 sing N N 421 XJW C3 H2 sing N N 422 XJW C3 H9 sing N N 423 XJW C4 H3 sing N N 424 XJW C8 H4 sing N N 425 XJW C9 H5 sing N N 426 XJW C12 H7 sing N N 427 XJW C13 H8 sing N N 428 XJW O1 H6 sing N N 429 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5NDT _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 65' _space_group.name_Hall 'P 65' _space_group.IT_number 170 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8R27 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010300 _atom_sites.fract_transf_matrix[1][2] 0.005947 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011894 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012482 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #