data_8R8A # _entry.id 8R8A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8R8A pdb_00008r8a 10.2210/pdb8r8a/pdb WWPDB D_1292134826 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-12-27 2 'Structure model' 1 1 2024-03-06 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_entry_details 4 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_citation_author.identifier_ORCID' 12 2 'Structure model' '_citation_author.name' 13 3 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8R8A _pdbx_database_status.recvd_initial_deposition_date 2023-11-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email daniel.bojar@gu.se _pdbx_contact_author.name_first Daniel _pdbx_contact_author.name_last Bojar _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3008-7851 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lundstrom, J.' 1 0000-0003-2733-7124 'Varrot, A.' 2 0000-0001-6667-8162 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Beilstein J Org Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-5397 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 306 _citation.page_last 320 _citation.title 'Elucidating the glycan-binding specificity and structure of Cucumis melo agglutinin, a new R-type lectin.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3762/bjoc.20.31 _citation.pdbx_database_id_PubMed 38410776 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lundstrom, J.' 1 ? primary 'Gillon, E.' 2 ? primary 'Chazalet, V.' 3 ? primary 'Kerekes, N.' 4 0000-0001-7065-8092 primary 'Di Maio, A.' 5 0000-0002-2740-9098 primary 'Feizi, T.' 6 0000-0001-6495-0329 primary 'Liu, Y.' 7 ? primary 'Varrot, A.' 8 0000-0001-6667-8162 primary 'Bojar, D.' 9 0000-0002-3008-7851 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nigrin b-like' 13933.389 1 ? ? ? ;Residue 6-132 of the mature protein preceded by residues left from TEV cleavage site. We used the numbering such as we kept the one of the mature protein ; 2 branched man 'beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose' 383.349 1 ? ? ? ? 3 non-polymer syn 'CADMIUM ION' 112.411 3 ? ? ? ? 4 water nat water 18.015 241 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMVSRSTHLVGQDGLCLDVIGGYSDNHVPTQLWPCGPQNNQLWTIQADGTIRTMGKCLVPNGHDPGSYTMIDDCNKADP NDKTWKLYPDGTLTHVRSSLVLTSQGTGAYAITTIETNTSAPTQSWGTAD ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMVSRSTHLVGQDGLCLDVIGGYSDNHVPTQLWPCGPQNNQLWTIQADGTIRTMGKCLVPNGHDPGSYTMIDDCNKADP NDKTWKLYPDGTLTHVRSSLVLTSQGTGAYAITTIETNTSAPTQSWGTAD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CADMIUM ION' CD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 VAL n 1 5 SER n 1 6 ARG n 1 7 SER n 1 8 THR n 1 9 HIS n 1 10 LEU n 1 11 VAL n 1 12 GLY n 1 13 GLN n 1 14 ASP n 1 15 GLY n 1 16 LEU n 1 17 CYS n 1 18 LEU n 1 19 ASP n 1 20 VAL n 1 21 ILE n 1 22 GLY n 1 23 GLY n 1 24 TYR n 1 25 SER n 1 26 ASP n 1 27 ASN n 1 28 HIS n 1 29 VAL n 1 30 PRO n 1 31 THR n 1 32 GLN n 1 33 LEU n 1 34 TRP n 1 35 PRO n 1 36 CYS n 1 37 GLY n 1 38 PRO n 1 39 GLN n 1 40 ASN n 1 41 ASN n 1 42 GLN n 1 43 LEU n 1 44 TRP n 1 45 THR n 1 46 ILE n 1 47 GLN n 1 48 ALA n 1 49 ASP n 1 50 GLY n 1 51 THR n 1 52 ILE n 1 53 ARG n 1 54 THR n 1 55 MET n 1 56 GLY n 1 57 LYS n 1 58 CYS n 1 59 LEU n 1 60 VAL n 1 61 PRO n 1 62 ASN n 1 63 GLY n 1 64 HIS n 1 65 ASP n 1 66 PRO n 1 67 GLY n 1 68 SER n 1 69 TYR n 1 70 THR n 1 71 MET n 1 72 ILE n 1 73 ASP n 1 74 ASP n 1 75 CYS n 1 76 ASN n 1 77 LYS n 1 78 ALA n 1 79 ASP n 1 80 PRO n 1 81 ASN n 1 82 ASP n 1 83 LYS n 1 84 THR n 1 85 TRP n 1 86 LYS n 1 87 LEU n 1 88 TYR n 1 89 PRO n 1 90 ASP n 1 91 GLY n 1 92 THR n 1 93 LEU n 1 94 THR n 1 95 HIS n 1 96 VAL n 1 97 ARG n 1 98 SER n 1 99 SER n 1 100 LEU n 1 101 VAL n 1 102 LEU n 1 103 THR n 1 104 SER n 1 105 GLN n 1 106 GLY n 1 107 THR n 1 108 GLY n 1 109 ALA n 1 110 TYR n 1 111 ALA n 1 112 ILE n 1 113 THR n 1 114 THR n 1 115 ILE n 1 116 GLU n 1 117 THR n 1 118 ASN n 1 119 THR n 1 120 SER n 1 121 ALA n 1 122 PRO n 1 123 THR n 1 124 GLN n 1 125 SER n 1 126 TRP n 1 127 GLY n 1 128 THR n 1 129 ALA n 1 130 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 130 _entity_src_gen.gene_src_common_name muskmelon _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LOC107992255, 107992255' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cucumis melo' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3656 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Tuner (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Pet40b-tev _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGalpb1-4DGlcpNAca1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a2122h-1a_1-5_2*NCC/3=O][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-GlcpNAc]{[(4+1)][b-D-Galp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 GAL _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NDG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose 'beta-D-galactose; D-galactose; galactose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ;N-acetyl-alpha-D-glucosamine; 2-acetamido-2-deoxy-alpha-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; 2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE ; 'C8 H15 N O6' 221.208 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAca NDG 'COMMON NAME' GMML 1.0 N-acetyl-a-D-glucopyranosamine NDG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GlcpNAc NDG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 3 ? ? ? A . n A 1 2 ALA 2 4 ? ? ? A . n A 1 3 MET 3 5 ? ? ? A . n A 1 4 VAL 4 6 6 VAL VAL A . n A 1 5 SER 5 7 7 SER SER A . n A 1 6 ARG 6 8 8 ARG ARG A . n A 1 7 SER 7 9 9 SER SER A . n A 1 8 THR 8 10 10 THR THR A . n A 1 9 HIS 9 11 11 HIS HIS A . n A 1 10 LEU 10 12 12 LEU LEU A . n A 1 11 VAL 11 13 13 VAL VAL A . n A 1 12 GLY 12 14 14 GLY GLY A . n A 1 13 GLN 13 15 15 GLN GLN A . n A 1 14 ASP 14 16 16 ASP ASP A . n A 1 15 GLY 15 17 17 GLY GLY A . n A 1 16 LEU 16 18 18 LEU LEU A . n A 1 17 CYS 17 19 19 CYS CYS A . n A 1 18 LEU 18 20 20 LEU LEU A . n A 1 19 ASP 19 21 21 ASP ASP A . n A 1 20 VAL 20 22 22 VAL VAL A . n A 1 21 ILE 21 23 23 ILE ILE A . n A 1 22 GLY 22 24 24 GLY GLY A . n A 1 23 GLY 23 25 25 GLY GLY A . n A 1 24 TYR 24 26 26 TYR TYR A . n A 1 25 SER 25 27 27 SER SER A . n A 1 26 ASP 26 28 28 ASP ASP A . n A 1 27 ASN 27 29 29 ASN ASN A . n A 1 28 HIS 28 30 30 HIS HIS A . n A 1 29 VAL 29 31 31 VAL VAL A . n A 1 30 PRO 30 32 32 PRO PRO A . n A 1 31 THR 31 33 33 THR THR A . n A 1 32 GLN 32 34 34 GLN GLN A . n A 1 33 LEU 33 35 35 LEU LEU A . n A 1 34 TRP 34 36 36 TRP TRP A . n A 1 35 PRO 35 37 37 PRO PRO A . n A 1 36 CYS 36 38 38 CYS CYS A . n A 1 37 GLY 37 39 39 GLY GLY A . n A 1 38 PRO 38 40 40 PRO PRO A . n A 1 39 GLN 39 41 41 GLN GLN A . n A 1 40 ASN 40 42 42 ASN ASN A . n A 1 41 ASN 41 43 43 ASN ASN A . n A 1 42 GLN 42 44 44 GLN GLN A . n A 1 43 LEU 43 45 45 LEU LEU A . n A 1 44 TRP 44 46 46 TRP TRP A . n A 1 45 THR 45 47 47 THR THR A . n A 1 46 ILE 46 48 48 ILE ILE A . n A 1 47 GLN 47 49 49 GLN GLN A . n A 1 48 ALA 48 50 50 ALA ALA A . n A 1 49 ASP 49 51 51 ASP ASP A . n A 1 50 GLY 50 52 52 GLY GLY A . n A 1 51 THR 51 53 53 THR THR A . n A 1 52 ILE 52 54 54 ILE ILE A . n A 1 53 ARG 53 55 55 ARG ARG A . n A 1 54 THR 54 56 56 THR THR A . n A 1 55 MET 55 57 57 MET MET A . n A 1 56 GLY 56 58 58 GLY GLY A . n A 1 57 LYS 57 59 59 LYS LYS A . n A 1 58 CYS 58 60 60 CYS CYS A . n A 1 59 LEU 59 61 61 LEU LEU A . n A 1 60 VAL 60 62 62 VAL VAL A . n A 1 61 PRO 61 63 63 PRO PRO A . n A 1 62 ASN 62 64 64 ASN ASN A . n A 1 63 GLY 63 65 65 GLY GLY A . n A 1 64 HIS 64 66 66 HIS HIS A . n A 1 65 ASP 65 67 67 ASP ASP A . n A 1 66 PRO 66 68 68 PRO PRO A . n A 1 67 GLY 67 69 69 GLY GLY A . n A 1 68 SER 68 70 70 SER SER A . n A 1 69 TYR 69 71 71 TYR TYR A . n A 1 70 THR 70 72 72 THR THR A . n A 1 71 MET 71 73 73 MET MET A . n A 1 72 ILE 72 74 74 ILE ILE A . n A 1 73 ASP 73 75 75 ASP ASP A . n A 1 74 ASP 74 76 76 ASP ASP A . n A 1 75 CYS 75 77 77 CYS CYS A . n A 1 76 ASN 76 78 78 ASN ASN A . n A 1 77 LYS 77 79 79 LYS LYS A . n A 1 78 ALA 78 80 80 ALA ALA A . n A 1 79 ASP 79 81 81 ASP ASP A . n A 1 80 PRO 80 82 82 PRO PRO A . n A 1 81 ASN 81 83 83 ASN ASN A . n A 1 82 ASP 82 84 84 ASP ASP A . n A 1 83 LYS 83 85 85 LYS LYS A . n A 1 84 THR 84 86 86 THR THR A . n A 1 85 TRP 85 87 87 TRP TRP A . n A 1 86 LYS 86 88 88 LYS LYS A . n A 1 87 LEU 87 89 89 LEU LEU A . n A 1 88 TYR 88 90 90 TYR TYR A . n A 1 89 PRO 89 91 91 PRO PRO A . n A 1 90 ASP 90 92 92 ASP ASP A . n A 1 91 GLY 91 93 93 GLY GLY A . n A 1 92 THR 92 94 94 THR THR A . n A 1 93 LEU 93 95 95 LEU LEU A . n A 1 94 THR 94 96 96 THR THR A . n A 1 95 HIS 95 97 97 HIS HIS A . n A 1 96 VAL 96 98 98 VAL VAL A . n A 1 97 ARG 97 99 99 ARG ARG A . n A 1 98 SER 98 100 100 SER SER A . n A 1 99 SER 99 101 101 SER SER A . n A 1 100 LEU 100 102 102 LEU LEU A . n A 1 101 VAL 101 103 103 VAL VAL A . n A 1 102 LEU 102 104 104 LEU LEU A . n A 1 103 THR 103 105 105 THR THR A . n A 1 104 SER 104 106 106 SER SER A . n A 1 105 GLN 105 107 107 GLN GLN A . n A 1 106 GLY 106 108 108 GLY GLY A . n A 1 107 THR 107 109 109 THR THR A . n A 1 108 GLY 108 110 110 GLY GLY A . n A 1 109 ALA 109 111 111 ALA ALA A . n A 1 110 TYR 110 112 112 TYR TYR A . n A 1 111 ALA 111 113 113 ALA ALA A . n A 1 112 ILE 112 114 114 ILE ILE A . n A 1 113 THR 113 115 115 THR THR A . n A 1 114 THR 114 116 116 THR THR A . n A 1 115 ILE 115 117 117 ILE ILE A . n A 1 116 GLU 116 118 118 GLU GLU A . n A 1 117 THR 117 119 119 THR THR A . n A 1 118 ASN 118 120 120 ASN ASN A . n A 1 119 THR 119 121 121 THR THR A . n A 1 120 SER 120 122 122 SER SER A . n A 1 121 ALA 121 123 123 ALA ALA A . n A 1 122 PRO 122 124 124 PRO PRO A . n A 1 123 THR 123 125 125 THR THR A . n A 1 124 GLN 124 126 126 GLN GLN A . n A 1 125 SER 125 127 127 SER SER A . n A 1 126 TRP 126 128 128 TRP TRP A . n A 1 127 GLY 127 129 129 GLY GLY A . n A 1 128 THR 128 130 130 THR THR A . n A 1 129 ALA 129 131 131 ALA ALA A . n A 1 130 ASP 130 132 132 ASP ASP A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NDG 1 C NDG 1 C NDG 2 n B 2 GAL 2 C GAL 2 C GAL 1 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 NDG ? ? NDG ? ? 'SUBJECT OF INVESTIGATION' ? 2 GAL ? ? GAL ? ? 'SUBJECT OF INVESTIGATION' ? 3 CD ? ? CD ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CD 1 201 201 CD CD A . D 3 CD 1 202 202 CD CD A . E 3 CD 1 203 203 CD CD A . F 4 HOH 1 301 107 HOH HOH A . F 4 HOH 2 302 126 HOH HOH A . F 4 HOH 3 303 213 HOH HOH A . F 4 HOH 4 304 157 HOH HOH A . F 4 HOH 5 305 31 HOH HOH A . F 4 HOH 6 306 160 HOH HOH A . F 4 HOH 7 307 72 HOH HOH A . F 4 HOH 8 308 41 HOH HOH A . F 4 HOH 9 309 124 HOH HOH A . F 4 HOH 10 310 93 HOH HOH A . F 4 HOH 11 311 131 HOH HOH A . F 4 HOH 12 312 150 HOH HOH A . F 4 HOH 13 313 122 HOH HOH A . F 4 HOH 14 314 73 HOH HOH A . F 4 HOH 15 315 81 HOH HOH A . F 4 HOH 16 316 28 HOH HOH A . F 4 HOH 17 317 134 HOH HOH A . F 4 HOH 18 318 57 HOH HOH A . F 4 HOH 19 319 39 HOH HOH A . F 4 HOH 20 320 20 HOH HOH A . F 4 HOH 21 321 99 HOH HOH A . F 4 HOH 22 322 45 HOH HOH A . F 4 HOH 23 323 219 HOH HOH A . F 4 HOH 24 324 79 HOH HOH A . F 4 HOH 25 325 238 HOH HOH A . F 4 HOH 26 326 2 HOH HOH A . F 4 HOH 27 327 151 HOH HOH A . F 4 HOH 28 328 21 HOH HOH A . F 4 HOH 29 329 148 HOH HOH A . F 4 HOH 30 330 184 HOH HOH A . F 4 HOH 31 331 76 HOH HOH A . F 4 HOH 32 332 25 HOH HOH A . F 4 HOH 33 333 11 HOH HOH A . F 4 HOH 34 334 65 HOH HOH A . F 4 HOH 35 335 19 HOH HOH A . F 4 HOH 36 336 3 HOH HOH A . F 4 HOH 37 337 205 HOH HOH A . F 4 HOH 38 338 53 HOH HOH A . F 4 HOH 39 339 14 HOH HOH A . F 4 HOH 40 340 198 HOH HOH A . F 4 HOH 41 341 242 HOH HOH A . F 4 HOH 42 342 141 HOH HOH A . F 4 HOH 43 343 15 HOH HOH A . F 4 HOH 44 344 132 HOH HOH A . F 4 HOH 45 345 103 HOH HOH A . F 4 HOH 46 346 12 HOH HOH A . F 4 HOH 47 347 163 HOH HOH A . F 4 HOH 48 348 127 HOH HOH A . F 4 HOH 49 349 110 HOH HOH A . F 4 HOH 50 350 105 HOH HOH A . F 4 HOH 51 351 154 HOH HOH A . F 4 HOH 52 352 6 HOH HOH A . F 4 HOH 53 353 112 HOH HOH A . F 4 HOH 54 354 144 HOH HOH A . F 4 HOH 55 355 10 HOH HOH A . F 4 HOH 56 356 97 HOH HOH A . F 4 HOH 57 357 117 HOH HOH A . F 4 HOH 58 358 17 HOH HOH A . F 4 HOH 59 359 13 HOH HOH A . F 4 HOH 60 360 33 HOH HOH A . F 4 HOH 61 361 118 HOH HOH A . F 4 HOH 62 362 218 HOH HOH A . F 4 HOH 63 363 1 HOH HOH A . F 4 HOH 64 364 34 HOH HOH A . F 4 HOH 65 365 91 HOH HOH A . F 4 HOH 66 366 18 HOH HOH A . F 4 HOH 67 367 146 HOH HOH A . F 4 HOH 68 368 59 HOH HOH A . F 4 HOH 69 369 5 HOH HOH A . F 4 HOH 70 370 4 HOH HOH A . F 4 HOH 71 371 78 HOH HOH A . F 4 HOH 72 372 70 HOH HOH A . F 4 HOH 73 373 32 HOH HOH A . F 4 HOH 74 374 193 HOH HOH A . F 4 HOH 75 375 153 HOH HOH A . F 4 HOH 76 376 40 HOH HOH A . F 4 HOH 77 377 74 HOH HOH A . F 4 HOH 78 378 8 HOH HOH A . F 4 HOH 79 379 9 HOH HOH A . F 4 HOH 80 380 42 HOH HOH A . F 4 HOH 81 381 35 HOH HOH A . F 4 HOH 82 382 98 HOH HOH A . F 4 HOH 83 383 123 HOH HOH A . F 4 HOH 84 384 155 HOH HOH A . F 4 HOH 85 385 51 HOH HOH A . F 4 HOH 86 386 80 HOH HOH A . F 4 HOH 87 387 43 HOH HOH A . F 4 HOH 88 388 204 HOH HOH A . F 4 HOH 89 389 240 HOH HOH A . F 4 HOH 90 390 143 HOH HOH A . F 4 HOH 91 391 140 HOH HOH A . F 4 HOH 92 392 101 HOH HOH A . F 4 HOH 93 393 87 HOH HOH A . F 4 HOH 94 394 26 HOH HOH A . F 4 HOH 95 395 119 HOH HOH A . F 4 HOH 96 396 194 HOH HOH A . F 4 HOH 97 397 246 HOH HOH A . F 4 HOH 98 398 135 HOH HOH A . F 4 HOH 99 399 52 HOH HOH A . F 4 HOH 100 400 16 HOH HOH A . F 4 HOH 101 401 149 HOH HOH A . F 4 HOH 102 402 46 HOH HOH A . F 4 HOH 103 403 66 HOH HOH A . F 4 HOH 104 404 69 HOH HOH A . F 4 HOH 105 405 106 HOH HOH A . F 4 HOH 106 406 192 HOH HOH A . F 4 HOH 107 407 83 HOH HOH A . F 4 HOH 108 408 231 HOH HOH A . F 4 HOH 109 409 130 HOH HOH A . F 4 HOH 110 410 67 HOH HOH A . F 4 HOH 111 411 29 HOH HOH A . F 4 HOH 112 412 129 HOH HOH A . F 4 HOH 113 413 44 HOH HOH A . F 4 HOH 114 414 152 HOH HOH A . F 4 HOH 115 415 95 HOH HOH A . F 4 HOH 116 416 233 HOH HOH A . F 4 HOH 117 417 68 HOH HOH A . F 4 HOH 118 418 203 HOH HOH A . F 4 HOH 119 419 109 HOH HOH A . F 4 HOH 120 420 116 HOH HOH A . F 4 HOH 121 421 82 HOH HOH A . F 4 HOH 122 422 239 HOH HOH A . F 4 HOH 123 423 244 HOH HOH A . F 4 HOH 124 424 115 HOH HOH A . F 4 HOH 125 425 142 HOH HOH A . F 4 HOH 126 426 23 HOH HOH A . F 4 HOH 127 427 104 HOH HOH A . F 4 HOH 128 428 38 HOH HOH A . F 4 HOH 129 429 202 HOH HOH A . F 4 HOH 130 430 85 HOH HOH A . F 4 HOH 131 431 88 HOH HOH A . F 4 HOH 132 432 63 HOH HOH A . F 4 HOH 133 433 75 HOH HOH A . F 4 HOH 134 434 92 HOH HOH A . F 4 HOH 135 435 111 HOH HOH A . F 4 HOH 136 436 108 HOH HOH A . F 4 HOH 137 437 48 HOH HOH A . F 4 HOH 138 438 96 HOH HOH A . F 4 HOH 139 439 36 HOH HOH A . F 4 HOH 140 440 159 HOH HOH A . F 4 HOH 141 441 145 HOH HOH A . F 4 HOH 142 442 64 HOH HOH A . F 4 HOH 143 443 90 HOH HOH A . F 4 HOH 144 444 210 HOH HOH A . F 4 HOH 145 445 27 HOH HOH A . F 4 HOH 146 446 22 HOH HOH A . F 4 HOH 147 447 89 HOH HOH A . F 4 HOH 148 448 61 HOH HOH A . F 4 HOH 149 449 120 HOH HOH A . F 4 HOH 150 450 164 HOH HOH A . F 4 HOH 151 451 94 HOH HOH A . F 4 HOH 152 452 147 HOH HOH A . F 4 HOH 153 453 237 HOH HOH A . F 4 HOH 154 454 7 HOH HOH A . F 4 HOH 155 455 236 HOH HOH A . F 4 HOH 156 456 30 HOH HOH A . F 4 HOH 157 457 55 HOH HOH A . F 4 HOH 158 458 49 HOH HOH A . F 4 HOH 159 459 222 HOH HOH A . F 4 HOH 160 460 182 HOH HOH A . F 4 HOH 161 461 211 HOH HOH A . F 4 HOH 162 462 169 HOH HOH A . F 4 HOH 163 463 221 HOH HOH A . F 4 HOH 164 464 161 HOH HOH A . F 4 HOH 165 465 241 HOH HOH A . F 4 HOH 166 466 77 HOH HOH A . F 4 HOH 167 467 128 HOH HOH A . F 4 HOH 168 468 125 HOH HOH A . F 4 HOH 169 469 172 HOH HOH A . F 4 HOH 170 470 188 HOH HOH A . F 4 HOH 171 471 181 HOH HOH A . F 4 HOH 172 472 100 HOH HOH A . F 4 HOH 173 473 197 HOH HOH A . F 4 HOH 174 474 177 HOH HOH A . F 4 HOH 175 475 201 HOH HOH A . F 4 HOH 176 476 170 HOH HOH A . F 4 HOH 177 477 56 HOH HOH A . F 4 HOH 178 478 220 HOH HOH A . F 4 HOH 179 479 223 HOH HOH A . F 4 HOH 180 480 158 HOH HOH A . F 4 HOH 181 481 54 HOH HOH A . F 4 HOH 182 482 60 HOH HOH A . F 4 HOH 183 483 247 HOH HOH A . F 4 HOH 184 484 136 HOH HOH A . F 4 HOH 185 485 212 HOH HOH A . F 4 HOH 186 486 225 HOH HOH A . F 4 HOH 187 487 166 HOH HOH A . F 4 HOH 188 488 208 HOH HOH A . F 4 HOH 189 489 139 HOH HOH A . F 4 HOH 190 490 206 HOH HOH A . F 4 HOH 191 491 209 HOH HOH A . F 4 HOH 192 492 215 HOH HOH A . F 4 HOH 193 493 248 HOH HOH A . F 4 HOH 194 494 227 HOH HOH A . F 4 HOH 195 495 165 HOH HOH A . F 4 HOH 196 496 156 HOH HOH A . F 4 HOH 197 497 176 HOH HOH A . F 4 HOH 198 498 47 HOH HOH A . F 4 HOH 199 499 179 HOH HOH A . F 4 HOH 200 500 245 HOH HOH A . F 4 HOH 201 501 114 HOH HOH A . F 4 HOH 202 502 232 HOH HOH A . F 4 HOH 203 503 186 HOH HOH A . F 4 HOH 204 504 171 HOH HOH A . F 4 HOH 205 505 62 HOH HOH A . F 4 HOH 206 506 58 HOH HOH A . F 4 HOH 207 507 168 HOH HOH A . F 4 HOH 208 508 138 HOH HOH A . F 4 HOH 209 509 249 HOH HOH A . F 4 HOH 210 510 180 HOH HOH A . F 4 HOH 211 511 37 HOH HOH A . F 4 HOH 212 512 50 HOH HOH A . F 4 HOH 213 513 183 HOH HOH A . F 4 HOH 214 514 214 HOH HOH A . F 4 HOH 215 515 178 HOH HOH A . F 4 HOH 216 516 137 HOH HOH A . F 4 HOH 217 517 207 HOH HOH A . F 4 HOH 218 518 185 HOH HOH A . F 4 HOH 219 519 190 HOH HOH A . F 4 HOH 220 520 71 HOH HOH A . F 4 HOH 221 521 250 HOH HOH A . F 4 HOH 222 522 196 HOH HOH A . F 4 HOH 223 523 86 HOH HOH A . F 4 HOH 224 524 199 HOH HOH A . F 4 HOH 225 525 84 HOH HOH A . F 4 HOH 226 526 24 HOH HOH A . F 4 HOH 227 527 191 HOH HOH A . F 4 HOH 228 528 243 HOH HOH A . F 4 HOH 229 529 174 HOH HOH A . F 4 HOH 230 530 162 HOH HOH A . F 4 HOH 231 531 228 HOH HOH A . F 4 HOH 232 532 187 HOH HOH A . F 4 HOH 233 533 175 HOH HOH A . F 4 HOH 234 534 189 HOH HOH A . F 4 HOH 235 535 234 HOH HOH A . F 4 HOH 236 536 224 HOH HOH A . F 4 HOH 237 537 217 HOH HOH A . F 4 HOH 238 538 235 HOH HOH A . F 4 HOH 239 539 102 HOH HOH A . F 4 HOH 240 540 113 HOH HOH A . F 4 HOH 241 541 200 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 8 ? CD ? A ARG 6 CD 2 1 Y 1 A ARG 8 ? NE ? A ARG 6 NE 3 1 Y 1 A ARG 8 ? CZ ? A ARG 6 CZ 4 1 Y 1 A ARG 8 ? NH1 ? A ARG 6 NH1 5 1 Y 1 A ARG 8 ? NH2 ? A ARG 6 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.13 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 99.237 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8R8A _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.696 _cell.length_a_esd ? _cell.length_b 36.782 _cell.length_b_esd ? _cell.length_c 94.786 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8R8A _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8R8A _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.21 _exptl_crystal.description diamond _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;10% Peg Smear Medium, 0.1 M Mes pH 6.5, and 5 mM of CaCl2, MgCl2, CsCl2, CdCl2, NiCl2 and Zinc acetate transfered in 30% Peg Smear Medium 5mM CdCl2 for cryoprotection ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-10-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97856 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97856 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8R8A _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.317 _reflns.d_resolution_low 46.78 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29695 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.32 _reflns_shell.d_res_low 1.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1434 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.400 _reflns_shell.pdbx_Rpim_I_all 0.153 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.969 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.369 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.245 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.068 _refine.aniso_B[2][2] 0.761 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.470 _refine.B_iso_max ? _refine.B_iso_mean 13.471 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.971 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.details 'Hydrogens have been added in their riding positions anisotropic refinement' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8R8A _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.317 _refine.ls_d_res_low 46.778 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29694 _refine.ls_number_reflns_R_free 1503 _refine.ls_number_reflns_R_work 28191 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.798 _refine.ls_percent_reflns_R_free 5.062 _refine.ls_R_factor_all 0.146 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1858 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1435 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.054 _refine.pdbx_overall_ESU_R_Free 0.054 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.297 _refine.overall_SU_ML 0.025 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.317 _refine_hist.d_res_low 46.778 _refine_hist.number_atoms_solvent 241 _refine_hist.number_atoms_total 1223 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 953 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.012 1088 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 962 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.721 1.776 1508 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.616 1.749 2244 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.145 5.000 145 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 1.385 5.000 2 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.000 10.000 159 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.075 10.000 42 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 179 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1316 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 228 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.213 0.200 193 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.214 0.200 881 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 551 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.091 0.200 544 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.193 0.200 144 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.120 0.200 13 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.229 0.200 20 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.188 0.200 43 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.142 0.200 36 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.287 0.200 2 ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 4.445 1.397 558 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.444 1.398 558 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.852 2.511 709 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.852 2.512 710 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.411 1.568 530 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 6.406 1.570 531 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 8.283 2.792 798 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.277 2.793 799 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.386 19.716 1318 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 10.265 16.713 1243 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 5.716 3.000 2050 ? r_rigid_bond_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.317 1.351 2185 . 120 2007 97.3455 . 0.220 . . 0.216 . . . . . 0.216 . 20 . 0.984 0.973 0.297 'X-RAY DIFFRACTION' 1.351 1.388 2105 . 114 1990 99.9525 . 0.162 . . 0.160 . . . . . 0.160 . 20 . 0.991 0.985 0.194 'X-RAY DIFFRACTION' 1.388 1.428 2087 . 123 1964 100.0000 . 0.141 . . 0.138 . . . . . 0.138 . 20 . 0.991 0.981 0.183 'X-RAY DIFFRACTION' 1.428 1.472 2027 . 115 1912 100.0000 . 0.128 . . 0.126 . . . . . 0.126 . 20 . 0.992 0.984 0.177 'X-RAY DIFFRACTION' 1.472 1.520 1939 . 97 1842 100.0000 . 0.102 . . 0.100 . . . . . 0.100 . 20 . 0.994 0.988 0.138 'X-RAY DIFFRACTION' 1.520 1.573 1888 . 85 1803 100.0000 . 0.104 . . 0.102 . . . . . 0.102 . 20 . 0.994 0.988 0.144 'X-RAY DIFFRACTION' 1.573 1.633 1811 . 83 1728 100.0000 . 0.110 . . 0.108 . . . . . 0.108 . 20 . 0.993 0.987 0.149 'X-RAY DIFFRACTION' 1.633 1.699 1751 . 92 1659 100.0000 . 0.118 . . 0.116 . . . . . 0.116 . 20 . 0.992 0.988 0.154 'X-RAY DIFFRACTION' 1.699 1.775 1704 . 77 1627 100.0000 . 0.106 . . 0.103 . . . . . 0.103 . 20 . 0.994 0.980 0.178 'X-RAY DIFFRACTION' 1.775 1.861 1604 . 76 1528 100.0000 . 0.111 . . 0.110 . . . . . 0.110 . 20 . 0.993 0.988 0.135 'X-RAY DIFFRACTION' 1.861 1.962 1540 . 67 1473 100.0000 . 0.123 . . 0.121 . . . . . 0.121 . 20 . 0.993 0.988 0.156 'X-RAY DIFFRACTION' 1.962 2.080 1456 . 65 1391 100.0000 . 0.128 . . 0.127 . . . . . 0.127 . 20 . 0.992 0.988 0.151 'X-RAY DIFFRACTION' 2.080 2.224 1368 . 79 1289 100.0000 . 0.127 . . 0.127 . . . . . 0.127 . 20 . 0.991 0.992 0.127 'X-RAY DIFFRACTION' 2.224 2.401 1267 . 57 1210 100.0000 . 0.136 . . 0.134 . . . . . 0.134 . 20 . 0.989 0.977 0.196 'X-RAY DIFFRACTION' 2.401 2.630 1188 . 68 1120 100.0000 . 0.143 . . 0.141 . . . . . 0.141 . 20 . 0.987 0.984 0.167 'X-RAY DIFFRACTION' 2.630 2.939 1061 . 55 1006 100.0000 . 0.144 . . 0.142 . . . . . 0.142 . 20 . 0.987 0.976 0.199 'X-RAY DIFFRACTION' 2.939 3.392 955 . 38 917 100.0000 . 0.153 . . 0.151 . . . . . 0.151 . 20 . 0.985 0.974 0.195 'X-RAY DIFFRACTION' 3.392 4.148 812 . 43 769 100.0000 . 0.165 . . 0.163 . . . . . 0.163 . 20 . 0.983 0.976 0.192 'X-RAY DIFFRACTION' 4.148 5.844 633 . 30 603 100.0000 . 0.180 . . 0.175 . . . . . 0.175 . 20 . 0.986 0.967 0.284 'X-RAY DIFFRACTION' 5.844 46.778 372 . 19 352 99.7312 . 0.316 . . 0.314 . . . . . 0.314 . 20 . 0.952 0.941 0.372 # _struct.entry_id 8R8A _struct.title 'Structure of the N-terminal domain of CMA in complex with N-acetyllactosamine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8R8A _struct_keywords.text 'lectin, beta-trefoil, galactose, N-acetyllactosamine, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1S4E5V9_CUCME _struct_ref.pdbx_db_accession A0A1S4E5V9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SRSTHLVGQDGLCLDVIGGYSDNHVPTQLWPCGPQNNQLWTIQADGTIRTMGKCLVPNGHDPGSYTMIDDCNKADPNDKT WKLYPDGTLTHVRSSLVLTSQGTGAYAITTIETNTSAPTQSWGTAD ; _struct_ref.pdbx_align_begin 34 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8R8A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1S4E5V9 _struct_ref_seq.db_align_beg 34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8R8A GLY A 1 ? UNP A0A1S4E5V9 ? ? 'expression tag' 3 1 1 8R8A ALA A 2 ? UNP A0A1S4E5V9 ? ? 'expression tag' 4 2 1 8R8A MET A 3 ? UNP A0A1S4E5V9 ? ? 'expression tag' 5 3 1 8R8A VAL A 4 ? UNP A0A1S4E5V9 ? ? 'expression tag' 6 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 860 ? 1 MORE -11 ? 1 'SSA (A^2)' 6280 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 12 ? LEU A 16 ? GLY A 14 LEU A 18 5 ? 5 HELX_P HELX_P2 AA2 GLY A 22 ? TYR A 24 ? GLY A 24 TYR A 26 5 ? 3 HELX_P HELX_P3 AA3 GLN A 39 ? LEU A 43 ? GLN A 41 LEU A 45 5 ? 5 HELX_P HELX_P4 AA4 ASP A 79 ? THR A 84 ? ASP A 81 THR A 86 1 ? 6 HELX_P HELX_P5 AA5 ALA A 121 ? SER A 125 ? ALA A 123 SER A 127 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 19 A CYS 38 1_555 ? ? ? ? ? ? ? 2.069 ? ? disulf2 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 60 A CYS 77 1_555 ? ? ? ? ? ? ? 2.041 ? ? covale1 covale both ? B NDG . O4 ? ? ? 1_555 B GAL . C1 ? ? C NDG 1 C GAL 2 1_555 ? ? ? ? ? ? ? 1.420 ? ? metalc1 metalc ? ? A HIS 9 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 11 A CD 201 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc2 metalc ? ? A HIS 28 NE2 ? ? ? 1_555 D CD . CD ? ? A HIS 30 A CD 202 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc3 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 C CD . CD ? ? A HIS 66 A CD 201 1_655 ? ? ? ? ? ? ? 2.043 ? ? metalc4 metalc ? ? A ASP 73 OD2 ? ? ? 1_555 D CD . CD ? ? A ASP 75 A CD 202 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc5 metalc ? ? A ASN 81 OD1 B ? ? 1_555 E CD . CD ? ? A ASN 83 A CD 203 4_646 ? ? ? ? ? ? ? 1.846 ? ? metalc6 metalc ? ? A ASP 90 OD1 ? ? ? 1_555 E CD . CD ? ? A ASP 92 A CD 203 1_555 ? ? ? ? ? ? ? 2.698 ? ? metalc7 metalc ? ? A ASP 90 OD2 ? ? ? 1_555 E CD . CD ? ? A ASP 92 A CD 203 1_555 ? ? ? ? ? ? ? 2.096 ? ? metalc8 metalc ? ? A THR 92 OG1 ? ? ? 1_555 E CD . CD ? ? A THR 94 A CD 203 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc9 metalc ? ? A ASP 130 OXT ? ? ? 1_555 C CD . CD ? ? A ASP 132 A CD 201 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc10 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 201 A HOH 310 1_555 ? ? ? ? ? ? ? 2.120 ? ? metalc11 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 201 A HOH 415 1_555 ? ? ? ? ? ? ? 2.152 ? ? metalc12 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 201 A HOH 434 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc13 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 362 1_555 ? ? ? ? ? ? ? 2.182 ? ? metalc14 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 430 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc15 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 438 1_555 ? ? ? ? ? ? ? 2.114 ? ? metalc16 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 202 A HOH 445 1_555 ? ? ? ? ? ? ? 2.135 ? ? metalc17 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 203 A HOH 349 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc18 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 203 A HOH 454 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc19 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O A ? A CD 203 A HOH 472 1_555 ? ? ? ? ? ? ? 2.051 ? ? metalc20 metalc ? ? E CD . CD ? ? ? 1_555 F HOH . O B ? A CD 203 A HOH 472 1_555 ? ? ? ? ? ? ? 2.348 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 14.3 ? 2 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OXT ? A ASP 130 ? A ASP 132 ? 1_555 90.3 ? 3 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OXT ? A ASP 130 ? A ASP 132 ? 1_555 83.4 ? 4 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 87.6 ? 5 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 100.3 ? 6 OXT ? A ASP 130 ? A ASP 132 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 310 ? 1_555 91.9 ? 7 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 90.0 ? 8 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 77.1 ? 9 OXT ? A ASP 130 ? A ASP 132 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 86.7 ? 10 O ? F HOH . ? A HOH 310 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 177.2 ? 11 NE2 ? A HIS 9 ? A HIS 11 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 92.7 ? 12 NE2 ? A HIS 64 ? A HIS 66 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 99.1 ? 13 OXT ? A ASP 130 ? A ASP 132 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 176.2 ? 14 O ? F HOH . ? A HOH 310 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 90.5 ? 15 O ? F HOH . ? A HOH 415 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 O ? F HOH . ? A HOH 434 ? 1_555 91.0 ? 16 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 92.1 ? 17 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 362 ? 1_555 94.1 ? 18 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 362 ? 1_555 92.9 ? 19 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 430 ? 1_555 174.9 ? 20 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 430 ? 1_555 91.8 ? 21 O ? F HOH . ? A HOH 362 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 430 ? 1_555 88.9 ? 22 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 92.7 ? 23 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 91.3 ? 24 O ? F HOH . ? A HOH 362 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 171.9 ? 25 O ? F HOH . ? A HOH 430 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 438 ? 1_555 84.0 ? 26 NE2 ? A HIS 28 ? A HIS 30 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 92.1 ? 27 OD2 ? A ASP 73 ? A ASP 75 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 175.7 ? 28 O ? F HOH . ? A HOH 362 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 86.2 ? 29 O ? F HOH . ? A HOH 430 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 83.9 ? 30 O ? F HOH . ? A HOH 438 ? 1_555 CD ? D CD . ? A CD 202 ? 1_555 O ? F HOH . ? A HOH 445 ? 1_555 89.1 ? 31 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 52.8 ? 32 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 53.5 ? 33 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 4.1 ? 34 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OG1 ? A THR 92 ? A THR 94 ? 1_555 47.3 ? 35 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OG1 ? A THR 92 ? A THR 94 ? 1_555 7.1 ? 36 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 OG1 ? A THR 92 ? A THR 94 ? 1_555 6.2 ? 37 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 48.1 ? 38 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 9.6 ? 39 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 7.0 ? 40 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 349 ? 1_555 3.8 ? 41 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 57.5 ? 42 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 7.1 ? 43 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 4.2 ? 44 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 10.2 ? 45 O ? F HOH . ? A HOH 349 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O ? F HOH . ? A HOH 454 ? 1_555 10.0 ? 46 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 53.4 ? 47 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 12.0 ? 48 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 8.1 ? 49 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 9.3 ? 50 O ? F HOH . ? A HOH 349 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 6.2 ? 51 O ? F HOH . ? A HOH 454 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O A F HOH . ? A HOH 472 ? 1_555 8.1 ? 52 OD1 B A ASN 81 ? A ASN 83 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 51.7 ? 53 OD1 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 12.7 ? 54 OD2 ? A ASP 90 ? A ASP 92 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 8.9 ? 55 OG1 ? A THR 92 ? A THR 94 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 8.9 ? 56 O ? F HOH . ? A HOH 349 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 5.3 ? 57 O ? F HOH . ? A HOH 454 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 9.6 ? 58 O A F HOH . ? A HOH 472 ? 1_555 CD ? E CD . ? A CD 203 ? 4_646 O B F HOH . ? A HOH 472 ? 1_555 1.8 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 17 ? CYS A 36 ? CYS A 19 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 58 ? CYS A 75 ? CYS A 60 ? 1_555 CYS A 77 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 101 ? THR A 103 ? VAL A 103 THR A 105 AA1 2 THR A 114 ? GLU A 116 ? THR A 116 GLU A 118 AA1 3 SER A 68 ? ASP A 73 ? SER A 70 ASP A 75 AA1 4 LYS A 57 ? PRO A 61 ? LYS A 59 PRO A 63 AA1 5 ILE A 52 ? THR A 54 ? ILE A 54 THR A 56 AA1 6 TRP A 44 ? ILE A 46 ? TRP A 46 ILE A 48 AA1 7 ARG A 6 ? VAL A 11 ? ARG A 8 VAL A 13 AA1 8 GLY A 127 ? ALA A 129 ? GLY A 129 ALA A 131 AA2 1 CYS A 17 ? VAL A 20 ? CYS A 19 VAL A 22 AA2 2 THR A 31 ? TRP A 34 ? THR A 33 TRP A 36 AA3 1 TRP A 85 ? LEU A 87 ? TRP A 87 LEU A 89 AA3 2 LEU A 93 ? HIS A 95 ? LEU A 95 HIS A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 103 ? N THR A 105 O THR A 114 ? O THR A 116 AA1 2 3 O ILE A 115 ? O ILE A 117 N SER A 68 ? N SER A 70 AA1 3 4 O ASP A 73 ? O ASP A 75 N CYS A 58 ? N CYS A 60 AA1 4 5 O LEU A 59 ? O LEU A 61 N ILE A 52 ? N ILE A 54 AA1 5 6 O ARG A 53 ? O ARG A 55 N THR A 45 ? N THR A 47 AA1 6 7 O TRP A 44 ? O TRP A 46 N THR A 8 ? N THR A 10 AA1 7 8 N VAL A 11 ? N VAL A 13 O GLY A 127 ? O GLY A 129 AA2 1 2 N CYS A 17 ? N CYS A 19 O TRP A 34 ? O TRP A 36 AA3 1 2 N LYS A 86 ? N LYS A 88 O THR A 94 ? O THR A 96 # _pdbx_entry_details.entry_id 8R8A _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 30 ? ? 81.17 15.29 2 1 TYR A 112 ? ? 70.75 30.02 # _pdbx_molecule_features.prd_id PRD_900019 _pdbx_molecule_features.name N-acetyl-alpha-lactosamine _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class 'Glycan component' _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900019 _pdbx_molecule.asym_id B # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 524 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O A A HOH 536 ? 6.05 . 2 1 O ? A HOH 537 ? 6.31 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 3 ? A GLY 1 2 1 Y 1 A ALA 4 ? A ALA 2 3 1 Y 1 A MET 5 ? A MET 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CD CD CD N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GAL C1 C N R 89 GAL C2 C N R 90 GAL C3 C N S 91 GAL C4 C N R 92 GAL C5 C N R 93 GAL C6 C N N 94 GAL O1 O N N 95 GAL O2 O N N 96 GAL O3 O N N 97 GAL O4 O N N 98 GAL O5 O N N 99 GAL O6 O N N 100 GAL H1 H N N 101 GAL H2 H N N 102 GAL H3 H N N 103 GAL H4 H N N 104 GAL H5 H N N 105 GAL H61 H N N 106 GAL H62 H N N 107 GAL HO1 H N N 108 GAL HO2 H N N 109 GAL HO3 H N N 110 GAL HO4 H N N 111 GAL HO6 H N N 112 GLN N N N N 113 GLN CA C N S 114 GLN C C N N 115 GLN O O N N 116 GLN CB C N N 117 GLN CG C N N 118 GLN CD C N N 119 GLN OE1 O N N 120 GLN NE2 N N N 121 GLN OXT O N N 122 GLN H H N N 123 GLN H2 H N N 124 GLN HA H N N 125 GLN HB2 H N N 126 GLN HB3 H N N 127 GLN HG2 H N N 128 GLN HG3 H N N 129 GLN HE21 H N N 130 GLN HE22 H N N 131 GLN HXT H N N 132 GLU N N N N 133 GLU CA C N S 134 GLU C C N N 135 GLU O O N N 136 GLU CB C N N 137 GLU CG C N N 138 GLU CD C N N 139 GLU OE1 O N N 140 GLU OE2 O N N 141 GLU OXT O N N 142 GLU H H N N 143 GLU H2 H N N 144 GLU HA H N N 145 GLU HB2 H N N 146 GLU HB3 H N N 147 GLU HG2 H N N 148 GLU HG3 H N N 149 GLU HE2 H N N 150 GLU HXT H N N 151 GLY N N N N 152 GLY CA C N N 153 GLY C C N N 154 GLY O O N N 155 GLY OXT O N N 156 GLY H H N N 157 GLY H2 H N N 158 GLY HA2 H N N 159 GLY HA3 H N N 160 GLY HXT H N N 161 HIS N N N N 162 HIS CA C N S 163 HIS C C N N 164 HIS O O N N 165 HIS CB C N N 166 HIS CG C Y N 167 HIS ND1 N Y N 168 HIS CD2 C Y N 169 HIS CE1 C Y N 170 HIS NE2 N Y N 171 HIS OXT O N N 172 HIS H H N N 173 HIS H2 H N N 174 HIS HA H N N 175 HIS HB2 H N N 176 HIS HB3 H N N 177 HIS HD1 H N N 178 HIS HD2 H N N 179 HIS HE1 H N N 180 HIS HE2 H N N 181 HIS HXT H N N 182 HOH O O N N 183 HOH H1 H N N 184 HOH H2 H N N 185 ILE N N N N 186 ILE CA C N S 187 ILE C C N N 188 ILE O O N N 189 ILE CB C N S 190 ILE CG1 C N N 191 ILE CG2 C N N 192 ILE CD1 C N N 193 ILE OXT O N N 194 ILE H H N N 195 ILE H2 H N N 196 ILE HA H N N 197 ILE HB H N N 198 ILE HG12 H N N 199 ILE HG13 H N N 200 ILE HG21 H N N 201 ILE HG22 H N N 202 ILE HG23 H N N 203 ILE HD11 H N N 204 ILE HD12 H N N 205 ILE HD13 H N N 206 ILE HXT H N N 207 LEU N N N N 208 LEU CA C N S 209 LEU C C N N 210 LEU O O N N 211 LEU CB C N N 212 LEU CG C N N 213 LEU CD1 C N N 214 LEU CD2 C N N 215 LEU OXT O N N 216 LEU H H N N 217 LEU H2 H N N 218 LEU HA H N N 219 LEU HB2 H N N 220 LEU HB3 H N N 221 LEU HG H N N 222 LEU HD11 H N N 223 LEU HD12 H N N 224 LEU HD13 H N N 225 LEU HD21 H N N 226 LEU HD22 H N N 227 LEU HD23 H N N 228 LEU HXT H N N 229 LYS N N N N 230 LYS CA C N S 231 LYS C C N N 232 LYS O O N N 233 LYS CB C N N 234 LYS CG C N N 235 LYS CD C N N 236 LYS CE C N N 237 LYS NZ N N N 238 LYS OXT O N N 239 LYS H H N N 240 LYS H2 H N N 241 LYS HA H N N 242 LYS HB2 H N N 243 LYS HB3 H N N 244 LYS HG2 H N N 245 LYS HG3 H N N 246 LYS HD2 H N N 247 LYS HD3 H N N 248 LYS HE2 H N N 249 LYS HE3 H N N 250 LYS HZ1 H N N 251 LYS HZ2 H N N 252 LYS HZ3 H N N 253 LYS HXT H N N 254 MET N N N N 255 MET CA C N S 256 MET C C N N 257 MET O O N N 258 MET CB C N N 259 MET CG C N N 260 MET SD S N N 261 MET CE C N N 262 MET OXT O N N 263 MET H H N N 264 MET H2 H N N 265 MET HA H N N 266 MET HB2 H N N 267 MET HB3 H N N 268 MET HG2 H N N 269 MET HG3 H N N 270 MET HE1 H N N 271 MET HE2 H N N 272 MET HE3 H N N 273 MET HXT H N N 274 NDG C1 C N S 275 NDG C2 C N R 276 NDG C3 C N R 277 NDG C4 C N S 278 NDG C5 C N R 279 NDG C6 C N N 280 NDG C7 C N N 281 NDG C8 C N N 282 NDG O5 O N N 283 NDG O3 O N N 284 NDG O4 O N N 285 NDG O6 O N N 286 NDG O7 O N N 287 NDG N2 N N N 288 NDG O1 O N N 289 NDG H1 H N N 290 NDG H2 H N N 291 NDG H3 H N N 292 NDG H4 H N N 293 NDG H5 H N N 294 NDG H61 H N N 295 NDG H62 H N N 296 NDG H81 H N N 297 NDG H82 H N N 298 NDG H83 H N N 299 NDG HO3 H N N 300 NDG HO4 H N N 301 NDG HO6 H N N 302 NDG HN2 H N N 303 NDG HO1 H N N 304 PRO N N N N 305 PRO CA C N S 306 PRO C C N N 307 PRO O O N N 308 PRO CB C N N 309 PRO CG C N N 310 PRO CD C N N 311 PRO OXT O N N 312 PRO H H N N 313 PRO HA H N N 314 PRO HB2 H N N 315 PRO HB3 H N N 316 PRO HG2 H N N 317 PRO HG3 H N N 318 PRO HD2 H N N 319 PRO HD3 H N N 320 PRO HXT H N N 321 SER N N N N 322 SER CA C N S 323 SER C C N N 324 SER O O N N 325 SER CB C N N 326 SER OG O N N 327 SER OXT O N N 328 SER H H N N 329 SER H2 H N N 330 SER HA H N N 331 SER HB2 H N N 332 SER HB3 H N N 333 SER HG H N N 334 SER HXT H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GAL C1 C2 sing N N 83 GAL C1 O1 sing N N 84 GAL C1 O5 sing N N 85 GAL C1 H1 sing N N 86 GAL C2 C3 sing N N 87 GAL C2 O2 sing N N 88 GAL C2 H2 sing N N 89 GAL C3 C4 sing N N 90 GAL C3 O3 sing N N 91 GAL C3 H3 sing N N 92 GAL C4 C5 sing N N 93 GAL C4 O4 sing N N 94 GAL C4 H4 sing N N 95 GAL C5 C6 sing N N 96 GAL C5 O5 sing N N 97 GAL C5 H5 sing N N 98 GAL C6 O6 sing N N 99 GAL C6 H61 sing N N 100 GAL C6 H62 sing N N 101 GAL O1 HO1 sing N N 102 GAL O2 HO2 sing N N 103 GAL O3 HO3 sing N N 104 GAL O4 HO4 sing N N 105 GAL O6 HO6 sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 HOH O H1 sing N N 174 HOH O H2 sing N N 175 ILE N CA sing N N 176 ILE N H sing N N 177 ILE N H2 sing N N 178 ILE CA C sing N N 179 ILE CA CB sing N N 180 ILE CA HA sing N N 181 ILE C O doub N N 182 ILE C OXT sing N N 183 ILE CB CG1 sing N N 184 ILE CB CG2 sing N N 185 ILE CB HB sing N N 186 ILE CG1 CD1 sing N N 187 ILE CG1 HG12 sing N N 188 ILE CG1 HG13 sing N N 189 ILE CG2 HG21 sing N N 190 ILE CG2 HG22 sing N N 191 ILE CG2 HG23 sing N N 192 ILE CD1 HD11 sing N N 193 ILE CD1 HD12 sing N N 194 ILE CD1 HD13 sing N N 195 ILE OXT HXT sing N N 196 LEU N CA sing N N 197 LEU N H sing N N 198 LEU N H2 sing N N 199 LEU CA C sing N N 200 LEU CA CB sing N N 201 LEU CA HA sing N N 202 LEU C O doub N N 203 LEU C OXT sing N N 204 LEU CB CG sing N N 205 LEU CB HB2 sing N N 206 LEU CB HB3 sing N N 207 LEU CG CD1 sing N N 208 LEU CG CD2 sing N N 209 LEU CG HG sing N N 210 LEU CD1 HD11 sing N N 211 LEU CD1 HD12 sing N N 212 LEU CD1 HD13 sing N N 213 LEU CD2 HD21 sing N N 214 LEU CD2 HD22 sing N N 215 LEU CD2 HD23 sing N N 216 LEU OXT HXT sing N N 217 LYS N CA sing N N 218 LYS N H sing N N 219 LYS N H2 sing N N 220 LYS CA C sing N N 221 LYS CA CB sing N N 222 LYS CA HA sing N N 223 LYS C O doub N N 224 LYS C OXT sing N N 225 LYS CB CG sing N N 226 LYS CB HB2 sing N N 227 LYS CB HB3 sing N N 228 LYS CG CD sing N N 229 LYS CG HG2 sing N N 230 LYS CG HG3 sing N N 231 LYS CD CE sing N N 232 LYS CD HD2 sing N N 233 LYS CD HD3 sing N N 234 LYS CE NZ sing N N 235 LYS CE HE2 sing N N 236 LYS CE HE3 sing N N 237 LYS NZ HZ1 sing N N 238 LYS NZ HZ2 sing N N 239 LYS NZ HZ3 sing N N 240 LYS OXT HXT sing N N 241 MET N CA sing N N 242 MET N H sing N N 243 MET N H2 sing N N 244 MET CA C sing N N 245 MET CA CB sing N N 246 MET CA HA sing N N 247 MET C O doub N N 248 MET C OXT sing N N 249 MET CB CG sing N N 250 MET CB HB2 sing N N 251 MET CB HB3 sing N N 252 MET CG SD sing N N 253 MET CG HG2 sing N N 254 MET CG HG3 sing N N 255 MET SD CE sing N N 256 MET CE HE1 sing N N 257 MET CE HE2 sing N N 258 MET CE HE3 sing N N 259 MET OXT HXT sing N N 260 NDG C1 C2 sing N N 261 NDG C1 O5 sing N N 262 NDG C1 O1 sing N N 263 NDG C1 H1 sing N N 264 NDG C2 C3 sing N N 265 NDG C2 N2 sing N N 266 NDG C2 H2 sing N N 267 NDG C3 C4 sing N N 268 NDG C3 O3 sing N N 269 NDG C3 H3 sing N N 270 NDG C4 C5 sing N N 271 NDG C4 O4 sing N N 272 NDG C4 H4 sing N N 273 NDG C5 C6 sing N N 274 NDG C5 O5 sing N N 275 NDG C5 H5 sing N N 276 NDG C6 O6 sing N N 277 NDG C6 H61 sing N N 278 NDG C6 H62 sing N N 279 NDG C7 C8 sing N N 280 NDG C7 O7 doub N N 281 NDG C7 N2 sing N N 282 NDG C8 H81 sing N N 283 NDG C8 H82 sing N N 284 NDG C8 H83 sing N N 285 NDG O3 HO3 sing N N 286 NDG O4 HO4 sing N N 287 NDG O6 HO6 sing N N 288 NDG N2 HN2 sing N N 289 NDG O1 HO1 sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Knut and Alice Wallenberg Foundation' Sweden ? 1 'Branco Weiss Fellowship - Society in Science' Switzerland ? 2 'COST (European Cooperation in Science and Technology) action' 'European Union' CA18103 3 'COST (European Cooperation in Science and Technology) action' 'European Union' CA18132 4 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NDG 1 n 2 GAL 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code A0A1S4E5V9 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8R8A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.027251 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004432 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027187 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010689 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CD 48 48 19.2218 0.5946 17.6447 6.9089 4.4611 24.7008 1.6029 87.4825 4.5906 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0493 # loop_