data_8R9R # _entry.id 8R9R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.388 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8R9R pdb_00008r9r 10.2210/pdb8r9r/pdb WWPDB D_1292134889 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8R9R _pdbx_database_status.recvd_initial_deposition_date 2023-11-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email bangeg@staff.uni-marburg.de _pdbx_contact_author.name_first Gert _pdbx_contact_author.name_last Bange _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7826-0932 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mais, C.N.' 1 0000-0003-1927-2885 'Dornes, A.' 2 0000-0002-1060-3636 'Bange, G.' 3 0000-0002-7826-0932 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_id_ASTM ACSFEN _citation.journal_id_CSD ? _citation.journal_id_ISSN 2053-230X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 80 _citation.language ? _citation.page_first 53 _citation.page_last 58 _citation.title 'Structure of the GDP-bound state of the SRP GTPase FlhF.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2053230X24000979 _citation.pdbx_database_id_PubMed 38376823 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dornes, A.' 1 0000-0002-1060-3636 primary 'Mais, C.N.' 2 0000-0003-1927-2885 primary 'Bange, G.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Flagellar biosynthesis protein FlhF' 32288.875 1 ? ? ? ? 2 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSLMTEHKKRIDPVGAMLESKLLEAEFSPAVAAKLAALSQHYTPAELVRALPQSLANMLDNQGDDIVRQGGVVALVGP TGVGKTTSLAKLAARFAAHHGPEQVALITTDHYRIGAYEQLATYGKIMGCPVKQAHDLNELEQILYQFRNRKLVLIDTAG MGQRDMRLYQQLDNLTANSRIPIRSYLVLSATGQRRVLQDAVNHFKRIPLSGAVLTKLDESVSLAGALSVLIQSGLPLSY VTDGQRVPEDMKVADTLMLAQQALATLDSTEQQSLQDTAWSDNMACAFEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSLMTEHKKRIDPVGAMLESKLLEAEFSPAVAAKLAALSQHYTPAELVRALPQSLANMLDNQGDDIVRQGGVVALVGP TGVGKTTSLAKLAARFAAHHGPEQVALITTDHYRIGAYEQLATYGKIMGCPVKQAHDLNELEQILYQFRNRKLVLIDTAG MGQRDMRLYQQLDNLTANSRIPIRSYLVLSATGQRRVLQDAVNHFKRIPLSGAVLTKLDESVSLAGALSVLIQSGLPLSY VTDGQRVPEDMKVADTLMLAQQALATLDSTEQQSLQDTAWSDNMACAFEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "GUANOSINE-5'-DIPHOSPHATE" GDP 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 LEU n 1 6 MET n 1 7 THR n 1 8 GLU n 1 9 HIS n 1 10 LYS n 1 11 LYS n 1 12 ARG n 1 13 ILE n 1 14 ASP n 1 15 PRO n 1 16 VAL n 1 17 GLY n 1 18 ALA n 1 19 MET n 1 20 LEU n 1 21 GLU n 1 22 SER n 1 23 LYS n 1 24 LEU n 1 25 LEU n 1 26 GLU n 1 27 ALA n 1 28 GLU n 1 29 PHE n 1 30 SER n 1 31 PRO n 1 32 ALA n 1 33 VAL n 1 34 ALA n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 ALA n 1 39 ALA n 1 40 LEU n 1 41 SER n 1 42 GLN n 1 43 HIS n 1 44 TYR n 1 45 THR n 1 46 PRO n 1 47 ALA n 1 48 GLU n 1 49 LEU n 1 50 VAL n 1 51 ARG n 1 52 ALA n 1 53 LEU n 1 54 PRO n 1 55 GLN n 1 56 SER n 1 57 LEU n 1 58 ALA n 1 59 ASN n 1 60 MET n 1 61 LEU n 1 62 ASP n 1 63 ASN n 1 64 GLN n 1 65 GLY n 1 66 ASP n 1 67 ASP n 1 68 ILE n 1 69 VAL n 1 70 ARG n 1 71 GLN n 1 72 GLY n 1 73 GLY n 1 74 VAL n 1 75 VAL n 1 76 ALA n 1 77 LEU n 1 78 VAL n 1 79 GLY n 1 80 PRO n 1 81 THR n 1 82 GLY n 1 83 VAL n 1 84 GLY n 1 85 LYS n 1 86 THR n 1 87 THR n 1 88 SER n 1 89 LEU n 1 90 ALA n 1 91 LYS n 1 92 LEU n 1 93 ALA n 1 94 ALA n 1 95 ARG n 1 96 PHE n 1 97 ALA n 1 98 ALA n 1 99 HIS n 1 100 HIS n 1 101 GLY n 1 102 PRO n 1 103 GLU n 1 104 GLN n 1 105 VAL n 1 106 ALA n 1 107 LEU n 1 108 ILE n 1 109 THR n 1 110 THR n 1 111 ASP n 1 112 HIS n 1 113 TYR n 1 114 ARG n 1 115 ILE n 1 116 GLY n 1 117 ALA n 1 118 TYR n 1 119 GLU n 1 120 GLN n 1 121 LEU n 1 122 ALA n 1 123 THR n 1 124 TYR n 1 125 GLY n 1 126 LYS n 1 127 ILE n 1 128 MET n 1 129 GLY n 1 130 CYS n 1 131 PRO n 1 132 VAL n 1 133 LYS n 1 134 GLN n 1 135 ALA n 1 136 HIS n 1 137 ASP n 1 138 LEU n 1 139 ASN n 1 140 GLU n 1 141 LEU n 1 142 GLU n 1 143 GLN n 1 144 ILE n 1 145 LEU n 1 146 TYR n 1 147 GLN n 1 148 PHE n 1 149 ARG n 1 150 ASN n 1 151 ARG n 1 152 LYS n 1 153 LEU n 1 154 VAL n 1 155 LEU n 1 156 ILE n 1 157 ASP n 1 158 THR n 1 159 ALA n 1 160 GLY n 1 161 MET n 1 162 GLY n 1 163 GLN n 1 164 ARG n 1 165 ASP n 1 166 MET n 1 167 ARG n 1 168 LEU n 1 169 TYR n 1 170 GLN n 1 171 GLN n 1 172 LEU n 1 173 ASP n 1 174 ASN n 1 175 LEU n 1 176 THR n 1 177 ALA n 1 178 ASN n 1 179 SER n 1 180 ARG n 1 181 ILE n 1 182 PRO n 1 183 ILE n 1 184 ARG n 1 185 SER n 1 186 TYR n 1 187 LEU n 1 188 VAL n 1 189 LEU n 1 190 SER n 1 191 ALA n 1 192 THR n 1 193 GLY n 1 194 GLN n 1 195 ARG n 1 196 ARG n 1 197 VAL n 1 198 LEU n 1 199 GLN n 1 200 ASP n 1 201 ALA n 1 202 VAL n 1 203 ASN n 1 204 HIS n 1 205 PHE n 1 206 LYS n 1 207 ARG n 1 208 ILE n 1 209 PRO n 1 210 LEU n 1 211 SER n 1 212 GLY n 1 213 ALA n 1 214 VAL n 1 215 LEU n 1 216 THR n 1 217 LYS n 1 218 LEU n 1 219 ASP n 1 220 GLU n 1 221 SER n 1 222 VAL n 1 223 SER n 1 224 LEU n 1 225 ALA n 1 226 GLY n 1 227 ALA n 1 228 LEU n 1 229 SER n 1 230 VAL n 1 231 LEU n 1 232 ILE n 1 233 GLN n 1 234 SER n 1 235 GLY n 1 236 LEU n 1 237 PRO n 1 238 LEU n 1 239 SER n 1 240 TYR n 1 241 VAL n 1 242 THR n 1 243 ASP n 1 244 GLY n 1 245 GLN n 1 246 ARG n 1 247 VAL n 1 248 PRO n 1 249 GLU n 1 250 ASP n 1 251 MET n 1 252 LYS n 1 253 VAL n 1 254 ALA n 1 255 ASP n 1 256 THR n 1 257 LEU n 1 258 MET n 1 259 LEU n 1 260 ALA n 1 261 GLN n 1 262 GLN n 1 263 ALA n 1 264 LEU n 1 265 ALA n 1 266 THR n 1 267 LEU n 1 268 ASP n 1 269 SER n 1 270 THR n 1 271 GLU n 1 272 GLN n 1 273 GLN n 1 274 SER n 1 275 LEU n 1 276 GLN n 1 277 ASP n 1 278 THR n 1 279 ALA n 1 280 TRP n 1 281 SER n 1 282 ASP n 1 283 ASN n 1 284 MET n 1 285 ALA n 1 286 CYS n 1 287 ALA n 1 288 PHE n 1 289 GLU n 1 290 HIS n 1 291 HIS n 1 292 HIS n 1 293 HIS n 1 294 HIS n 1 295 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 295 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Sputcn32_2561 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shewanella putrefaciens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 319224 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 170 ? ? ? A . n A 1 2 GLY 2 171 ? ? ? A . n A 1 3 SER 3 172 ? ? ? A . n A 1 4 SER 4 173 ? ? ? A . n A 1 5 LEU 5 174 ? ? ? A . n A 1 6 MET 6 175 ? ? ? A . n A 1 7 THR 7 176 ? ? ? A . n A 1 8 GLU 8 177 ? ? ? A . n A 1 9 HIS 9 178 ? ? ? A . n A 1 10 LYS 10 179 ? ? ? A . n A 1 11 LYS 11 180 ? ? ? A . n A 1 12 ARG 12 181 ? ? ? A . n A 1 13 ILE 13 182 ? ? ? A . n A 1 14 ASP 14 183 183 ASP ASP A . n A 1 15 PRO 15 184 184 PRO PRO A . n A 1 16 VAL 16 185 185 VAL VAL A . n A 1 17 GLY 17 186 186 GLY GLY A . n A 1 18 ALA 18 187 187 ALA ALA A . n A 1 19 MET 19 188 188 MET MET A . n A 1 20 LEU 20 189 189 LEU LEU A . n A 1 21 GLU 21 190 190 GLU GLU A . n A 1 22 SER 22 191 191 SER SER A . n A 1 23 LYS 23 192 192 LYS LYS A . n A 1 24 LEU 24 193 193 LEU LEU A . n A 1 25 LEU 25 194 194 LEU LEU A . n A 1 26 GLU 26 195 195 GLU GLU A . n A 1 27 ALA 27 196 196 ALA ALA A . n A 1 28 GLU 28 197 197 GLU GLU A . n A 1 29 PHE 29 198 198 PHE PHE A . n A 1 30 SER 30 199 199 SER SER A . n A 1 31 PRO 31 200 200 PRO PRO A . n A 1 32 ALA 32 201 201 ALA ALA A . n A 1 33 VAL 33 202 202 VAL VAL A . n A 1 34 ALA 34 203 203 ALA ALA A . n A 1 35 ALA 35 204 204 ALA ALA A . n A 1 36 LYS 36 205 205 LYS LYS A . n A 1 37 LEU 37 206 206 LEU LEU A . n A 1 38 ALA 38 207 207 ALA ALA A . n A 1 39 ALA 39 208 208 ALA ALA A . n A 1 40 LEU 40 209 209 LEU LEU A . n A 1 41 SER 41 210 210 SER SER A . n A 1 42 GLN 42 211 211 GLN GLN A . n A 1 43 HIS 43 212 212 HIS HIS A . n A 1 44 TYR 44 213 213 TYR TYR A . n A 1 45 THR 45 214 214 THR THR A . n A 1 46 PRO 46 215 215 PRO PRO A . n A 1 47 ALA 47 216 216 ALA ALA A . n A 1 48 GLU 48 217 217 GLU GLU A . n A 1 49 LEU 49 218 218 LEU LEU A . n A 1 50 VAL 50 219 219 VAL VAL A . n A 1 51 ARG 51 220 220 ARG ARG A . n A 1 52 ALA 52 221 221 ALA ALA A . n A 1 53 LEU 53 222 222 LEU LEU A . n A 1 54 PRO 54 223 223 PRO PRO A . n A 1 55 GLN 55 224 224 GLN GLN A . n A 1 56 SER 56 225 225 SER SER A . n A 1 57 LEU 57 226 226 LEU LEU A . n A 1 58 ALA 58 227 227 ALA ALA A . n A 1 59 ASN 59 228 228 ASN ASN A . n A 1 60 MET 60 229 229 MET MET A . n A 1 61 LEU 61 230 230 LEU LEU A . n A 1 62 ASP 62 231 231 ASP ASP A . n A 1 63 ASN 63 232 232 ASN ASN A . n A 1 64 GLN 64 233 233 GLN GLN A . n A 1 65 GLY 65 234 234 GLY GLY A . n A 1 66 ASP 66 235 235 ASP ASP A . n A 1 67 ASP 67 236 236 ASP ASP A . n A 1 68 ILE 68 237 237 ILE ILE A . n A 1 69 VAL 69 238 238 VAL VAL A . n A 1 70 ARG 70 239 239 ARG ARG A . n A 1 71 GLN 71 240 240 GLN GLN A . n A 1 72 GLY 72 241 241 GLY GLY A . n A 1 73 GLY 73 242 242 GLY GLY A . n A 1 74 VAL 74 243 243 VAL VAL A . n A 1 75 VAL 75 244 244 VAL VAL A . n A 1 76 ALA 76 245 245 ALA ALA A . n A 1 77 LEU 77 246 246 LEU LEU A . n A 1 78 VAL 78 247 247 VAL VAL A . n A 1 79 GLY 79 248 248 GLY GLY A . n A 1 80 PRO 80 249 249 PRO PRO A . n A 1 81 THR 81 250 250 THR THR A . n A 1 82 GLY 82 251 251 GLY GLY A . n A 1 83 VAL 83 252 252 VAL VAL A . n A 1 84 GLY 84 253 253 GLY GLY A . n A 1 85 LYS 85 254 254 LYS LYS A . n A 1 86 THR 86 255 255 THR THR A . n A 1 87 THR 87 256 256 THR THR A . n A 1 88 SER 88 257 257 SER SER A . n A 1 89 LEU 89 258 258 LEU LEU A . n A 1 90 ALA 90 259 259 ALA ALA A . n A 1 91 LYS 91 260 260 LYS LYS A . n A 1 92 LEU 92 261 261 LEU LEU A . n A 1 93 ALA 93 262 262 ALA ALA A . n A 1 94 ALA 94 263 263 ALA ALA A . n A 1 95 ARG 95 264 264 ARG ARG A . n A 1 96 PHE 96 265 265 PHE PHE A . n A 1 97 ALA 97 266 266 ALA ALA A . n A 1 98 ALA 98 267 267 ALA ALA A . n A 1 99 HIS 99 268 268 HIS HIS A . n A 1 100 HIS 100 269 269 HIS HIS A . n A 1 101 GLY 101 270 270 GLY GLY A . n A 1 102 PRO 102 271 271 PRO PRO A . n A 1 103 GLU 103 272 272 GLU GLU A . n A 1 104 GLN 104 273 273 GLN GLN A . n A 1 105 VAL 105 274 274 VAL VAL A . n A 1 106 ALA 106 275 275 ALA ALA A . n A 1 107 LEU 107 276 276 LEU LEU A . n A 1 108 ILE 108 277 277 ILE ILE A . n A 1 109 THR 109 278 278 THR THR A . n A 1 110 THR 110 279 279 THR THR A . n A 1 111 ASP 111 280 280 ASP ASP A . n A 1 112 HIS 112 281 281 HIS HIS A . n A 1 113 TYR 113 282 282 TYR TYR A . n A 1 114 ARG 114 283 283 ARG ARG A . n A 1 115 ILE 115 284 284 ILE ILE A . n A 1 116 GLY 116 285 285 GLY GLY A . n A 1 117 ALA 117 286 286 ALA ALA A . n A 1 118 TYR 118 287 287 TYR TYR A . n A 1 119 GLU 119 288 288 GLU GLU A . n A 1 120 GLN 120 289 289 GLN GLN A . n A 1 121 LEU 121 290 290 LEU LEU A . n A 1 122 ALA 122 291 291 ALA ALA A . n A 1 123 THR 123 292 292 THR THR A . n A 1 124 TYR 124 293 293 TYR TYR A . n A 1 125 GLY 125 294 294 GLY GLY A . n A 1 126 LYS 126 295 295 LYS LYS A . n A 1 127 ILE 127 296 296 ILE ILE A . n A 1 128 MET 128 297 297 MET MET A . n A 1 129 GLY 129 298 298 GLY GLY A . n A 1 130 CYS 130 299 299 CYS CYS A . n A 1 131 PRO 131 300 300 PRO PRO A . n A 1 132 VAL 132 301 301 VAL VAL A . n A 1 133 LYS 133 302 302 LYS LYS A . n A 1 134 GLN 134 303 303 GLN GLN A . n A 1 135 ALA 135 304 304 ALA ALA A . n A 1 136 HIS 136 305 305 HIS HIS A . n A 1 137 ASP 137 306 306 ASP ASP A . n A 1 138 LEU 138 307 307 LEU LEU A . n A 1 139 ASN 139 308 308 ASN ASN A . n A 1 140 GLU 140 309 309 GLU GLU A . n A 1 141 LEU 141 310 310 LEU LEU A . n A 1 142 GLU 142 311 311 GLU GLU A . n A 1 143 GLN 143 312 312 GLN GLN A . n A 1 144 ILE 144 313 313 ILE ILE A . n A 1 145 LEU 145 314 314 LEU LEU A . n A 1 146 TYR 146 315 315 TYR TYR A . n A 1 147 GLN 147 316 316 GLN GLN A . n A 1 148 PHE 148 317 317 PHE PHE A . n A 1 149 ARG 149 318 318 ARG ARG A . n A 1 150 ASN 150 319 319 ASN ASN A . n A 1 151 ARG 151 320 320 ARG ARG A . n A 1 152 LYS 152 321 321 LYS LYS A . n A 1 153 LEU 153 322 322 LEU LEU A . n A 1 154 VAL 154 323 323 VAL VAL A . n A 1 155 LEU 155 324 324 LEU LEU A . n A 1 156 ILE 156 325 325 ILE ILE A . n A 1 157 ASP 157 326 326 ASP ASP A . n A 1 158 THR 158 327 327 THR THR A . n A 1 159 ALA 159 328 328 ALA ALA A . n A 1 160 GLY 160 329 329 GLY GLY A . n A 1 161 MET 161 330 330 MET MET A . n A 1 162 GLY 162 331 331 GLY GLY A . n A 1 163 GLN 163 332 332 GLN GLN A . n A 1 164 ARG 164 333 333 ARG ARG A . n A 1 165 ASP 165 334 334 ASP ASP A . n A 1 166 MET 166 335 335 MET MET A . n A 1 167 ARG 167 336 336 ARG ARG A . n A 1 168 LEU 168 337 337 LEU LEU A . n A 1 169 TYR 169 338 338 TYR TYR A . n A 1 170 GLN 170 339 339 GLN GLN A . n A 1 171 GLN 171 340 340 GLN GLN A . n A 1 172 LEU 172 341 341 LEU LEU A . n A 1 173 ASP 173 342 342 ASP ASP A . n A 1 174 ASN 174 343 343 ASN ASN A . n A 1 175 LEU 175 344 344 LEU LEU A . n A 1 176 THR 176 345 345 THR THR A . n A 1 177 ALA 177 346 346 ALA ALA A . n A 1 178 ASN 178 347 347 ASN ASN A . n A 1 179 SER 179 348 348 SER SER A . n A 1 180 ARG 180 349 349 ARG ARG A . n A 1 181 ILE 181 350 350 ILE ILE A . n A 1 182 PRO 182 351 351 PRO PRO A . n A 1 183 ILE 183 352 352 ILE ILE A . n A 1 184 ARG 184 353 353 ARG ARG A . n A 1 185 SER 185 354 354 SER SER A . n A 1 186 TYR 186 355 355 TYR TYR A . n A 1 187 LEU 187 356 356 LEU LEU A . n A 1 188 VAL 188 357 357 VAL VAL A . n A 1 189 LEU 189 358 358 LEU LEU A . n A 1 190 SER 190 359 359 SER SER A . n A 1 191 ALA 191 360 360 ALA ALA A . n A 1 192 THR 192 361 361 THR THR A . n A 1 193 GLY 193 362 362 GLY GLY A . n A 1 194 GLN 194 363 363 GLN GLN A . n A 1 195 ARG 195 364 364 ARG ARG A . n A 1 196 ARG 196 365 365 ARG ARG A . n A 1 197 VAL 197 366 366 VAL VAL A . n A 1 198 LEU 198 367 367 LEU LEU A . n A 1 199 GLN 199 368 368 GLN GLN A . n A 1 200 ASP 200 369 369 ASP ASP A . n A 1 201 ALA 201 370 370 ALA ALA A . n A 1 202 VAL 202 371 371 VAL VAL A . n A 1 203 ASN 203 372 372 ASN ASN A . n A 1 204 HIS 204 373 373 HIS HIS A . n A 1 205 PHE 205 374 374 PHE PHE A . n A 1 206 LYS 206 375 375 LYS LYS A . n A 1 207 ARG 207 376 376 ARG ARG A . n A 1 208 ILE 208 377 377 ILE ILE A . n A 1 209 PRO 209 378 378 PRO PRO A . n A 1 210 LEU 210 379 379 LEU LEU A . n A 1 211 SER 211 380 380 SER SER A . n A 1 212 GLY 212 381 381 GLY GLY A . n A 1 213 ALA 213 382 382 ALA ALA A . n A 1 214 VAL 214 383 383 VAL VAL A . n A 1 215 LEU 215 384 384 LEU LEU A . n A 1 216 THR 216 385 385 THR THR A . n A 1 217 LYS 217 386 386 LYS LYS A . n A 1 218 LEU 218 387 387 LEU LEU A . n A 1 219 ASP 219 388 388 ASP ASP A . n A 1 220 GLU 220 389 389 GLU GLU A . n A 1 221 SER 221 390 390 SER SER A . n A 1 222 VAL 222 391 391 VAL VAL A . n A 1 223 SER 223 392 392 SER SER A . n A 1 224 LEU 224 393 393 LEU LEU A . n A 1 225 ALA 225 394 394 ALA ALA A . n A 1 226 GLY 226 395 395 GLY GLY A . n A 1 227 ALA 227 396 396 ALA ALA A . n A 1 228 LEU 228 397 397 LEU LEU A . n A 1 229 SER 229 398 398 SER SER A . n A 1 230 VAL 230 399 399 VAL VAL A . n A 1 231 LEU 231 400 400 LEU LEU A . n A 1 232 ILE 232 401 401 ILE ILE A . n A 1 233 GLN 233 402 402 GLN GLN A . n A 1 234 SER 234 403 403 SER SER A . n A 1 235 GLY 235 404 404 GLY GLY A . n A 1 236 LEU 236 405 405 LEU LEU A . n A 1 237 PRO 237 406 406 PRO PRO A . n A 1 238 LEU 238 407 407 LEU LEU A . n A 1 239 SER 239 408 408 SER SER A . n A 1 240 TYR 240 409 409 TYR TYR A . n A 1 241 VAL 241 410 410 VAL VAL A . n A 1 242 THR 242 411 411 THR THR A . n A 1 243 ASP 243 412 412 ASP ASP A . n A 1 244 GLY 244 413 413 GLY GLY A . n A 1 245 GLN 245 414 414 GLN GLN A . n A 1 246 ARG 246 415 415 ARG ARG A . n A 1 247 VAL 247 416 416 VAL VAL A . n A 1 248 PRO 248 417 417 PRO PRO A . n A 1 249 GLU 249 418 418 GLU GLU A . n A 1 250 ASP 250 419 419 ASP ASP A . n A 1 251 MET 251 420 420 MET MET A . n A 1 252 LYS 252 421 421 LYS LYS A . n A 1 253 VAL 253 422 422 VAL VAL A . n A 1 254 ALA 254 423 423 ALA ALA A . n A 1 255 ASP 255 424 424 ASP ASP A . n A 1 256 THR 256 425 425 THR THR A . n A 1 257 LEU 257 426 426 LEU LEU A . n A 1 258 MET 258 427 427 MET MET A . n A 1 259 LEU 259 428 428 LEU LEU A . n A 1 260 ALA 260 429 429 ALA ALA A . n A 1 261 GLN 261 430 430 GLN GLN A . n A 1 262 GLN 262 431 431 GLN GLN A . n A 1 263 ALA 263 432 432 ALA ALA A . n A 1 264 LEU 264 433 433 LEU LEU A . n A 1 265 ALA 265 434 434 ALA ALA A . n A 1 266 THR 266 435 435 THR THR A . n A 1 267 LEU 267 436 436 LEU LEU A . n A 1 268 ASP 268 437 437 ASP ASP A . n A 1 269 SER 269 438 ? ? ? A . n A 1 270 THR 270 439 ? ? ? A . n A 1 271 GLU 271 440 ? ? ? A . n A 1 272 GLN 272 441 ? ? ? A . n A 1 273 GLN 273 442 ? ? ? A . n A 1 274 SER 274 443 ? ? ? A . n A 1 275 LEU 275 444 ? ? ? A . n A 1 276 GLN 276 445 ? ? ? A . n A 1 277 ASP 277 446 ? ? ? A . n A 1 278 THR 278 447 ? ? ? A . n A 1 279 ALA 279 448 ? ? ? A . n A 1 280 TRP 280 449 ? ? ? A . n A 1 281 SER 281 450 ? ? ? A . n A 1 282 ASP 282 451 ? ? ? A . n A 1 283 ASN 283 452 ? ? ? A . n A 1 284 MET 284 453 ? ? ? A . n A 1 285 ALA 285 454 ? ? ? A . n A 1 286 CYS 286 455 ? ? ? A . n A 1 287 ALA 287 456 ? ? ? A . n A 1 288 PHE 288 457 ? ? ? A . n A 1 289 GLU 289 458 ? ? ? A . n A 1 290 HIS 290 459 ? ? ? A . n A 1 291 HIS 291 460 ? ? ? A . n A 1 292 HIS 292 461 ? ? ? A . n A 1 293 HIS 293 462 ? ? ? A . n A 1 294 HIS 294 463 ? ? ? A . n A 1 295 HIS 295 464 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GDP 1 501 1 GDP GDP A . C 3 HOH 1 601 1 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8R9R _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.920 _cell.length_a_esd ? _cell.length_b 73.920 _cell.length_b_esd ? _cell.length_c 159.960 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8R9R _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8R9R _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1 M lithium chloride, 0.1 M citric acid, 20% PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 273 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-11-27 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.885600 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.885600 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8R9R _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.42 _reflns.d_resolution_low 40.97 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 100474 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.84 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 35.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.75 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.116 _reflns.pdbx_Rpim_I_all 0.01971 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1142 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.42 _reflns_shell.d_res_low 2.507 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1001 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.258 _reflns_shell.pdbx_Rpim_I_all 0.3613 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.754 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.228 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.66 _refine.aniso_B[1][2] 0.33 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.66 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -2.14 _refine.B_iso_max ? _refine.B_iso_mean 55.000 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8R9R _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.42 _refine.ls_d_res_low 40.97 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9955 _refine.ls_number_reflns_R_free 524 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.81 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20844 _refine.ls_R_factor_R_free 0.25034 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20620 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.492 _refine.pdbx_overall_ESU_R_Free 0.274 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 18.967 _refine.overall_SU_ML 0.211 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.42 _refine_hist.d_res_low 40.97 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 1965 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1936 _refine_hist.pdbx_number_atoms_nucleic_acid 28 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _struct.entry_id 8R9R _struct.title 'GDP-bound state of S. putrefaciens FlhF' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8R9R _struct_keywords.text 'Flagellum, Assembly, motility, GTP-binding, GTPase, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4Y8J9_SHEPC _struct_ref.pdbx_db_accession A4Y8J9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSLMTEHKKRIDPVGAMLESKLLEAEFSPAVAAKLAALSQHYTPAELVRALPQSLANMLDNQGDDIVRQGGVVALVGPTG VGKTTSLAKLAARFAAHHGPEQVALITTDHYRIGAYEQLATYGKIMGCPVKQAHDLNELEQILYQFRNRKLVLIDTAGMG QRDMRLYQQLDNLTANSRIPIRSYLVLSATGQRRVLQDAVNHFKRIPLSGAVLTKLDESVSLAGALSVLIQSGLPLSYVT DGQRVPEDMKVADTLMLAQQALATLDSTEQQSLQDTAWSDNMACAFE ; _struct_ref.pdbx_align_begin 174 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8R9R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 289 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A4Y8J9 _struct_ref_seq.db_align_beg 174 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 460 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 172 _struct_ref_seq.pdbx_auth_seq_align_end 458 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8R9R MET A 1 ? UNP A4Y8J9 ? ? 'initiating methionine' 170 1 1 8R9R GLY A 2 ? UNP A4Y8J9 ? ? 'expression tag' 171 2 1 8R9R HIS A 290 ? UNP A4Y8J9 ? ? 'expression tag' 459 3 1 8R9R HIS A 291 ? UNP A4Y8J9 ? ? 'expression tag' 460 4 1 8R9R HIS A 292 ? UNP A4Y8J9 ? ? 'expression tag' 461 5 1 8R9R HIS A 293 ? UNP A4Y8J9 ? ? 'expression tag' 462 6 1 8R9R HIS A 294 ? UNP A4Y8J9 ? ? 'expression tag' 463 7 1 8R9R HIS A 295 ? UNP A4Y8J9 ? ? 'expression tag' 464 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 1 2 A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 14 ? ALA A 27 ? ASP A 183 ALA A 196 1 ? 14 HELX_P HELX_P2 AA2 SER A 30 ? ALA A 39 ? SER A 199 ALA A 208 1 ? 10 HELX_P HELX_P3 AA3 LEU A 40 ? HIS A 43 ? LEU A 209 HIS A 212 5 ? 4 HELX_P HELX_P4 AA4 THR A 45 ? ASP A 62 ? THR A 214 ASP A 231 1 ? 18 HELX_P HELX_P5 AA5 ASP A 66 ? GLY A 72 ? ASP A 235 GLY A 241 1 ? 7 HELX_P HELX_P6 AA6 GLY A 84 ? HIS A 99 ? GLY A 253 HIS A 268 1 ? 16 HELX_P HELX_P7 AA7 GLY A 101 ? GLU A 103 ? GLY A 270 GLU A 272 5 ? 3 HELX_P HELX_P8 AA8 GLY A 116 ? GLY A 129 ? GLY A 285 GLY A 298 1 ? 14 HELX_P HELX_P9 AA9 ASP A 137 ? PHE A 148 ? ASP A 306 PHE A 317 1 ? 12 HELX_P HELX_P10 AB1 ARG A 167 ? ASN A 174 ? ARG A 336 ASN A 343 1 ? 8 HELX_P HELX_P11 AB2 LEU A 175 ? ALA A 177 ? LEU A 344 ALA A 346 5 ? 3 HELX_P HELX_P12 AB3 GLN A 194 ? LYS A 206 ? GLN A 363 LYS A 375 1 ? 13 HELX_P HELX_P13 AB4 LYS A 217 ? SER A 221 ? LYS A 386 SER A 390 5 ? 5 HELX_P HELX_P14 AB5 LEU A 224 ? SER A 234 ? LEU A 393 SER A 403 1 ? 11 HELX_P HELX_P15 AB6 ASP A 255 ? ALA A 265 ? ASP A 424 ALA A 434 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 247 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 416 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 248 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 417 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.78 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 132 ? GLN A 134 ? VAL A 301 GLN A 303 AA1 2 VAL A 105 ? THR A 109 ? VAL A 274 THR A 278 AA1 3 LEU A 153 ? ASP A 157 ? LEU A 322 ASP A 326 AA1 4 GLY A 73 ? VAL A 78 ? GLY A 242 VAL A 247 AA1 5 ILE A 183 ? SER A 190 ? ILE A 352 SER A 359 AA1 6 GLY A 212 ? THR A 216 ? GLY A 381 THR A 385 AA1 7 LEU A 238 ? THR A 242 ? LEU A 407 THR A 411 AA1 8 MET A 251 ? VAL A 253 ? MET A 420 VAL A 422 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 133 ? O LYS A 302 N LEU A 107 ? N LEU A 276 AA1 2 3 N ILE A 108 ? N ILE A 277 O ASP A 157 ? O ASP A 326 AA1 3 4 O ILE A 156 ? O ILE A 325 N VAL A 75 ? N VAL A 244 AA1 4 5 N VAL A 78 ? N VAL A 247 O VAL A 188 ? O VAL A 357 AA1 5 6 N LEU A 187 ? N LEU A 356 O VAL A 214 ? O VAL A 383 AA1 6 7 N LEU A 215 ? N LEU A 384 O TYR A 240 ? O TYR A 409 AA1 7 8 N VAL A 241 ? N VAL A 410 O LYS A 252 ? O LYS A 421 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 285 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 289 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 269 ? ? 55.71 -112.31 2 1 GLU A 272 ? ? -58.25 -7.40 3 1 TYR A 282 ? ? -99.33 -60.77 4 1 ILE A 284 ? ? -55.50 99.45 5 1 ASN A 347 ? ? 61.23 106.13 6 1 LYS A 375 ? ? -67.50 5.46 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 239 ? ? 0.078 'SIDE CHAIN' 2 1 ARG A 264 ? ? 0.091 'SIDE CHAIN' 3 1 ARG A 283 ? ? 0.079 'SIDE CHAIN' 4 1 ARG A 320 ? ? 0.123 'SIDE CHAIN' # _pdbx_entry_details.entry_id 8R9R _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 170 ? A MET 1 2 1 Y 1 A GLY 171 ? A GLY 2 3 1 Y 1 A SER 172 ? A SER 3 4 1 Y 1 A SER 173 ? A SER 4 5 1 Y 1 A LEU 174 ? A LEU 5 6 1 Y 1 A MET 175 ? A MET 6 7 1 Y 1 A THR 176 ? A THR 7 8 1 Y 1 A GLU 177 ? A GLU 8 9 1 Y 1 A HIS 178 ? A HIS 9 10 1 Y 1 A LYS 179 ? A LYS 10 11 1 Y 1 A LYS 180 ? A LYS 11 12 1 Y 1 A ARG 181 ? A ARG 12 13 1 Y 1 A ILE 182 ? A ILE 13 14 1 Y 1 A SER 438 ? A SER 269 15 1 Y 1 A THR 439 ? A THR 270 16 1 Y 1 A GLU 440 ? A GLU 271 17 1 Y 1 A GLN 441 ? A GLN 272 18 1 Y 1 A GLN 442 ? A GLN 273 19 1 Y 1 A SER 443 ? A SER 274 20 1 Y 1 A LEU 444 ? A LEU 275 21 1 Y 1 A GLN 445 ? A GLN 276 22 1 Y 1 A ASP 446 ? A ASP 277 23 1 Y 1 A THR 447 ? A THR 278 24 1 Y 1 A ALA 448 ? A ALA 279 25 1 Y 1 A TRP 449 ? A TRP 280 26 1 Y 1 A SER 450 ? A SER 281 27 1 Y 1 A ASP 451 ? A ASP 282 28 1 Y 1 A ASN 452 ? A ASN 283 29 1 Y 1 A MET 453 ? A MET 284 30 1 Y 1 A ALA 454 ? A ALA 285 31 1 Y 1 A CYS 455 ? A CYS 286 32 1 Y 1 A ALA 456 ? A ALA 287 33 1 Y 1 A PHE 457 ? A PHE 288 34 1 Y 1 A GLU 458 ? A GLU 289 35 1 Y 1 A HIS 459 ? A HIS 290 36 1 Y 1 A HIS 460 ? A HIS 291 37 1 Y 1 A HIS 461 ? A HIS 292 38 1 Y 1 A HIS 462 ? A HIS 293 39 1 Y 1 A HIS 463 ? A HIS 294 40 1 Y 1 A HIS 464 ? A HIS 295 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TRP N CA sing N N 351 TRP N H sing N N 352 TRP N H2 sing N N 353 TRP CA C sing N N 354 TRP CA CB sing N N 355 TRP CA HA sing N N 356 TRP C O doub N N 357 TRP C OXT sing N N 358 TRP CB CG sing N N 359 TRP CB HB2 sing N N 360 TRP CB HB3 sing N N 361 TRP CG CD1 doub Y N 362 TRP CG CD2 sing Y N 363 TRP CD1 NE1 sing Y N 364 TRP CD1 HD1 sing N N 365 TRP CD2 CE2 doub Y N 366 TRP CD2 CE3 sing Y N 367 TRP NE1 CE2 sing Y N 368 TRP NE1 HE1 sing N N 369 TRP CE2 CZ2 sing Y N 370 TRP CE3 CZ3 doub Y N 371 TRP CE3 HE3 sing N N 372 TRP CZ2 CH2 doub Y N 373 TRP CZ2 HZ2 sing N N 374 TRP CZ3 CH2 sing Y N 375 TRP CZ3 HZ3 sing N N 376 TRP CH2 HH2 sing N N 377 TRP OXT HXT sing N N 378 TYR N CA sing N N 379 TYR N H sing N N 380 TYR N H2 sing N N 381 TYR CA C sing N N 382 TYR CA CB sing N N 383 TYR CA HA sing N N 384 TYR C O doub N N 385 TYR C OXT sing N N 386 TYR CB CG sing N N 387 TYR CB HB2 sing N N 388 TYR CB HB3 sing N N 389 TYR CG CD1 doub Y N 390 TYR CG CD2 sing Y N 391 TYR CD1 CE1 sing Y N 392 TYR CD1 HD1 sing N N 393 TYR CD2 CE2 doub Y N 394 TYR CD2 HD2 sing N N 395 TYR CE1 CZ doub Y N 396 TYR CE1 HE1 sing N N 397 TYR CE2 CZ sing Y N 398 TYR CE2 HE2 sing N N 399 TYR CZ OH sing N N 400 TYR OH HH sing N N 401 TYR OXT HXT sing N N 402 VAL N CA sing N N 403 VAL N H sing N N 404 VAL N H2 sing N N 405 VAL CA C sing N N 406 VAL CA CB sing N N 407 VAL CA HA sing N N 408 VAL C O doub N N 409 VAL C OXT sing N N 410 VAL CB CG1 sing N N 411 VAL CB CG2 sing N N 412 VAL CB HB sing N N 413 VAL CG1 HG11 sing N N 414 VAL CG1 HG12 sing N N 415 VAL CG1 HG13 sing N N 416 VAL CG2 HG21 sing N N 417 VAL CG2 HG22 sing N N 418 VAL CG2 HG23 sing N N 419 VAL OXT HXT sing N N 420 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 495924434 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GDP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GDP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2PX3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8R9R _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013528 _atom_sites.fract_transf_matrix[1][2] 0.007810 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015621 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006252 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O P S # loop_