data_8RHR # _entry.id 8RHR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RHR pdb_00008rhr 10.2210/pdb8rhr/pdb WWPDB D_1292135393 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-04-17 2 'Structure model' 1 1 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8RHR _pdbx_database_status.recvd_initial_deposition_date 2023-12-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 eckhard.hofmann@rub.de Eckhard Hofmann ? 'principal investigator/group leader' 0000-0003-4874-372X 3 raphael.stoll@rub.de Raphael Stoll ? 'principal investigator/group leader' 0000-0003-2890-8419 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kirschner, H.' 1 0000-0002-8314-1620 'Stoll, R.' 2 ? 'Hofmann, E.' 3 0000-0003-4874-372X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 6384 _citation.page_last 6396 _citation.title 'Toward More Selective Antibiotic Inhibitors: A Structural View of the Complexed Binding Pocket of E. coli Peptide Deformylase.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.3c02382 _citation.pdbx_database_id_PubMed 38574272 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kirschner, H.' 1 ? primary 'Heister, N.' 2 ? primary 'Zouatom, M.' 3 ? primary 'Zhou, T.' 4 ? primary 'Hofmann, E.' 5 ? primary 'Scherkenbeck, J.' 6 ? primary 'Stoll, R.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptide deformylase' 19552.645 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn '2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide' 269.095 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 2 ? ? ? ? 6 water nat water 18.015 131 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPEL LEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQK VEKLDRLKARA ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPEL LEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQK VEKLDRLKARA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide' BB4 4 GLYCEROL GOL 5 'DIMETHYL SULFOXIDE' DMS 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 SER n 1 5 VAL n 1 6 LEU n 1 7 GLN n 1 8 VAL n 1 9 LEU n 1 10 HIS n 1 11 ILE n 1 12 PRO n 1 13 ASP n 1 14 GLU n 1 15 ARG n 1 16 LEU n 1 17 ARG n 1 18 LYS n 1 19 VAL n 1 20 ALA n 1 21 LYS n 1 22 PRO n 1 23 VAL n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 ASN n 1 28 ALA n 1 29 GLU n 1 30 ILE n 1 31 GLN n 1 32 ARG n 1 33 ILE n 1 34 VAL n 1 35 ASP n 1 36 ASP n 1 37 MET n 1 38 PHE n 1 39 GLU n 1 40 THR n 1 41 MET n 1 42 TYR n 1 43 ALA n 1 44 GLU n 1 45 GLU n 1 46 GLY n 1 47 ILE n 1 48 GLY n 1 49 LEU n 1 50 ALA n 1 51 ALA n 1 52 THR n 1 53 GLN n 1 54 VAL n 1 55 ASP n 1 56 ILE n 1 57 HIS n 1 58 GLN n 1 59 ARG n 1 60 ILE n 1 61 ILE n 1 62 VAL n 1 63 ILE n 1 64 ASP n 1 65 VAL n 1 66 SER n 1 67 GLU n 1 68 ASN n 1 69 ARG n 1 70 ASP n 1 71 GLU n 1 72 ARG n 1 73 LEU n 1 74 VAL n 1 75 LEU n 1 76 ILE n 1 77 ASN n 1 78 PRO n 1 79 GLU n 1 80 LEU n 1 81 LEU n 1 82 GLU n 1 83 LYS n 1 84 SER n 1 85 GLY n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 ILE n 1 90 GLU n 1 91 GLU n 1 92 GLY n 1 93 CYS n 1 94 LEU n 1 95 SER n 1 96 ILE n 1 97 PRO n 1 98 GLU n 1 99 GLN n 1 100 ARG n 1 101 ALA n 1 102 LEU n 1 103 VAL n 1 104 PRO n 1 105 ARG n 1 106 ALA n 1 107 GLU n 1 108 LYS n 1 109 VAL n 1 110 LYS n 1 111 ILE n 1 112 ARG n 1 113 ALA n 1 114 LEU n 1 115 ASP n 1 116 ARG n 1 117 ASP n 1 118 GLY n 1 119 LYS n 1 120 PRO n 1 121 PHE n 1 122 GLU n 1 123 LEU n 1 124 GLU n 1 125 ALA n 1 126 ASP n 1 127 GLY n 1 128 LEU n 1 129 LEU n 1 130 ALA n 1 131 ILE n 1 132 CYS n 1 133 ILE n 1 134 GLN n 1 135 HIS n 1 136 GLU n 1 137 MET n 1 138 ASP n 1 139 HIS n 1 140 LEU n 1 141 VAL n 1 142 GLY n 1 143 LYS n 1 144 LEU n 1 145 PHE n 1 146 MET n 1 147 ASP n 1 148 TYR n 1 149 LEU n 1 150 SER n 1 151 PRO n 1 152 LEU n 1 153 LYS n 1 154 GLN n 1 155 GLN n 1 156 ARG n 1 157 ILE n 1 158 ARG n 1 159 GLN n 1 160 LYS n 1 161 VAL n 1 162 GLU n 1 163 LYS n 1 164 LEU n 1 165 ASP n 1 166 ARG n 1 167 LEU n 1 168 LYS n 1 169 ALA n 1 170 ARG n 1 171 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 171 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene def _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details 'pET19 with additional TEV protease cutting site' _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET19mod _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BB4 non-polymer . '2-(5-bromo-1H-indol-3-yl)-N-hydroxyacetamide' ? 'C10 H9 Br N2 O2' 269.095 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 HIS 2 -1 -1 HIS HIS A . n A 1 3 MET 3 0 0 MET MET A . n A 1 4 SER 4 1 1 SER SER A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 LEU 6 3 3 LEU LEU A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 LEU 9 6 6 LEU LEU A . n A 1 10 HIS 10 7 7 HIS HIS A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 PRO 12 9 9 PRO PRO A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 ARG 15 12 12 ARG ARG A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 ARG 17 14 14 ARG ARG A . n A 1 18 LYS 18 15 15 LYS LYS A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 PRO 22 19 19 PRO PRO A . n A 1 23 VAL 23 20 20 VAL VAL A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 VAL 26 23 23 VAL VAL A . n A 1 27 ASN 27 24 24 ASN ASN A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 GLN 31 28 28 GLN GLN A . n A 1 32 ARG 32 29 29 ARG ARG A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 ASP 35 32 32 ASP ASP A . n A 1 36 ASP 36 33 33 ASP ASP A . n A 1 37 MET 37 34 34 MET MET A . n A 1 38 PHE 38 35 35 PHE PHE A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 MET 41 38 38 MET MET A . n A 1 42 TYR 42 39 39 TYR TYR A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 GLU 44 41 41 GLU GLU A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 GLY 48 45 45 GLY GLY A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 ALA 51 48 48 ALA ALA A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 GLN 53 50 50 GLN GLN A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 HIS 57 54 54 HIS HIS A . n A 1 58 GLN 58 55 55 GLN GLN A . n A 1 59 ARG 59 56 56 ARG ARG A . n A 1 60 ILE 60 57 57 ILE ILE A . n A 1 61 ILE 61 58 58 ILE ILE A . n A 1 62 VAL 62 59 59 VAL VAL A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 VAL 65 62 62 VAL VAL A . n A 1 66 SER 66 63 63 SER SER A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 ASN 68 65 65 ASN ASN A . n A 1 69 ARG 69 66 66 ARG ARG A . n A 1 70 ASP 70 67 67 ASP ASP A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 ARG 72 69 69 ARG ARG A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 VAL 74 71 71 VAL VAL A . n A 1 75 LEU 75 72 72 LEU LEU A . n A 1 76 ILE 76 73 73 ILE ILE A . n A 1 77 ASN 77 74 74 ASN ASN A . n A 1 78 PRO 78 75 75 PRO PRO A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 LEU 80 77 77 LEU LEU A . n A 1 81 LEU 81 78 78 LEU LEU A . n A 1 82 GLU 82 79 79 GLU GLU A . n A 1 83 LYS 83 80 80 LYS LYS A . n A 1 84 SER 84 81 81 SER SER A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 THR 87 84 84 THR THR A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 ILE 89 86 86 ILE ILE A . n A 1 90 GLU 90 87 87 GLU GLU A . n A 1 91 GLU 91 88 88 GLU GLU A . n A 1 92 GLY 92 89 89 GLY GLY A . n A 1 93 CYS 93 90 90 CYS CYS A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 SER 95 92 92 SER SER A . n A 1 96 ILE 96 93 93 ILE ILE A . n A 1 97 PRO 97 94 94 PRO PRO A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 GLN 99 96 96 GLN GLN A . n A 1 100 ARG 100 97 97 ARG ARG A . n A 1 101 ALA 101 98 98 ALA ALA A . n A 1 102 LEU 102 99 99 LEU LEU A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 PRO 104 101 101 PRO PRO A . n A 1 105 ARG 105 102 102 ARG ARG A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 LYS 108 105 105 LYS LYS A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 LYS 110 107 107 LYS LYS A . n A 1 111 ILE 111 108 108 ILE ILE A . n A 1 112 ARG 112 109 109 ARG ARG A . n A 1 113 ALA 113 110 110 ALA ALA A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 ASP 115 112 112 ASP ASP A . n A 1 116 ARG 116 113 113 ARG ARG A . n A 1 117 ASP 117 114 114 ASP ASP A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 LYS 119 116 116 LYS LYS A . n A 1 120 PRO 120 117 117 PRO PRO A . n A 1 121 PHE 121 118 118 PHE PHE A . n A 1 122 GLU 122 119 119 GLU GLU A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 GLU 124 121 121 GLU GLU A . n A 1 125 ALA 125 122 122 ALA ALA A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 GLY 127 124 124 GLY GLY A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 ALA 130 127 127 ALA ALA A . n A 1 131 ILE 131 128 128 ILE ILE A . n A 1 132 CYS 132 129 129 CYS CYS A . n A 1 133 ILE 133 130 130 ILE ILE A . n A 1 134 GLN 134 131 131 GLN GLN A . n A 1 135 HIS 135 132 132 HIS HIS A . n A 1 136 GLU 136 133 133 GLU GLU A . n A 1 137 MET 137 134 134 MET MET A . n A 1 138 ASP 138 135 135 ASP ASP A . n A 1 139 HIS 139 136 136 HIS HIS A . n A 1 140 LEU 140 137 137 LEU LEU A . n A 1 141 VAL 141 138 138 VAL VAL A . n A 1 142 GLY 142 139 139 GLY GLY A . n A 1 143 LYS 143 140 140 LYS LYS A . n A 1 144 LEU 144 141 141 LEU LEU A . n A 1 145 PHE 145 142 142 PHE PHE A . n A 1 146 MET 146 143 143 MET MET A . n A 1 147 ASP 147 144 144 ASP ASP A . n A 1 148 TYR 148 145 145 TYR TYR A . n A 1 149 LEU 149 146 146 LEU LEU A . n A 1 150 SER 150 147 147 SER SER A . n A 1 151 PRO 151 148 148 PRO PRO A . n A 1 152 LEU 152 149 149 LEU LEU A . n A 1 153 LYS 153 150 150 LYS LYS A . n A 1 154 GLN 154 151 151 GLN GLN A . n A 1 155 GLN 155 152 152 GLN GLN A . n A 1 156 ARG 156 153 153 ARG ARG A . n A 1 157 ILE 157 154 154 ILE ILE A . n A 1 158 ARG 158 155 155 ARG ARG A . n A 1 159 GLN 159 156 156 GLN GLN A . n A 1 160 LYS 160 157 157 LYS LYS A . n A 1 161 VAL 161 158 158 VAL VAL A . n A 1 162 GLU 162 159 159 GLU GLU A . n A 1 163 LYS 163 160 160 LYS LYS A . n A 1 164 LEU 164 161 161 LEU LEU A . n A 1 165 ASP 165 162 162 ASP ASP A . n A 1 166 ARG 166 163 163 ARG ARG A . n A 1 167 LEU 167 164 164 LEU LEU A . n A 1 168 LYS 168 165 165 LYS LYS A . n A 1 169 ALA 169 166 166 ALA ALA A . n A 1 170 ARG 170 167 ? ? ? A . n A 1 171 ALA 171 168 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 200 ZN ZN A . C 3 BB4 1 202 201 BB4 BB4 A . D 4 GOL 1 203 435 GOL GOL A . E 5 DMS 1 204 436 DMS DMS A . F 5 DMS 1 205 437 DMS DMS A . G 6 HOH 1 301 340 HOH HOH A . G 6 HOH 2 302 311 HOH HOH A . G 6 HOH 3 303 376 HOH HOH A . G 6 HOH 4 304 367 HOH HOH A . G 6 HOH 5 305 415 HOH HOH A . G 6 HOH 6 306 363 HOH HOH A . G 6 HOH 7 307 405 HOH HOH A . G 6 HOH 8 308 355 HOH HOH A . G 6 HOH 9 309 382 HOH HOH A . G 6 HOH 10 310 381 HOH HOH A . G 6 HOH 11 311 384 HOH HOH A . G 6 HOH 12 312 378 HOH HOH A . G 6 HOH 13 313 408 HOH HOH A . G 6 HOH 14 314 331 HOH HOH A . G 6 HOH 15 315 348 HOH HOH A . G 6 HOH 16 316 321 HOH HOH A . G 6 HOH 17 317 428 HOH HOH A . G 6 HOH 18 318 358 HOH HOH A . G 6 HOH 19 319 318 HOH HOH A . G 6 HOH 20 320 430 HOH HOH A . G 6 HOH 21 321 315 HOH HOH A . G 6 HOH 22 322 374 HOH HOH A . G 6 HOH 23 323 309 HOH HOH A . G 6 HOH 24 324 302 HOH HOH A . G 6 HOH 25 325 328 HOH HOH A . G 6 HOH 26 326 319 HOH HOH A . G 6 HOH 27 327 364 HOH HOH A . G 6 HOH 28 328 344 HOH HOH A . G 6 HOH 29 329 332 HOH HOH A . G 6 HOH 30 330 341 HOH HOH A . G 6 HOH 31 331 361 HOH HOH A . G 6 HOH 32 332 346 HOH HOH A . G 6 HOH 33 333 306 HOH HOH A . G 6 HOH 34 334 326 HOH HOH A . G 6 HOH 35 335 379 HOH HOH A . G 6 HOH 36 336 347 HOH HOH A . G 6 HOH 37 337 312 HOH HOH A . G 6 HOH 38 338 308 HOH HOH A . G 6 HOH 39 339 373 HOH HOH A . G 6 HOH 40 340 391 HOH HOH A . G 6 HOH 41 341 301 HOH HOH A . G 6 HOH 42 342 324 HOH HOH A . G 6 HOH 43 343 411 HOH HOH A . G 6 HOH 44 344 336 HOH HOH A . G 6 HOH 45 345 342 HOH HOH A . G 6 HOH 46 346 350 HOH HOH A . G 6 HOH 47 347 413 HOH HOH A . G 6 HOH 48 348 310 HOH HOH A . G 6 HOH 49 349 329 HOH HOH A . G 6 HOH 50 350 334 HOH HOH A . G 6 HOH 51 351 304 HOH HOH A . G 6 HOH 52 352 409 HOH HOH A . G 6 HOH 53 353 357 HOH HOH A . G 6 HOH 54 354 313 HOH HOH A . G 6 HOH 55 355 402 HOH HOH A . G 6 HOH 56 356 369 HOH HOH A . G 6 HOH 57 357 380 HOH HOH A . G 6 HOH 58 358 305 HOH HOH A . G 6 HOH 59 359 390 HOH HOH A . G 6 HOH 60 360 325 HOH HOH A . G 6 HOH 61 361 386 HOH HOH A . G 6 HOH 62 362 401 HOH HOH A . G 6 HOH 63 363 365 HOH HOH A . G 6 HOH 64 364 338 HOH HOH A . G 6 HOH 65 365 303 HOH HOH A . G 6 HOH 66 366 356 HOH HOH A . G 6 HOH 67 367 351 HOH HOH A . G 6 HOH 68 368 352 HOH HOH A . G 6 HOH 69 369 327 HOH HOH A . G 6 HOH 70 370 400 HOH HOH A . G 6 HOH 71 371 333 HOH HOH A . G 6 HOH 72 372 330 HOH HOH A . G 6 HOH 73 373 320 HOH HOH A . G 6 HOH 74 374 416 HOH HOH A . G 6 HOH 75 375 317 HOH HOH A . G 6 HOH 76 376 360 HOH HOH A . G 6 HOH 77 377 307 HOH HOH A . G 6 HOH 78 378 339 HOH HOH A . G 6 HOH 79 379 398 HOH HOH A . G 6 HOH 80 380 432 HOH HOH A . G 6 HOH 81 381 322 HOH HOH A . G 6 HOH 82 382 323 HOH HOH A . G 6 HOH 83 383 394 HOH HOH A . G 6 HOH 84 384 383 HOH HOH A . G 6 HOH 85 385 417 HOH HOH A . G 6 HOH 86 386 371 HOH HOH A . G 6 HOH 87 387 335 HOH HOH A . G 6 HOH 88 388 316 HOH HOH A . G 6 HOH 89 389 389 HOH HOH A . G 6 HOH 90 390 419 HOH HOH A . G 6 HOH 91 391 385 HOH HOH A . G 6 HOH 92 392 354 HOH HOH A . G 6 HOH 93 393 337 HOH HOH A . G 6 HOH 94 394 388 HOH HOH A . G 6 HOH 95 395 393 HOH HOH A . G 6 HOH 96 396 431 HOH HOH A . G 6 HOH 97 397 418 HOH HOH A . G 6 HOH 98 398 343 HOH HOH A . G 6 HOH 99 399 429 HOH HOH A . G 6 HOH 100 400 404 HOH HOH A . G 6 HOH 101 401 395 HOH HOH A . G 6 HOH 102 402 433 HOH HOH A . G 6 HOH 103 403 412 HOH HOH A . G 6 HOH 104 404 403 HOH HOH A . G 6 HOH 105 405 349 HOH HOH A . G 6 HOH 106 406 407 HOH HOH A . G 6 HOH 107 407 427 HOH HOH A . G 6 HOH 108 408 406 HOH HOH A . G 6 HOH 109 409 362 HOH HOH A . G 6 HOH 110 410 426 HOH HOH A . G 6 HOH 111 411 387 HOH HOH A . G 6 HOH 112 412 424 HOH HOH A . G 6 HOH 113 413 314 HOH HOH A . G 6 HOH 114 414 425 HOH HOH A . G 6 HOH 115 415 421 HOH HOH A . G 6 HOH 116 416 396 HOH HOH A . G 6 HOH 117 417 423 HOH HOH A . G 6 HOH 118 418 370 HOH HOH A . G 6 HOH 119 419 372 HOH HOH A . G 6 HOH 120 420 397 HOH HOH A . G 6 HOH 121 421 377 HOH HOH A . G 6 HOH 122 422 392 HOH HOH A . G 6 HOH 123 423 353 HOH HOH A . G 6 HOH 124 424 359 HOH HOH A . G 6 HOH 125 425 366 HOH HOH A . G 6 HOH 126 426 422 HOH HOH A . G 6 HOH 127 427 375 HOH HOH A . G 6 HOH 128 428 434 HOH HOH A . G 6 HOH 129 429 410 HOH HOH A . G 6 HOH 130 430 345 HOH HOH A . G 6 HOH 131 431 414 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8RHR _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.850 _cell.length_a_esd ? _cell.length_b 54.850 _cell.length_b_esd ? _cell.length_c 228.580 _cell.length_c_esd ? _cell.volume 595555.341 _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8RHR _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall 'P 61 2 (x,y,z+5/12)' _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RHR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1 ul of protein solution (10 ug/ul) was mixed with 1 ul reservoir solution (0.17 M ammonium sulfate, 25.5% (w/v) PEG4000, 15% (v/v) glycerol); soaking was performed for appr. 22 hours at 291.2K with 1 ul of stock solution (30 mM) added to the sitting drop well ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.2 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 1022-08-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91977 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.91977 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 23.89 _reflns.entry_id 8RHR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.42 _reflns.d_resolution_low 46.51 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 72634 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 36.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.84 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.066 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.065 _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.42 _reflns_shell.d_res_low 1.46 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5371 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 3.26 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.452 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 3.19 _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 34.58 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8RHR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.42 _refine.ls_d_res_low 46.51 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 72616 _refine.ls_number_reflns_R_free 3633 _refine.ls_number_reflns_R_work 68983 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1639 _refine.ls_R_factor_R_free 0.1865 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1627 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.4611 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.42 _refine_hist.d_res_low 46.51 _refine_hist.number_atoms_solvent 131 _refine_hist.number_atoms_total 1508 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1347 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0136 ? 1437 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2736 ? 1938 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0941 ? 218 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0162 ? 256 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 6.9289 ? 197 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.42 1.44 . . 144 2690 99.86 . . . . 0.3183 . . . . . . . . . . . 0.3497 'X-RAY DIFFRACTION' 1.44 1.46 . . 133 2584 100.00 . . . . 0.2849 . . . . . . . . . . . 0.3278 'X-RAY DIFFRACTION' 1.46 1.48 . . 141 2711 99.93 . . . . 0.2441 . . . . . . . . . . . 0.3021 'X-RAY DIFFRACTION' 1.48 1.50 . . 137 2605 99.96 . . . . 0.2310 . . . . . . . . . . . 0.2587 'X-RAY DIFFRACTION' 1.50 1.52 . . 147 2696 99.96 . . . . 0.2076 . . . . . . . . . . . 0.2517 'X-RAY DIFFRACTION' 1.52 1.55 . . 136 2594 99.96 . . . . 0.1871 . . . . . . . . . . . 0.2641 'X-RAY DIFFRACTION' 1.55 1.58 . . 143 2702 100.00 . . . . 0.1815 . . . . . . . . . . . 0.2116 'X-RAY DIFFRACTION' 1.58 1.61 . . 140 2649 100.00 . . . . 0.1728 . . . . . . . . . . . 0.2196 'X-RAY DIFFRACTION' 1.61 1.64 . . 137 2641 99.96 . . . . 0.1666 . . . . . . . . . . . 0.2065 'X-RAY DIFFRACTION' 1.64 1.67 . . 144 2678 99.89 . . . . 0.1490 . . . . . . . . . . . 0.2012 'X-RAY DIFFRACTION' 1.67 1.71 . . 139 2651 100.00 . . . . 0.1447 . . . . . . . . . . . 0.1616 'X-RAY DIFFRACTION' 1.71 1.75 . . 138 2639 100.00 . . . . 0.1467 . . . . . . . . . . . 0.1854 'X-RAY DIFFRACTION' 1.75 1.79 . . 138 2642 100.00 . . . . 0.1335 . . . . . . . . . . . 0.1828 'X-RAY DIFFRACTION' 1.79 1.84 . . 136 2695 100.00 . . . . 0.1346 . . . . . . . . . . . 0.1952 'X-RAY DIFFRACTION' 1.84 1.89 . . 143 2640 99.96 . . . . 0.1280 . . . . . . . . . . . 0.2046 'X-RAY DIFFRACTION' 1.89 1.95 . . 141 2649 99.96 . . . . 0.1368 . . . . . . . . . . . 0.2056 'X-RAY DIFFRACTION' 1.95 2.02 . . 143 2659 100.00 . . . . 0.1419 . . . . . . . . . . . 0.1789 'X-RAY DIFFRACTION' 2.02 2.10 . . 139 2641 100.00 . . . . 0.1423 . . . . . . . . . . . 0.1693 'X-RAY DIFFRACTION' 2.10 2.20 . . 143 2663 99.96 . . . . 0.1284 . . . . . . . . . . . 0.1536 'X-RAY DIFFRACTION' 2.20 2.31 . . 138 2625 99.93 . . . . 0.1300 . . . . . . . . . . . 0.1809 'X-RAY DIFFRACTION' 2.31 2.46 . . 145 2649 99.89 . . . . 0.1460 . . . . . . . . . . . 0.1762 'X-RAY DIFFRACTION' 2.46 2.65 . . 133 2647 100.00 . . . . 0.1639 . . . . . . . . . . . 0.2248 'X-RAY DIFFRACTION' 2.65 2.92 . . 135 2659 99.86 . . . . 0.1668 . . . . . . . . . . . 0.1806 'X-RAY DIFFRACTION' 2.92 3.34 . . 135 2653 99.96 . . . . 0.1660 . . . . . . . . . . . 0.1642 'X-RAY DIFFRACTION' 3.34 4.21 . . 143 2671 100.00 . . . . 0.1632 . . . . . . . . . . . 0.2173 'X-RAY DIFFRACTION' 4.21 46.51 . . 142 2650 99.86 . . . . 0.1850 . . . . . . . . . . . 0.1563 # _struct.entry_id 8RHR _struct.title 'E.coli Peptide Deformylase with bound inhibitor BB4' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RHR _struct_keywords.text 'Peptide Deformylase (EC 3.5.1.88), Inhibitor, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 5 ? G N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3SRA2_ECOLX _struct_ref.pdbx_db_accession C3SRA2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLE KSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVE KLDRLKARA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8RHR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3SRA2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 168 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8RHR GLY A 1 ? UNP C3SRA2 ? ? 'expression tag' -2 1 1 8RHR HIS A 2 ? UNP C3SRA2 ? ? 'expression tag' -1 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 520 ? 1 MORE 3 ? 1 'SSA (A^2)' 9170 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? LYS A 18 ? ASP A 10 LYS A 15 5 ? 6 HELX_P HELX_P2 AA2 ASN A 27 ? GLU A 44 ? ASN A 24 GLU A 41 1 ? 18 HELX_P HELX_P3 AA3 THR A 52 ? ASP A 55 ? THR A 49 ASP A 52 5 ? 4 HELX_P HELX_P4 AA4 GLY A 127 ? VAL A 141 ? GLY A 124 VAL A 138 1 ? 15 HELX_P HELX_P5 AA5 LEU A 144 ? LEU A 149 ? LEU A 141 LEU A 146 5 ? 6 HELX_P HELX_P6 AA6 SER A 150 ? LYS A 168 ? SER A 147 LYS A 165 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 93 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 90 A ZN 201 1_555 ? ? ? ? ? ? ? 2.238 ? ? metalc2 metalc ? ? A HIS 135 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 132 A ZN 201 1_555 ? ? ? ? ? ? ? 2.091 ? ? metalc3 metalc ? ? A HIS 139 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 136 A ZN 201 1_555 ? ? ? ? ? ? ? 2.071 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C BB4 . N1 ? ? A ZN 201 A BB4 202 1_555 ? ? ? ? ? ? ? 2.242 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C BB4 . O14 ? ? A ZN 201 A BB4 202 1_555 ? ? ? ? ? ? ? 1.917 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 118.8 ? 2 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 100.0 ? 3 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 105.2 ? 4 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 N1 ? C BB4 . ? A BB4 202 ? 1_555 126.3 ? 5 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 N1 ? C BB4 . ? A BB4 202 ? 1_555 90.0 ? 6 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 N1 ? C BB4 . ? A BB4 202 ? 1_555 115.8 ? 7 SG ? A CYS 93 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O14 ? C BB4 . ? A BB4 202 ? 1_555 131.2 ? 8 NE2 ? A HIS 135 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O14 ? C BB4 . ? A BB4 202 ? 1_555 108.0 ? 9 NE2 ? A HIS 139 ? A HIS 136 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O14 ? C BB4 . ? A BB4 202 ? 1_555 79.6 ? 10 N1 ? C BB4 . ? A BB4 202 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O14 ? C BB4 . ? A BB4 202 ? 1_555 37.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 11 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 8 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 12 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 9 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 48 ? ALA A 50 ? GLY A 45 ALA A 47 AA1 2 ILE A 60 ? ILE A 63 ? ILE A 57 ILE A 60 AA1 3 LEU A 73 ? SER A 84 ? LEU A 70 SER A 81 AA1 4 LYS A 108 ? LEU A 114 ? LYS A 105 LEU A 111 AA1 5 PRO A 120 ? ASP A 126 ? PRO A 117 ASP A 123 AA2 1 GLU A 90 ? GLU A 91 ? GLU A 87 GLU A 88 AA2 2 ALA A 101 ? LEU A 102 ? ALA A 98 LEU A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 49 ? N LEU A 46 O VAL A 62 ? O VAL A 59 AA1 2 3 N ILE A 63 ? N ILE A 60 O LEU A 73 ? O LEU A 70 AA1 3 4 N ILE A 76 ? N ILE A 73 O LEU A 114 ? O LEU A 111 AA1 4 5 N VAL A 109 ? N VAL A 106 O ALA A 125 ? O ALA A 122 AA2 1 2 N GLU A 91 ? N GLU A 88 O ALA A 101 ? O ALA A 98 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 9 ? ? -97.63 36.49 2 1 HIS A 54 ? ? -99.58 59.19 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 153 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id A _pdbx_validate_planes.rmsd 0.096 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 428 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 x-y,-y,-z 7 -x,-x+y,-z+2/3 8 -x,-y,z+1/2 9 y,x,-z+1/3 10 -y,-x,-z+5/6 11 -x+y,y,-z+1/2 12 x,x-y,-z+1/6 # _pdbx_entry_details.entry_id 8RHR _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 431 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.22 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A ARG 167 ? A ARG 170 3 1 Y 1 A ALA 168 ? A ALA 171 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BB4 BR BR N N 74 BB4 N1 N N N 75 BB4 O2 O N N 76 BB4 N3 N Y N 77 BB4 C4 C Y N 78 BB4 C5 C Y N 79 BB4 C6 C Y N 80 BB4 C7 C Y N 81 BB4 C8 C Y N 82 BB4 C9 C Y N 83 BB4 C10 C Y N 84 BB4 C11 C Y N 85 BB4 C12 C N N 86 BB4 C13 C N N 87 BB4 O14 O N N 88 BB4 HN1 H N N 89 BB4 HN3 H N N 90 BB4 H4 H N N 91 BB4 H7 H N N 92 BB4 H9 H N N 93 BB4 H10 H N N 94 BB4 H12 H N N 95 BB4 H12A H N N 96 BB4 HO14 H N N 97 CYS N N N N 98 CYS CA C N R 99 CYS C C N N 100 CYS O O N N 101 CYS CB C N N 102 CYS SG S N N 103 CYS OXT O N N 104 CYS H H N N 105 CYS H2 H N N 106 CYS HA H N N 107 CYS HB2 H N N 108 CYS HB3 H N N 109 CYS HG H N N 110 CYS HXT H N N 111 DMS S S N N 112 DMS O O N N 113 DMS C1 C N N 114 DMS C2 C N N 115 DMS H11 H N N 116 DMS H12 H N N 117 DMS H13 H N N 118 DMS H21 H N N 119 DMS H22 H N N 120 DMS H23 H N N 121 GLN N N N N 122 GLN CA C N S 123 GLN C C N N 124 GLN O O N N 125 GLN CB C N N 126 GLN CG C N N 127 GLN CD C N N 128 GLN OE1 O N N 129 GLN NE2 N N N 130 GLN OXT O N N 131 GLN H H N N 132 GLN H2 H N N 133 GLN HA H N N 134 GLN HB2 H N N 135 GLN HB3 H N N 136 GLN HG2 H N N 137 GLN HG3 H N N 138 GLN HE21 H N N 139 GLN HE22 H N N 140 GLN HXT H N N 141 GLU N N N N 142 GLU CA C N S 143 GLU C C N N 144 GLU O O N N 145 GLU CB C N N 146 GLU CG C N N 147 GLU CD C N N 148 GLU OE1 O N N 149 GLU OE2 O N N 150 GLU OXT O N N 151 GLU H H N N 152 GLU H2 H N N 153 GLU HA H N N 154 GLU HB2 H N N 155 GLU HB3 H N N 156 GLU HG2 H N N 157 GLU HG3 H N N 158 GLU HE2 H N N 159 GLU HXT H N N 160 GLY N N N N 161 GLY CA C N N 162 GLY C C N N 163 GLY O O N N 164 GLY OXT O N N 165 GLY H H N N 166 GLY H2 H N N 167 GLY HA2 H N N 168 GLY HA3 H N N 169 GLY HXT H N N 170 GOL C1 C N N 171 GOL O1 O N N 172 GOL C2 C N N 173 GOL O2 O N N 174 GOL C3 C N N 175 GOL O3 O N N 176 GOL H11 H N N 177 GOL H12 H N N 178 GOL HO1 H N N 179 GOL H2 H N N 180 GOL HO2 H N N 181 GOL H31 H N N 182 GOL H32 H N N 183 GOL HO3 H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 PHE N N N N 298 PHE CA C N S 299 PHE C C N N 300 PHE O O N N 301 PHE CB C N N 302 PHE CG C Y N 303 PHE CD1 C Y N 304 PHE CD2 C Y N 305 PHE CE1 C Y N 306 PHE CE2 C Y N 307 PHE CZ C Y N 308 PHE OXT O N N 309 PHE H H N N 310 PHE H2 H N N 311 PHE HA H N N 312 PHE HB2 H N N 313 PHE HB3 H N N 314 PHE HD1 H N N 315 PHE HD2 H N N 316 PHE HE1 H N N 317 PHE HE2 H N N 318 PHE HZ H N N 319 PHE HXT H N N 320 PRO N N N N 321 PRO CA C N S 322 PRO C C N N 323 PRO O O N N 324 PRO CB C N N 325 PRO CG C N N 326 PRO CD C N N 327 PRO OXT O N N 328 PRO H H N N 329 PRO HA H N N 330 PRO HB2 H N N 331 PRO HB3 H N N 332 PRO HG2 H N N 333 PRO HG3 H N N 334 PRO HD2 H N N 335 PRO HD3 H N N 336 PRO HXT H N N 337 SER N N N N 338 SER CA C N S 339 SER C C N N 340 SER O O N N 341 SER CB C N N 342 SER OG O N N 343 SER OXT O N N 344 SER H H N N 345 SER H2 H N N 346 SER HA H N N 347 SER HB2 H N N 348 SER HB3 H N N 349 SER HG H N N 350 SER HXT H N N 351 THR N N N N 352 THR CA C N S 353 THR C C N N 354 THR O O N N 355 THR CB C N R 356 THR OG1 O N N 357 THR CG2 C N N 358 THR OXT O N N 359 THR H H N N 360 THR H2 H N N 361 THR HA H N N 362 THR HB H N N 363 THR HG1 H N N 364 THR HG21 H N N 365 THR HG22 H N N 366 THR HG23 H N N 367 THR HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 ZN ZN ZN N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BB4 BR C8 sing N N 70 BB4 N1 C13 sing N N 71 BB4 N1 O14 sing N N 72 BB4 O2 C13 doub N N 73 BB4 N3 C4 sing Y N 74 BB4 N3 C11 sing Y N 75 BB4 C4 C5 doub Y N 76 BB4 C5 C6 sing Y N 77 BB4 C5 C12 sing N N 78 BB4 C6 C7 doub Y N 79 BB4 C6 C11 sing Y N 80 BB4 C7 C8 sing Y N 81 BB4 C8 C9 doub Y N 82 BB4 C9 C10 sing Y N 83 BB4 C10 C11 doub Y N 84 BB4 C12 C13 sing N N 85 BB4 N1 HN1 sing N N 86 BB4 N3 HN3 sing N N 87 BB4 C4 H4 sing N N 88 BB4 C7 H7 sing N N 89 BB4 C9 H9 sing N N 90 BB4 C10 H10 sing N N 91 BB4 C12 H12 sing N N 92 BB4 C12 H12A sing N N 93 BB4 O14 HO14 sing N N 94 CYS N CA sing N N 95 CYS N H sing N N 96 CYS N H2 sing N N 97 CYS CA C sing N N 98 CYS CA CB sing N N 99 CYS CA HA sing N N 100 CYS C O doub N N 101 CYS C OXT sing N N 102 CYS CB SG sing N N 103 CYS CB HB2 sing N N 104 CYS CB HB3 sing N N 105 CYS SG HG sing N N 106 CYS OXT HXT sing N N 107 DMS S O doub N N 108 DMS S C1 sing N N 109 DMS S C2 sing N N 110 DMS C1 H11 sing N N 111 DMS C1 H12 sing N N 112 DMS C1 H13 sing N N 113 DMS C2 H21 sing N N 114 DMS C2 H22 sing N N 115 DMS C2 H23 sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 GOL C1 O1 sing N N 163 GOL C1 C2 sing N N 164 GOL C1 H11 sing N N 165 GOL C1 H12 sing N N 166 GOL O1 HO1 sing N N 167 GOL C2 O2 sing N N 168 GOL C2 C3 sing N N 169 GOL C2 H2 sing N N 170 GOL O2 HO2 sing N N 171 GOL C3 O3 sing N N 172 GOL C3 H31 sing N N 173 GOL C3 H32 sing N N 174 GOL O3 HO3 sing N N 175 HIS N CA sing N N 176 HIS N H sing N N 177 HIS N H2 sing N N 178 HIS CA C sing N N 179 HIS CA CB sing N N 180 HIS CA HA sing N N 181 HIS C O doub N N 182 HIS C OXT sing N N 183 HIS CB CG sing N N 184 HIS CB HB2 sing N N 185 HIS CB HB3 sing N N 186 HIS CG ND1 sing Y N 187 HIS CG CD2 doub Y N 188 HIS ND1 CE1 doub Y N 189 HIS ND1 HD1 sing N N 190 HIS CD2 NE2 sing Y N 191 HIS CD2 HD2 sing N N 192 HIS CE1 NE2 sing Y N 193 HIS CE1 HE1 sing N N 194 HIS NE2 HE2 sing N N 195 HIS OXT HXT sing N N 196 HOH O H1 sing N N 197 HOH O H2 sing N N 198 ILE N CA sing N N 199 ILE N H sing N N 200 ILE N H2 sing N N 201 ILE CA C sing N N 202 ILE CA CB sing N N 203 ILE CA HA sing N N 204 ILE C O doub N N 205 ILE C OXT sing N N 206 ILE CB CG1 sing N N 207 ILE CB CG2 sing N N 208 ILE CB HB sing N N 209 ILE CG1 CD1 sing N N 210 ILE CG1 HG12 sing N N 211 ILE CG1 HG13 sing N N 212 ILE CG2 HG21 sing N N 213 ILE CG2 HG22 sing N N 214 ILE CG2 HG23 sing N N 215 ILE CD1 HD11 sing N N 216 ILE CD1 HD12 sing N N 217 ILE CD1 HD13 sing N N 218 ILE OXT HXT sing N N 219 LEU N CA sing N N 220 LEU N H sing N N 221 LEU N H2 sing N N 222 LEU CA C sing N N 223 LEU CA CB sing N N 224 LEU CA HA sing N N 225 LEU C O doub N N 226 LEU C OXT sing N N 227 LEU CB CG sing N N 228 LEU CB HB2 sing N N 229 LEU CB HB3 sing N N 230 LEU CG CD1 sing N N 231 LEU CG CD2 sing N N 232 LEU CG HG sing N N 233 LEU CD1 HD11 sing N N 234 LEU CD1 HD12 sing N N 235 LEU CD1 HD13 sing N N 236 LEU CD2 HD21 sing N N 237 LEU CD2 HD22 sing N N 238 LEU CD2 HD23 sing N N 239 LEU OXT HXT sing N N 240 LYS N CA sing N N 241 LYS N H sing N N 242 LYS N H2 sing N N 243 LYS CA C sing N N 244 LYS CA CB sing N N 245 LYS CA HA sing N N 246 LYS C O doub N N 247 LYS C OXT sing N N 248 LYS CB CG sing N N 249 LYS CB HB2 sing N N 250 LYS CB HB3 sing N N 251 LYS CG CD sing N N 252 LYS CG HG2 sing N N 253 LYS CG HG3 sing N N 254 LYS CD CE sing N N 255 LYS CD HD2 sing N N 256 LYS CD HD3 sing N N 257 LYS CE NZ sing N N 258 LYS CE HE2 sing N N 259 LYS CE HE3 sing N N 260 LYS NZ HZ1 sing N N 261 LYS NZ HZ2 sing N N 262 LYS NZ HZ3 sing N N 263 LYS OXT HXT sing N N 264 MET N CA sing N N 265 MET N H sing N N 266 MET N H2 sing N N 267 MET CA C sing N N 268 MET CA CB sing N N 269 MET CA HA sing N N 270 MET C O doub N N 271 MET C OXT sing N N 272 MET CB CG sing N N 273 MET CB HB2 sing N N 274 MET CB HB3 sing N N 275 MET CG SD sing N N 276 MET CG HG2 sing N N 277 MET CG HG3 sing N N 278 MET SD CE sing N N 279 MET CE HE1 sing N N 280 MET CE HE2 sing N N 281 MET CE HE3 sing N N 282 MET OXT HXT sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'German Federal Ministry for Education and Research' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 16GW0224 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BB4 ? ? BB4 ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1G2A _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 61 2 2' _space_group.name_Hall 'P 61 2 (x,y,z+5/12)' _space_group.IT_number 178 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 8RHR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018232 _atom_sites.fract_transf_matrix[1][2] 0.010526 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021052 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004375 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source BR ? ? 25.79822 9.11301 ? ? 1.35700 25.34896 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_