data_8RKP # _entry.id 8RKP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RKP pdb_00008rkp 10.2210/pdb8rkp/pdb WWPDB D_1292134433 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-12-04 ? 2 'Structure model' 2 0 2026-09-02 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Metalloprotein remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Non-polymer description' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp 2 2 'Structure model' chem_comp_atom 3 2 'Structure model' chem_comp_bond 4 2 'Structure model' entity 5 2 'Structure model' pdbx_nonpoly_atom_coordination 6 2 'Structure model' pdbx_nonpoly_atom_coordination_sphere 7 2 'Structure model' pdbx_nonpoly_atom_coordination_sphere_order 8 2 'Structure model' pdbx_validate_chiral # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_chem_comp.formula' 2 2 'Structure model' '_chem_comp.formula_weight' 3 2 'Structure model' '_entity.formula_weight' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8RKP _pdbx_database_status.recvd_initial_deposition_date 2023-12-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details '5B3I is the native state without NO binding' _pdbx_database_related.db_id 5B3I _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email sotaro.fujii@diamond.ac.uk _pdbx_contact_author.name_first Sotaro _pdbx_contact_author.name_last Fujii _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5356-7674 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fujii, S.' 1 0000-0001-5356-7674 'Hough, M.A.' 2 0000-0001-7377-6713 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biophys.J. _citation.journal_id_ASTM BIOJAU _citation.journal_id_CSD 0030 _citation.journal_id_ISSN 1542-0086 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 123 _citation.language ? _citation.page_first 2594 _citation.page_last 2603 _citation.title ;Conformational rigidity of cytochrome c'-alpha from a thermophile is associated with slow NO binding. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bpj.2024.06.026 _citation.pdbx_database_id_PubMed 38937973 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fujii, S.' 1 ? primary 'Wilson, M.T.' 2 ? primary 'Adams, H.R.' 3 ? primary 'Mikolajek, H.' 4 ? primary 'Svistunenko, D.A.' 5 ? primary 'Smyth, P.' 6 ? primary 'Andrew, C.R.' 7 ? primary 'Sambongi, Y.' 8 ? primary 'Hough, M.A.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c prime' 14733.850 1 ? ? ? ? 2 non-polymer syn 'NITRIC OXIDE' 30.006 1 ? ? ? ? 3 non-polymer syn 'ASCORBIC ACID' 176.124 3 ? ? ? ? 4 non-polymer syn 'HEME C' 620.519 1 ? ? ? ? 5 water nat water 18.015 68 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFF QEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE ; _entity_poly.pdbx_seq_one_letter_code_can ;ALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFF QEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NITRIC OXIDE' NO 3 'ASCORBIC ACID' ASC 4 'HEME C' HEC 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 LYS n 1 4 PRO n 1 5 GLU n 1 6 ASP n 1 7 LYS n 1 8 VAL n 1 9 LYS n 1 10 PHE n 1 11 ARG n 1 12 GLN n 1 13 ALA n 1 14 SER n 1 15 TYR n 1 16 THR n 1 17 THR n 1 18 MET n 1 19 ALA n 1 20 TRP n 1 21 ASN n 1 22 MET n 1 23 GLY n 1 24 LYS n 1 25 ILE n 1 26 LYS n 1 27 ALA n 1 28 MET n 1 29 VAL n 1 30 VAL n 1 31 ASP n 1 32 GLY n 1 33 THR n 1 34 MET n 1 35 PRO n 1 36 PHE n 1 37 SER n 1 38 GLN n 1 39 THR n 1 40 GLN n 1 41 VAL n 1 42 SER n 1 43 ALA n 1 44 ALA n 1 45 ALA n 1 46 ASN n 1 47 VAL n 1 48 ILE n 1 49 ALA n 1 50 ALA n 1 51 ILE n 1 52 ALA n 1 53 ASN n 1 54 SER n 1 55 GLY n 1 56 MET n 1 57 GLY n 1 58 ALA n 1 59 LEU n 1 60 TYR n 1 61 SER n 1 62 PRO n 1 63 ASP n 1 64 THR n 1 65 LEU n 1 66 GLY n 1 67 VAL n 1 68 VAL n 1 69 GLY n 1 70 PHE n 1 71 LYS n 1 72 LYS n 1 73 SER n 1 74 ARG n 1 75 LEU n 1 76 LYS n 1 77 GLU n 1 78 ASN n 1 79 PHE n 1 80 PHE n 1 81 GLN n 1 82 GLU n 1 83 GLN n 1 84 ASP n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 LYS n 1 89 ILE n 1 90 ALA n 1 91 THR n 1 92 ASN n 1 93 PHE n 1 94 VAL n 1 95 GLU n 1 96 GLN n 1 97 ALA n 1 98 ASN n 1 99 LYS n 1 100 LEU n 1 101 ALA n 1 102 GLU n 1 103 VAL n 1 104 ALA n 1 105 ALA n 1 106 MET n 1 107 GLY n 1 108 ASP n 1 109 LYS n 1 110 ASP n 1 111 GLU n 1 112 ILE n 1 113 LYS n 1 114 ALA n 1 115 GLN n 1 116 PHE n 1 117 GLY n 1 118 GLU n 1 119 VAL n 1 120 GLY n 1 121 LYS n 1 122 ALA n 1 123 CYS n 1 124 LYS n 1 125 ALA n 1 126 CYS n 1 127 HIS n 1 128 GLU n 1 129 LYS n 1 130 PHE n 1 131 ARG n 1 132 GLU n 1 133 GLU n 1 134 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 134 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'cytc, HPTL_0021' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hydrogenophilus thermoluteolus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 297 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JCB387 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASC L-saccharide . 'ASCORBIC ACID' 'Vitamin C' 'C6 H8 O6' 176.124 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H36 Fe N4 O4' 620.519 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NO non-polymer . 'NITRIC OXIDE' 'Nitrogen monoxide' 'N O' 30.006 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 LEU 2 3 3 LEU LEU A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 PRO 4 5 5 PRO PRO A . n A 1 5 GLU 5 6 6 GLU GLU A . n A 1 6 ASP 6 7 7 ASP ASP A . n A 1 7 LYS 7 8 8 LYS LYS A . n A 1 8 VAL 8 9 9 VAL VAL A . n A 1 9 LYS 9 10 10 LYS LYS A . n A 1 10 PHE 10 11 11 PHE PHE A . n A 1 11 ARG 11 12 12 ARG ARG A . n A 1 12 GLN 12 13 13 GLN GLN A . n A 1 13 ALA 13 14 14 ALA ALA A . n A 1 14 SER 14 15 15 SER SER A . n A 1 15 TYR 15 16 16 TYR TYR A . n A 1 16 THR 16 17 17 THR THR A . n A 1 17 THR 17 18 18 THR THR A . n A 1 18 MET 18 19 19 MET MET A . n A 1 19 ALA 19 20 20 ALA ALA A . n A 1 20 TRP 20 21 21 TRP TRP A . n A 1 21 ASN 21 22 22 ASN ASN A . n A 1 22 MET 22 23 23 MET MET A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 LYS 24 25 25 LYS LYS A . n A 1 25 ILE 25 26 26 ILE ILE A . n A 1 26 LYS 26 27 27 LYS LYS A . n A 1 27 ALA 27 28 28 ALA ALA A . n A 1 28 MET 28 29 29 MET MET A . n A 1 29 VAL 29 30 30 VAL VAL A . n A 1 30 VAL 30 31 31 VAL VAL A . n A 1 31 ASP 31 32 32 ASP ASP A . n A 1 32 GLY 32 33 33 GLY GLY A . n A 1 33 THR 33 34 34 THR THR A . n A 1 34 MET 34 35 35 MET MET A . n A 1 35 PRO 35 36 36 PRO PRO A . n A 1 36 PHE 36 37 37 PHE PHE A . n A 1 37 SER 37 38 38 SER SER A . n A 1 38 GLN 38 39 39 GLN GLN A . n A 1 39 THR 39 40 40 THR THR A . n A 1 40 GLN 40 41 41 GLN GLN A . n A 1 41 VAL 41 42 42 VAL VAL A . n A 1 42 SER 42 43 43 SER SER A . n A 1 43 ALA 43 44 44 ALA ALA A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 ALA 45 46 46 ALA ALA A . n A 1 46 ASN 46 47 47 ASN ASN A . n A 1 47 VAL 47 48 48 VAL VAL A . n A 1 48 ILE 48 49 49 ILE ILE A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 ALA 50 51 51 ALA ALA A . n A 1 51 ILE 51 52 52 ILE ILE A . n A 1 52 ALA 52 53 53 ALA ALA A . n A 1 53 ASN 53 54 54 ASN ASN A . n A 1 54 SER 54 55 55 SER SER A . n A 1 55 GLY 55 56 56 GLY GLY A . n A 1 56 MET 56 57 57 MET MET A . n A 1 57 GLY 57 58 58 GLY GLY A . n A 1 58 ALA 58 59 59 ALA ALA A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 TYR 60 61 61 TYR TYR A . n A 1 61 SER 61 62 62 SER SER A . n A 1 62 PRO 62 63 63 PRO PRO A . n A 1 63 ASP 63 64 64 ASP ASP A . n A 1 64 THR 64 65 65 THR THR A . n A 1 65 LEU 65 66 66 LEU LEU A . n A 1 66 GLY 66 67 67 GLY GLY A . n A 1 67 VAL 67 68 68 VAL VAL A . n A 1 68 VAL 68 69 69 VAL VAL A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 PHE 70 71 71 PHE PHE A . n A 1 71 LYS 71 72 72 LYS LYS A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 SER 73 74 74 SER SER A . n A 1 74 ARG 74 75 75 ARG ARG A . n A 1 75 LEU 75 76 76 LEU LEU A . n A 1 76 LYS 76 77 77 LYS LYS A . n A 1 77 GLU 77 78 78 GLU GLU A . n A 1 78 ASN 78 79 79 ASN ASN A . n A 1 79 PHE 79 80 80 PHE PHE A . n A 1 80 PHE 80 81 81 PHE PHE A . n A 1 81 GLN 81 82 82 GLN GLN A . n A 1 82 GLU 82 83 83 GLU GLU A . n A 1 83 GLN 83 84 84 GLN GLN A . n A 1 84 ASP 84 85 85 ASP ASP A . n A 1 85 GLU 85 86 86 GLU GLU A . n A 1 86 VAL 86 87 87 VAL VAL A . n A 1 87 ARG 87 88 88 ARG ARG A . n A 1 88 LYS 88 89 89 LYS LYS A . n A 1 89 ILE 89 90 90 ILE ILE A . n A 1 90 ALA 90 91 91 ALA ALA A . n A 1 91 THR 91 92 92 THR THR A . n A 1 92 ASN 92 93 93 ASN ASN A . n A 1 93 PHE 93 94 94 PHE PHE A . n A 1 94 VAL 94 95 95 VAL VAL A . n A 1 95 GLU 95 96 96 GLU GLU A . n A 1 96 GLN 96 97 97 GLN GLN A . n A 1 97 ALA 97 98 98 ALA ALA A . n A 1 98 ASN 98 99 99 ASN ASN A . n A 1 99 LYS 99 100 100 LYS LYS A . n A 1 100 LEU 100 101 101 LEU LEU A . n A 1 101 ALA 101 102 102 ALA ALA A . n A 1 102 GLU 102 103 103 GLU GLU A . n A 1 103 VAL 103 104 104 VAL VAL A . n A 1 104 ALA 104 105 105 ALA ALA A . n A 1 105 ALA 105 106 106 ALA ALA A . n A 1 106 MET 106 107 107 MET MET A . n A 1 107 GLY 107 108 108 GLY GLY A . n A 1 108 ASP 108 109 109 ASP ASP A . n A 1 109 LYS 109 110 110 LYS LYS A . n A 1 110 ASP 110 111 111 ASP ASP A . n A 1 111 GLU 111 112 112 GLU GLU A . n A 1 112 ILE 112 113 113 ILE ILE A . n A 1 113 LYS 113 114 114 LYS LYS A . n A 1 114 ALA 114 115 115 ALA ALA A . n A 1 115 GLN 115 116 116 GLN GLN A . n A 1 116 PHE 116 117 117 PHE PHE A . n A 1 117 GLY 117 118 118 GLY GLY A . n A 1 118 GLU 118 119 119 GLU GLU A . n A 1 119 VAL 119 120 120 VAL VAL A . n A 1 120 GLY 120 121 121 GLY GLY A . n A 1 121 LYS 121 122 122 LYS LYS A . n A 1 122 ALA 122 123 123 ALA ALA A . n A 1 123 CYS 123 124 124 CYS CYS A . n A 1 124 LYS 124 125 125 LYS LYS A . n A 1 125 ALA 125 126 126 ALA ALA A . n A 1 126 CYS 126 127 127 CYS CYS A . n A 1 127 HIS 127 128 128 HIS HIS A . n A 1 128 GLU 128 129 129 GLU GLU A . n A 1 129 LYS 129 130 130 LYS LYS A . n A 1 130 PHE 130 131 131 PHE PHE A . n A 1 131 ARG 131 132 132 ARG ARG A . n A 1 132 GLU 132 133 133 GLU GLU A . n A 1 133 GLU 133 134 134 GLU GLU A . n A 1 134 GLU 134 135 135 GLU GLU A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ASC ? ? ASC ? ? 'SUBJECT OF INVESTIGATION' ? 2 NO ? ? NO ? ? 'SUBJECT OF INVESTIGATION' ? 3 HEC ? ? HEC ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NO 1 201 202 NO NO A . C 3 ASC 1 202 203 ASC ASC A . D 3 ASC 1 203 205 ASC ASC A . E 3 ASC 1 204 206 ASC ASC A . F 4 HEC 1 205 207 HEC HEC A . G 5 HOH 1 301 59 HOH HOH A . G 5 HOH 2 302 62 HOH HOH A . G 5 HOH 3 303 31 HOH HOH A . G 5 HOH 4 304 75 HOH HOH A . G 5 HOH 5 305 6 HOH HOH A . G 5 HOH 6 306 30 HOH HOH A . G 5 HOH 7 307 20 HOH HOH A . G 5 HOH 8 308 43 HOH HOH A . G 5 HOH 9 309 35 HOH HOH A . G 5 HOH 10 310 71 HOH HOH A . G 5 HOH 11 311 36 HOH HOH A . G 5 HOH 12 312 17 HOH HOH A . G 5 HOH 13 313 23 HOH HOH A . G 5 HOH 14 314 1 HOH HOH A . G 5 HOH 15 315 4 HOH HOH A . G 5 HOH 16 316 3 HOH HOH A . G 5 HOH 17 317 47 HOH HOH A . G 5 HOH 18 318 21 HOH HOH A . G 5 HOH 19 319 12 HOH HOH A . G 5 HOH 20 320 66 HOH HOH A . G 5 HOH 21 321 46 HOH HOH A . G 5 HOH 22 322 29 HOH HOH A . G 5 HOH 23 323 14 HOH HOH A . G 5 HOH 24 324 9 HOH HOH A . G 5 HOH 25 325 33 HOH HOH A . G 5 HOH 26 326 55 HOH HOH A . G 5 HOH 27 327 5 HOH HOH A . G 5 HOH 28 328 7 HOH HOH A . G 5 HOH 29 329 8 HOH HOH A . G 5 HOH 30 330 15 HOH HOH A . G 5 HOH 31 331 61 HOH HOH A . G 5 HOH 32 332 24 HOH HOH A . G 5 HOH 33 333 13 HOH HOH A . G 5 HOH 34 334 10 HOH HOH A . G 5 HOH 35 335 39 HOH HOH A . G 5 HOH 36 336 54 HOH HOH A . G 5 HOH 37 337 52 HOH HOH A . G 5 HOH 38 338 48 HOH HOH A . G 5 HOH 39 339 26 HOH HOH A . G 5 HOH 40 340 19 HOH HOH A . G 5 HOH 41 341 58 HOH HOH A . G 5 HOH 42 342 40 HOH HOH A . G 5 HOH 43 343 2 HOH HOH A . G 5 HOH 44 344 27 HOH HOH A . G 5 HOH 45 345 60 HOH HOH A . G 5 HOH 46 346 44 HOH HOH A . G 5 HOH 47 347 11 HOH HOH A . G 5 HOH 48 348 49 HOH HOH A . G 5 HOH 49 349 18 HOH HOH A . G 5 HOH 50 350 42 HOH HOH A . G 5 HOH 51 351 22 HOH HOH A . G 5 HOH 52 352 32 HOH HOH A . G 5 HOH 53 353 68 HOH HOH A . G 5 HOH 54 354 53 HOH HOH A . G 5 HOH 55 355 67 HOH HOH A . G 5 HOH 56 356 25 HOH HOH A . G 5 HOH 57 357 65 HOH HOH A . G 5 HOH 58 358 50 HOH HOH A . G 5 HOH 59 359 51 HOH HOH A . G 5 HOH 60 360 41 HOH HOH A . G 5 HOH 61 361 64 HOH HOH A . G 5 HOH 62 362 72 HOH HOH A . G 5 HOH 63 363 63 HOH HOH A . G 5 HOH 64 364 38 HOH HOH A . G 5 HOH 65 365 56 HOH HOH A . G 5 HOH 66 366 57 HOH HOH A . G 5 HOH 67 367 28 HOH HOH A . G 5 HOH 68 368 73 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 8RKP _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.671 _cell.length_a_esd ? _cell.length_b 83.671 _cell.length_b_esd ? _cell.length_c 88.247 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8RKP _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RKP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details 'room temperature (20 C)' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M sodium acetate pH 4.5, 0.2 M lithium sulphate, 30% (w/v) PEG 8,000 in a 96-well in-situ plate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-04-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8RKP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.63 _reflns.d_resolution_low 72.57 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23390 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.120 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.63 _reflns_shell.d_res_low 1.66 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1135 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 4.362 _reflns_shell.pdbx_Rpim_I_all 0.952 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.3 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.255 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.03 _refine.aniso_B[1][2] 0.01 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.03 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.10 _refine.B_iso_max ? _refine.B_iso_mean 33.946 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.958 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8RKP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.63 _refine.ls_d_res_low 72.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22222 _refine.ls_number_reflns_R_free 1131 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19835 _refine.ls_R_factor_R_free 0.21928 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19727 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.086 _refine.pdbx_overall_ESU_R_Free 0.085 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.109 _refine.overall_SU_ML 0.092 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.63 _refine_hist.d_res_low 72.57 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1178 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1029 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 81 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.013 1162 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1076 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.431 1.739 1578 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.578 1.633 2489 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.184 5.000 136 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.735 22.667 60 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.960 15.000 201 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.175 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.307 0.200 148 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 1325 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 247 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.889 3.093 545 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.890 3.084 543 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.211 4.604 680 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.208 4.614 681 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.566 3.955 617 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.565 3.956 615 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.969 5.666 898 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.397 38.396 1360 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 9.345 38.283 1353 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.630 _refine_ls_shell.d_res_low 1.672 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 73 _refine_ls_shell.number_reflns_R_work 1611 _refine_ls_shell.percent_reflns_obs 99.94 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.403 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.416 # _struct.entry_id 8RKP _struct.title 'Cytochrome c prime from Hydrogenophilus thermoluteolus: Ferrous recombinant native with bound NO' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RKP _struct_keywords.text 'Nitrix oxide binding, Heme protein, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code F7J213_HYDTE _struct_ref.pdbx_db_accession F7J213 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFF QEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8RKP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession F7J213 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 135 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6850 ? 1 MORE -49 ? 1 'SSA (A^2)' 12210 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 -41.8355000000 0.0000000000 -1.0000000000 0.0000000000 72.4612115600 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 3 ? VAL A 30 ? LYS A 4 VAL A 31 1 ? 28 HELX_P HELX_P2 AA2 SER A 37 ? ASN A 53 ? SER A 38 ASN A 54 1 ? 17 HELX_P HELX_P3 AA3 GLY A 55 ? TYR A 60 ? GLY A 56 TYR A 61 5 ? 6 HELX_P HELX_P4 AA4 SER A 61 ? LEU A 65 ? SER A 62 LEU A 66 5 ? 5 HELX_P HELX_P5 AA5 LYS A 76 ? GLN A 81 ? LYS A 77 GLN A 82 5 ? 6 HELX_P HELX_P6 AA6 GLU A 82 ? ALA A 105 ? GLU A 83 ALA A 106 1 ? 24 HELX_P HELX_P7 AA7 ASP A 108 ? CYS A 126 ? ASP A 109 CYS A 127 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 123 SG ? ? ? 1_555 F HEC . CAB ? ? A CYS 124 A HEC 205 1_555 ? ? ? ? ? ? ? 1.806 ? ? covale2 covale none ? A CYS 126 SG ? ? ? 1_555 F HEC . CAC ? ? A CYS 127 A HEC 205 1_555 ? ? ? ? ? ? ? 1.767 ? ? metalc1 metalc ? ? B NO . N ? ? ? 1_555 F HEC . FE ? ? A NO 201 A HEC 205 1_555 ? ? ? ? ? ? ? 1.909 ? ? metalc2 metalc ? ? B NO . O ? ? ? 1_555 F HEC . FE ? ? A NO 201 A HEC 205 1_555 ? ? ? ? ? ? ? 2.725 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? B NO . ? A NO 201 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 NA ? F HEC . ? A HEC 205 ? 1_555 93.7 ? 2 N ? B NO . ? A NO 201 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 NB ? F HEC . ? A HEC 205 ? 1_555 85.0 ? 3 NA ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 NB ? F HEC . ? A HEC 205 ? 1_555 88.6 ? 4 N ? B NO . ? A NO 201 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 NC ? F HEC . ? A HEC 205 ? 1_555 95.7 ? 5 NA ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 NC ? F HEC . ? A HEC 205 ? 1_555 170.5 ? 6 NB ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 NC ? F HEC . ? A HEC 205 ? 1_555 93.3 ? 7 N ? B NO . ? A NO 201 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 ND ? F HEC . ? A HEC 205 ? 1_555 103.4 ? 8 NA ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 ND ? F HEC . ? A HEC 205 ? 1_555 89.0 ? 9 NB ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 ND ? F HEC . ? A HEC 205 ? 1_555 171.4 ? 10 NC ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 ND ? F HEC . ? A HEC 205 ? 1_555 87.8 ? 11 N ? B NO . ? A NO 201 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 O ? B NO . ? A NO 201 ? 1_555 26.1 ? 12 NA ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 O ? B NO . ? A NO 201 ? 1_555 107.4 ? 13 NB ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 O ? B NO . ? A NO 201 ? 1_555 107.1 ? 14 NC ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 O ? B NO . ? A NO 201 ? 1_555 81.0 ? 15 ND ? F HEC . ? A HEC 205 ? 1_555 FE ? F HEC . ? A HEC 205 ? 1_555 O ? B NO . ? A NO 201 ? 1_555 81.5 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 HEC F . ? CYS A 123 ? HEC A 205 ? 1_555 CYS A 124 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 2 HEC F . ? CYS A 126 ? HEC A 205 ? 1_555 CYS A 127 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like # _pdbx_entry_details.entry_id 8RKP _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 129 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 61.95 _pdbx_validate_torsion.psi -45.43 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id NA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id HEC _pdbx_validate_chiral.auth_seq_id 205 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # _pdbx_nonpoly_atom_coordination.geometry_id 1 _pdbx_nonpoly_atom_coordination.label_asym_id F _pdbx_nonpoly_atom_coordination.label_seq_id . _pdbx_nonpoly_atom_coordination.label_comp_id HEC _pdbx_nonpoly_atom_coordination.label_atom_id FE _pdbx_nonpoly_atom_coordination.label_alt_id ? _pdbx_nonpoly_atom_coordination.auth_asym_id A _pdbx_nonpoly_atom_coordination.auth_seq_id 205 _pdbx_nonpoly_atom_coordination.auth_comp_id HEC _pdbx_nonpoly_atom_coordination.auth_atom_id FE _pdbx_nonpoly_atom_coordination.PDB_ins_code ? _pdbx_nonpoly_atom_coordination.number 5 _pdbx_nonpoly_atom_coordination.geometry_calculated square-pyramid _pdbx_nonpoly_atom_coordination.remark regular _pdbx_nonpoly_atom_coordination.geometry_generic 'square pyramidal' _pdbx_nonpoly_atom_coordination.geometry_abbr SQP _pdbx_nonpoly_atom_coordination.provenance MetalCoord _pdbx_nonpoly_atom_coordination.assessment Expected # _pdbx_nonpoly_atom_coordination_sphere.id 1 _pdbx_nonpoly_atom_coordination_sphere.geometry_id 1 _pdbx_nonpoly_atom_coordination_sphere.label_asym_id F _pdbx_nonpoly_atom_coordination_sphere.label_seq_id . _pdbx_nonpoly_atom_coordination_sphere.label_comp_id HEC _pdbx_nonpoly_atom_coordination_sphere.label_atom_id FE _pdbx_nonpoly_atom_coordination_sphere.label_alt_id ? _pdbx_nonpoly_atom_coordination_sphere.auth_asym_id A _pdbx_nonpoly_atom_coordination_sphere.auth_seq_id 205 _pdbx_nonpoly_atom_coordination_sphere.auth_comp_id HEC _pdbx_nonpoly_atom_coordination_sphere.auth_atom_id FE _pdbx_nonpoly_atom_coordination_sphere.PDB_ins_code ? _pdbx_nonpoly_atom_coordination_sphere.descriptor '@SQP{Fe,N,N,N,N,N}' _pdbx_nonpoly_atom_coordination_sphere.provenance MetalCoord # loop_ _pdbx_nonpoly_atom_coordination_sphere_order.sphere_id _pdbx_nonpoly_atom_coordination_sphere_order.label_asym_id _pdbx_nonpoly_atom_coordination_sphere_order.label_seq_id _pdbx_nonpoly_atom_coordination_sphere_order.label_comp_id _pdbx_nonpoly_atom_coordination_sphere_order.label_atom_id _pdbx_nonpoly_atom_coordination_sphere_order.label_alt_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_asym_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_seq_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_comp_id _pdbx_nonpoly_atom_coordination_sphere_order.auth_atom_id _pdbx_nonpoly_atom_coordination_sphere_order.PDB_ins_code _pdbx_nonpoly_atom_coordination_sphere_order.symmetry_operation _pdbx_nonpoly_atom_coordination_sphere_order.atom_place 1 F . HEC NA ? A 205 HEC NA ? x,y,z 1 1 F . HEC NB ? A 205 HEC NB ? x,y,z 2 1 F . HEC NC ? A 205 HEC NC ? x,y,z 3 1 F . HEC ND ? A 205 HEC ND ? x,y,z 4 1 B . NO N ? A 201 NO N ? x,y,z 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASC C1 C N N 41 ASC C2 C N N 42 ASC C3 C N N 43 ASC C4 C N R 44 ASC C5 C N S 45 ASC C6 C N N 46 ASC O1 O N N 47 ASC O2 O N N 48 ASC O3 O N N 49 ASC O4 O N N 50 ASC O5 O N N 51 ASC O6 O N N 52 ASC H4 H N N 53 ASC H5 H N N 54 ASC H61 H N N 55 ASC H62 H N N 56 ASC HO2 H N N 57 ASC HO3 H N N 58 ASC HO5 H N N 59 ASC HO6 H N N 60 ASN N N N N 61 ASN CA C N S 62 ASN C C N N 63 ASN O O N N 64 ASN CB C N N 65 ASN CG C N N 66 ASN OD1 O N N 67 ASN ND2 N N N 68 ASN OXT O N N 69 ASN H H N N 70 ASN H2 H N N 71 ASN HA H N N 72 ASN HB2 H N N 73 ASN HB3 H N N 74 ASN HD21 H N N 75 ASN HD22 H N N 76 ASN HXT H N N 77 ASP N N N N 78 ASP CA C N S 79 ASP C C N N 80 ASP O O N N 81 ASP CB C N N 82 ASP CG C N N 83 ASP OD1 O N N 84 ASP OD2 O N N 85 ASP OXT O N N 86 ASP H H N N 87 ASP H2 H N N 88 ASP HA H N N 89 ASP HB2 H N N 90 ASP HB3 H N N 91 ASP HD2 H N N 92 ASP HXT H N N 93 CYS N N N N 94 CYS CA C N R 95 CYS C C N N 96 CYS O O N N 97 CYS CB C N N 98 CYS SG S N N 99 CYS OXT O N N 100 CYS H H N N 101 CYS H2 H N N 102 CYS HA H N N 103 CYS HB2 H N N 104 CYS HB3 H N N 105 CYS HG H N N 106 CYS HXT H N N 107 GLN N N N N 108 GLN CA C N S 109 GLN C C N N 110 GLN O O N N 111 GLN CB C N N 112 GLN CG C N N 113 GLN CD C N N 114 GLN OE1 O N N 115 GLN NE2 N N N 116 GLN OXT O N N 117 GLN H H N N 118 GLN H2 H N N 119 GLN HA H N N 120 GLN HB2 H N N 121 GLN HB3 H N N 122 GLN HG2 H N N 123 GLN HG3 H N N 124 GLN HE21 H N N 125 GLN HE22 H N N 126 GLN HXT H N N 127 GLU N N N N 128 GLU CA C N S 129 GLU C C N N 130 GLU O O N N 131 GLU CB C N N 132 GLU CG C N N 133 GLU CD C N N 134 GLU OE1 O N N 135 GLU OE2 O N N 136 GLU OXT O N N 137 GLU H H N N 138 GLU H2 H N N 139 GLU HA H N N 140 GLU HB2 H N N 141 GLU HB3 H N N 142 GLU HG2 H N N 143 GLU HG3 H N N 144 GLU HE2 H N N 145 GLU HXT H N N 146 GLY N N N N 147 GLY CA C N N 148 GLY C C N N 149 GLY O O N N 150 GLY OXT O N N 151 GLY H H N N 152 GLY H2 H N N 153 GLY HA2 H N N 154 GLY HA3 H N N 155 GLY HXT H N N 156 HEC FE FE N N 157 HEC CHA C N N 158 HEC CHB C N N 159 HEC CHC C N N 160 HEC CHD C N N 161 HEC NA N N R 162 HEC C1A C N N 163 HEC C2A C N N 164 HEC C3A C N N 165 HEC C4A C N N 166 HEC CMA C N N 167 HEC CAA C N N 168 HEC CBA C N N 169 HEC CGA C N N 170 HEC O1A O N N 171 HEC O2A O N N 172 HEC NB N N N 173 HEC C1B C N N 174 HEC C2B C N N 175 HEC C3B C N N 176 HEC C4B C N N 177 HEC CMB C N N 178 HEC CAB C N N 179 HEC CBB C N N 180 HEC NC N Y N 181 HEC C1C C Y N 182 HEC C2C C Y N 183 HEC C3C C Y N 184 HEC C4C C Y N 185 HEC CMC C N N 186 HEC CAC C N N 187 HEC CBC C N N 188 HEC ND N N N 189 HEC C1D C N N 190 HEC C2D C N N 191 HEC C3D C N N 192 HEC C4D C N N 193 HEC CMD C N N 194 HEC CAD C N N 195 HEC CBD C N N 196 HEC CGD C N N 197 HEC O1D O N N 198 HEC O2D O N N 199 HEC HHA H N N 200 HEC HHB H N N 201 HEC HHC H N N 202 HEC HHD H N N 203 HEC HMA1 H N N 204 HEC HMA2 H N N 205 HEC HMA3 H N N 206 HEC HAA1 H N N 207 HEC HAA2 H N N 208 HEC HBA1 H N N 209 HEC HBA2 H N N 210 HEC H2A H N N 211 HEC HMB1 H N N 212 HEC HMB2 H N N 213 HEC HMB3 H N N 214 HEC HAB H N N 215 HEC HBB1 H N N 216 HEC HBB2 H N N 217 HEC HBB3 H N N 218 HEC HMC1 H N N 219 HEC HMC2 H N N 220 HEC HMC3 H N N 221 HEC HAC H N N 222 HEC HBC1 H N N 223 HEC HBC2 H N N 224 HEC HBC3 H N N 225 HEC HMD1 H N N 226 HEC HMD2 H N N 227 HEC HMD3 H N N 228 HEC HAD1 H N N 229 HEC HAD2 H N N 230 HEC HBD1 H N N 231 HEC HBD2 H N N 232 HEC H2D H N N 233 HEC H1 H N N 234 HEC H2 H N N 235 HIS N N N N 236 HIS CA C N S 237 HIS C C N N 238 HIS O O N N 239 HIS CB C N N 240 HIS CG C Y N 241 HIS ND1 N Y N 242 HIS CD2 C Y N 243 HIS CE1 C Y N 244 HIS NE2 N Y N 245 HIS OXT O N N 246 HIS H H N N 247 HIS H2 H N N 248 HIS HA H N N 249 HIS HB2 H N N 250 HIS HB3 H N N 251 HIS HD1 H N N 252 HIS HD2 H N N 253 HIS HE1 H N N 254 HIS HE2 H N N 255 HIS HXT H N N 256 HOH O O N N 257 HOH H1 H N N 258 HOH H2 H N N 259 ILE N N N N 260 ILE CA C N S 261 ILE C C N N 262 ILE O O N N 263 ILE CB C N S 264 ILE CG1 C N N 265 ILE CG2 C N N 266 ILE CD1 C N N 267 ILE OXT O N N 268 ILE H H N N 269 ILE H2 H N N 270 ILE HA H N N 271 ILE HB H N N 272 ILE HG12 H N N 273 ILE HG13 H N N 274 ILE HG21 H N N 275 ILE HG22 H N N 276 ILE HG23 H N N 277 ILE HD11 H N N 278 ILE HD12 H N N 279 ILE HD13 H N N 280 ILE HXT H N N 281 LEU N N N N 282 LEU CA C N S 283 LEU C C N N 284 LEU O O N N 285 LEU CB C N N 286 LEU CG C N N 287 LEU CD1 C N N 288 LEU CD2 C N N 289 LEU OXT O N N 290 LEU H H N N 291 LEU H2 H N N 292 LEU HA H N N 293 LEU HB2 H N N 294 LEU HB3 H N N 295 LEU HG H N N 296 LEU HD11 H N N 297 LEU HD12 H N N 298 LEU HD13 H N N 299 LEU HD21 H N N 300 LEU HD22 H N N 301 LEU HD23 H N N 302 LEU HXT H N N 303 LYS N N N N 304 LYS CA C N S 305 LYS C C N N 306 LYS O O N N 307 LYS CB C N N 308 LYS CG C N N 309 LYS CD C N N 310 LYS CE C N N 311 LYS NZ N N N 312 LYS OXT O N N 313 LYS H H N N 314 LYS H2 H N N 315 LYS HA H N N 316 LYS HB2 H N N 317 LYS HB3 H N N 318 LYS HG2 H N N 319 LYS HG3 H N N 320 LYS HD2 H N N 321 LYS HD3 H N N 322 LYS HE2 H N N 323 LYS HE3 H N N 324 LYS HZ1 H N N 325 LYS HZ2 H N N 326 LYS HZ3 H N N 327 LYS HXT H N N 328 MET N N N N 329 MET CA C N S 330 MET C C N N 331 MET O O N N 332 MET CB C N N 333 MET CG C N N 334 MET SD S N N 335 MET CE C N N 336 MET OXT O N N 337 MET H H N N 338 MET H2 H N N 339 MET HA H N N 340 MET HB2 H N N 341 MET HB3 H N N 342 MET HG2 H N N 343 MET HG3 H N N 344 MET HE1 H N N 345 MET HE2 H N N 346 MET HE3 H N N 347 MET HXT H N N 348 NO N N N N 349 NO O O N N 350 PHE N N N N 351 PHE CA C N S 352 PHE C C N N 353 PHE O O N N 354 PHE CB C N N 355 PHE CG C Y N 356 PHE CD1 C Y N 357 PHE CD2 C Y N 358 PHE CE1 C Y N 359 PHE CE2 C Y N 360 PHE CZ C Y N 361 PHE OXT O N N 362 PHE H H N N 363 PHE H2 H N N 364 PHE HA H N N 365 PHE HB2 H N N 366 PHE HB3 H N N 367 PHE HD1 H N N 368 PHE HD2 H N N 369 PHE HE1 H N N 370 PHE HE2 H N N 371 PHE HZ H N N 372 PHE HXT H N N 373 PRO N N N N 374 PRO CA C N S 375 PRO C C N N 376 PRO O O N N 377 PRO CB C N N 378 PRO CG C N N 379 PRO CD C N N 380 PRO OXT O N N 381 PRO H H N N 382 PRO HA H N N 383 PRO HB2 H N N 384 PRO HB3 H N N 385 PRO HG2 H N N 386 PRO HG3 H N N 387 PRO HD2 H N N 388 PRO HD3 H N N 389 PRO HXT H N N 390 SER N N N N 391 SER CA C N S 392 SER C C N N 393 SER O O N N 394 SER CB C N N 395 SER OG O N N 396 SER OXT O N N 397 SER H H N N 398 SER H2 H N N 399 SER HA H N N 400 SER HB2 H N N 401 SER HB3 H N N 402 SER HG H N N 403 SER HXT H N N 404 THR N N N N 405 THR CA C N S 406 THR C C N N 407 THR O O N N 408 THR CB C N R 409 THR OG1 O N N 410 THR CG2 C N N 411 THR OXT O N N 412 THR H H N N 413 THR H2 H N N 414 THR HA H N N 415 THR HB H N N 416 THR HG1 H N N 417 THR HG21 H N N 418 THR HG22 H N N 419 THR HG23 H N N 420 THR HXT H N N 421 TRP N N N N 422 TRP CA C N S 423 TRP C C N N 424 TRP O O N N 425 TRP CB C N N 426 TRP CG C Y N 427 TRP CD1 C Y N 428 TRP CD2 C Y N 429 TRP NE1 N Y N 430 TRP CE2 C Y N 431 TRP CE3 C Y N 432 TRP CZ2 C Y N 433 TRP CZ3 C Y N 434 TRP CH2 C Y N 435 TRP OXT O N N 436 TRP H H N N 437 TRP H2 H N N 438 TRP HA H N N 439 TRP HB2 H N N 440 TRP HB3 H N N 441 TRP HD1 H N N 442 TRP HE1 H N N 443 TRP HE3 H N N 444 TRP HZ2 H N N 445 TRP HZ3 H N N 446 TRP HH2 H N N 447 TRP HXT H N N 448 TYR N N N N 449 TYR CA C N S 450 TYR C C N N 451 TYR O O N N 452 TYR CB C N N 453 TYR CG C Y N 454 TYR CD1 C Y N 455 TYR CD2 C Y N 456 TYR CE1 C Y N 457 TYR CE2 C Y N 458 TYR CZ C Y N 459 TYR OH O N N 460 TYR OXT O N N 461 TYR H H N N 462 TYR H2 H N N 463 TYR HA H N N 464 TYR HB2 H N N 465 TYR HB3 H N N 466 TYR HD1 H N N 467 TYR HD2 H N N 468 TYR HE1 H N N 469 TYR HE2 H N N 470 TYR HH H N N 471 TYR HXT H N N 472 VAL N N N N 473 VAL CA C N S 474 VAL C C N N 475 VAL O O N N 476 VAL CB C N N 477 VAL CG1 C N N 478 VAL CG2 C N N 479 VAL OXT O N N 480 VAL H H N N 481 VAL H2 H N N 482 VAL HA H N N 483 VAL HB H N N 484 VAL HG11 H N N 485 VAL HG12 H N N 486 VAL HG13 H N N 487 VAL HG21 H N N 488 VAL HG22 H N N 489 VAL HG23 H N N 490 VAL HXT H N N 491 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASC C1 C2 sing N N 39 ASC C1 O1 doub N N 40 ASC C1 O4 sing N N 41 ASC C2 C3 doub N N 42 ASC C2 O2 sing N N 43 ASC C3 C4 sing N N 44 ASC C3 O3 sing N N 45 ASC C4 C5 sing N N 46 ASC C4 O4 sing N N 47 ASC C4 H4 sing N N 48 ASC C5 C6 sing N N 49 ASC C5 O5 sing N N 50 ASC C5 H5 sing N N 51 ASC C6 O6 sing N N 52 ASC C6 H61 sing N N 53 ASC C6 H62 sing N N 54 ASC O2 HO2 sing N N 55 ASC O3 HO3 sing N N 56 ASC O5 HO5 sing N N 57 ASC O6 HO6 sing N N 58 ASN N CA sing N N 59 ASN N H sing N N 60 ASN N H2 sing N N 61 ASN CA C sing N N 62 ASN CA CB sing N N 63 ASN CA HA sing N N 64 ASN C O doub N N 65 ASN C OXT sing N N 66 ASN CB CG sing N N 67 ASN CB HB2 sing N N 68 ASN CB HB3 sing N N 69 ASN CG OD1 doub N N 70 ASN CG ND2 sing N N 71 ASN ND2 HD21 sing N N 72 ASN ND2 HD22 sing N N 73 ASN OXT HXT sing N N 74 ASP N CA sing N N 75 ASP N H sing N N 76 ASP N H2 sing N N 77 ASP CA C sing N N 78 ASP CA CB sing N N 79 ASP CA HA sing N N 80 ASP C O doub N N 81 ASP C OXT sing N N 82 ASP CB CG sing N N 83 ASP CB HB2 sing N N 84 ASP CB HB3 sing N N 85 ASP CG OD1 doub N N 86 ASP CG OD2 sing N N 87 ASP OD2 HD2 sing N N 88 ASP OXT HXT sing N N 89 CYS N CA sing N N 90 CYS N H sing N N 91 CYS N H2 sing N N 92 CYS CA C sing N N 93 CYS CA CB sing N N 94 CYS CA HA sing N N 95 CYS C O doub N N 96 CYS C OXT sing N N 97 CYS CB SG sing N N 98 CYS CB HB2 sing N N 99 CYS CB HB3 sing N N 100 CYS SG HG sing N N 101 CYS OXT HXT sing N N 102 GLN N CA sing N N 103 GLN N H sing N N 104 GLN N H2 sing N N 105 GLN CA C sing N N 106 GLN CA CB sing N N 107 GLN CA HA sing N N 108 GLN C O doub N N 109 GLN C OXT sing N N 110 GLN CB CG sing N N 111 GLN CB HB2 sing N N 112 GLN CB HB3 sing N N 113 GLN CG CD sing N N 114 GLN CG HG2 sing N N 115 GLN CG HG3 sing N N 116 GLN CD OE1 doub N N 117 GLN CD NE2 sing N N 118 GLN NE2 HE21 sing N N 119 GLN NE2 HE22 sing N N 120 GLN OXT HXT sing N N 121 GLU N CA sing N N 122 GLU N H sing N N 123 GLU N H2 sing N N 124 GLU CA C sing N N 125 GLU CA CB sing N N 126 GLU CA HA sing N N 127 GLU C O doub N N 128 GLU C OXT sing N N 129 GLU CB CG sing N N 130 GLU CB HB2 sing N N 131 GLU CB HB3 sing N N 132 GLU CG CD sing N N 133 GLU CG HG2 sing N N 134 GLU CG HG3 sing N N 135 GLU CD OE1 doub N N 136 GLU CD OE2 sing N N 137 GLU OE2 HE2 sing N N 138 GLU OXT HXT sing N N 139 GLY N CA sing N N 140 GLY N H sing N N 141 GLY N H2 sing N N 142 GLY CA C sing N N 143 GLY CA HA2 sing N N 144 GLY CA HA3 sing N N 145 GLY C O doub N N 146 GLY C OXT sing N N 147 GLY OXT HXT sing N N 148 HEC FE NA sing N N 149 HEC FE NB sing N N 150 HEC FE NC sing N N 151 HEC FE ND sing N N 152 HEC CHA C1A doub N N 153 HEC CHA C4D sing N N 154 HEC CHA HHA sing N N 155 HEC CHB C4A doub N N 156 HEC CHB C1B sing N N 157 HEC CHB HHB sing N N 158 HEC CHC C4B doub N N 159 HEC CHC C1C sing N N 160 HEC CHC HHC sing N N 161 HEC CHD C4C sing N N 162 HEC CHD C1D doub N N 163 HEC CHD HHD sing N N 164 HEC NA C1A sing N N 165 HEC NA C4A sing N N 166 HEC C1A C2A sing N N 167 HEC C2A C3A doub N N 168 HEC C2A CAA sing N N 169 HEC C3A C4A sing N N 170 HEC C3A CMA sing N N 171 HEC CMA HMA1 sing N N 172 HEC CMA HMA2 sing N N 173 HEC CMA HMA3 sing N N 174 HEC CAA CBA sing N N 175 HEC CAA HAA1 sing N N 176 HEC CAA HAA2 sing N N 177 HEC CBA CGA sing N N 178 HEC CBA HBA1 sing N N 179 HEC CBA HBA2 sing N N 180 HEC CGA O1A doub N N 181 HEC CGA O2A sing N N 182 HEC O2A H2A sing N N 183 HEC NB C1B doub N N 184 HEC NB C4B sing N N 185 HEC C1B C2B sing N N 186 HEC C2B C3B doub N N 187 HEC C2B CMB sing N N 188 HEC C3B C4B sing N N 189 HEC C3B CAB sing N N 190 HEC CMB HMB1 sing N N 191 HEC CMB HMB2 sing N N 192 HEC CMB HMB3 sing N N 193 HEC CAB CBB sing N N 194 HEC CAB HAB sing N N 195 HEC CBB HBB1 sing N N 196 HEC CBB HBB2 sing N N 197 HEC CBB HBB3 sing N N 198 HEC NC C1C sing Y N 199 HEC NC C4C sing Y N 200 HEC C1C C2C doub Y N 201 HEC C2C C3C sing Y N 202 HEC C2C CMC sing N N 203 HEC C3C C4C doub Y N 204 HEC C3C CAC sing N N 205 HEC CMC HMC1 sing N N 206 HEC CMC HMC2 sing N N 207 HEC CMC HMC3 sing N N 208 HEC CAC CBC sing N N 209 HEC CAC HAC sing N N 210 HEC CBC HBC1 sing N N 211 HEC CBC HBC2 sing N N 212 HEC CBC HBC3 sing N N 213 HEC ND C1D sing N N 214 HEC ND C4D doub N N 215 HEC C1D C2D sing N N 216 HEC C2D C3D doub N N 217 HEC C2D CMD sing N N 218 HEC C3D C4D sing N N 219 HEC C3D CAD sing N N 220 HEC CMD HMD1 sing N N 221 HEC CMD HMD2 sing N N 222 HEC CMD HMD3 sing N N 223 HEC CAD CBD sing N N 224 HEC CAD HAD1 sing N N 225 HEC CAD HAD2 sing N N 226 HEC CBD CGD sing N N 227 HEC CBD HBD1 sing N N 228 HEC CBD HBD2 sing N N 229 HEC CGD O1D doub N N 230 HEC CGD O2D sing N N 231 HEC O2D H2D sing N N 232 HEC H1 CAB sing N N 233 HEC H2 CAC sing N N 234 HIS N CA sing N N 235 HIS N H sing N N 236 HIS N H2 sing N N 237 HIS CA C sing N N 238 HIS CA CB sing N N 239 HIS CA HA sing N N 240 HIS C O doub N N 241 HIS C OXT sing N N 242 HIS CB CG sing N N 243 HIS CB HB2 sing N N 244 HIS CB HB3 sing N N 245 HIS CG ND1 sing Y N 246 HIS CG CD2 doub Y N 247 HIS ND1 CE1 doub Y N 248 HIS ND1 HD1 sing N N 249 HIS CD2 NE2 sing Y N 250 HIS CD2 HD2 sing N N 251 HIS CE1 NE2 sing Y N 252 HIS CE1 HE1 sing N N 253 HIS NE2 HE2 sing N N 254 HIS OXT HXT sing N N 255 HOH O H1 sing N N 256 HOH O H2 sing N N 257 ILE N CA sing N N 258 ILE N H sing N N 259 ILE N H2 sing N N 260 ILE CA C sing N N 261 ILE CA CB sing N N 262 ILE CA HA sing N N 263 ILE C O doub N N 264 ILE C OXT sing N N 265 ILE CB CG1 sing N N 266 ILE CB CG2 sing N N 267 ILE CB HB sing N N 268 ILE CG1 CD1 sing N N 269 ILE CG1 HG12 sing N N 270 ILE CG1 HG13 sing N N 271 ILE CG2 HG21 sing N N 272 ILE CG2 HG22 sing N N 273 ILE CG2 HG23 sing N N 274 ILE CD1 HD11 sing N N 275 ILE CD1 HD12 sing N N 276 ILE CD1 HD13 sing N N 277 ILE OXT HXT sing N N 278 LEU N CA sing N N 279 LEU N H sing N N 280 LEU N H2 sing N N 281 LEU CA C sing N N 282 LEU CA CB sing N N 283 LEU CA HA sing N N 284 LEU C O doub N N 285 LEU C OXT sing N N 286 LEU CB CG sing N N 287 LEU CB HB2 sing N N 288 LEU CB HB3 sing N N 289 LEU CG CD1 sing N N 290 LEU CG CD2 sing N N 291 LEU CG HG sing N N 292 LEU CD1 HD11 sing N N 293 LEU CD1 HD12 sing N N 294 LEU CD1 HD13 sing N N 295 LEU CD2 HD21 sing N N 296 LEU CD2 HD22 sing N N 297 LEU CD2 HD23 sing N N 298 LEU OXT HXT sing N N 299 LYS N CA sing N N 300 LYS N H sing N N 301 LYS N H2 sing N N 302 LYS CA C sing N N 303 LYS CA CB sing N N 304 LYS CA HA sing N N 305 LYS C O doub N N 306 LYS C OXT sing N N 307 LYS CB CG sing N N 308 LYS CB HB2 sing N N 309 LYS CB HB3 sing N N 310 LYS CG CD sing N N 311 LYS CG HG2 sing N N 312 LYS CG HG3 sing N N 313 LYS CD CE sing N N 314 LYS CD HD2 sing N N 315 LYS CD HD3 sing N N 316 LYS CE NZ sing N N 317 LYS CE HE2 sing N N 318 LYS CE HE3 sing N N 319 LYS NZ HZ1 sing N N 320 LYS NZ HZ2 sing N N 321 LYS NZ HZ3 sing N N 322 LYS OXT HXT sing N N 323 MET N CA sing N N 324 MET N H sing N N 325 MET N H2 sing N N 326 MET CA C sing N N 327 MET CA CB sing N N 328 MET CA HA sing N N 329 MET C O doub N N 330 MET C OXT sing N N 331 MET CB CG sing N N 332 MET CB HB2 sing N N 333 MET CB HB3 sing N N 334 MET CG SD sing N N 335 MET CG HG2 sing N N 336 MET CG HG3 sing N N 337 MET SD CE sing N N 338 MET CE HE1 sing N N 339 MET CE HE2 sing N N 340 MET CE HE3 sing N N 341 MET OXT HXT sing N N 342 NO N O doub N N 343 PHE N CA sing N N 344 PHE N H sing N N 345 PHE N H2 sing N N 346 PHE CA C sing N N 347 PHE CA CB sing N N 348 PHE CA HA sing N N 349 PHE C O doub N N 350 PHE C OXT sing N N 351 PHE CB CG sing N N 352 PHE CB HB2 sing N N 353 PHE CB HB3 sing N N 354 PHE CG CD1 doub Y N 355 PHE CG CD2 sing Y N 356 PHE CD1 CE1 sing Y N 357 PHE CD1 HD1 sing N N 358 PHE CD2 CE2 doub Y N 359 PHE CD2 HD2 sing N N 360 PHE CE1 CZ doub Y N 361 PHE CE1 HE1 sing N N 362 PHE CE2 CZ sing Y N 363 PHE CE2 HE2 sing N N 364 PHE CZ HZ sing N N 365 PHE OXT HXT sing N N 366 PRO N CA sing N N 367 PRO N CD sing N N 368 PRO N H sing N N 369 PRO CA C sing N N 370 PRO CA CB sing N N 371 PRO CA HA sing N N 372 PRO C O doub N N 373 PRO C OXT sing N N 374 PRO CB CG sing N N 375 PRO CB HB2 sing N N 376 PRO CB HB3 sing N N 377 PRO CG CD sing N N 378 PRO CG HG2 sing N N 379 PRO CG HG3 sing N N 380 PRO CD HD2 sing N N 381 PRO CD HD3 sing N N 382 PRO OXT HXT sing N N 383 SER N CA sing N N 384 SER N H sing N N 385 SER N H2 sing N N 386 SER CA C sing N N 387 SER CA CB sing N N 388 SER CA HA sing N N 389 SER C O doub N N 390 SER C OXT sing N N 391 SER CB OG sing N N 392 SER CB HB2 sing N N 393 SER CB HB3 sing N N 394 SER OG HG sing N N 395 SER OXT HXT sing N N 396 THR N CA sing N N 397 THR N H sing N N 398 THR N H2 sing N N 399 THR CA C sing N N 400 THR CA CB sing N N 401 THR CA HA sing N N 402 THR C O doub N N 403 THR C OXT sing N N 404 THR CB OG1 sing N N 405 THR CB CG2 sing N N 406 THR CB HB sing N N 407 THR OG1 HG1 sing N N 408 THR CG2 HG21 sing N N 409 THR CG2 HG22 sing N N 410 THR CG2 HG23 sing N N 411 THR OXT HXT sing N N 412 TRP N CA sing N N 413 TRP N H sing N N 414 TRP N H2 sing N N 415 TRP CA C sing N N 416 TRP CA CB sing N N 417 TRP CA HA sing N N 418 TRP C O doub N N 419 TRP C OXT sing N N 420 TRP CB CG sing N N 421 TRP CB HB2 sing N N 422 TRP CB HB3 sing N N 423 TRP CG CD1 doub Y N 424 TRP CG CD2 sing Y N 425 TRP CD1 NE1 sing Y N 426 TRP CD1 HD1 sing N N 427 TRP CD2 CE2 doub Y N 428 TRP CD2 CE3 sing Y N 429 TRP NE1 CE2 sing Y N 430 TRP NE1 HE1 sing N N 431 TRP CE2 CZ2 sing Y N 432 TRP CE3 CZ3 doub Y N 433 TRP CE3 HE3 sing N N 434 TRP CZ2 CH2 doub Y N 435 TRP CZ2 HZ2 sing N N 436 TRP CZ3 CH2 sing Y N 437 TRP CZ3 HZ3 sing N N 438 TRP CH2 HH2 sing N N 439 TRP OXT HXT sing N N 440 TYR N CA sing N N 441 TYR N H sing N N 442 TYR N H2 sing N N 443 TYR CA C sing N N 444 TYR CA CB sing N N 445 TYR CA HA sing N N 446 TYR C O doub N N 447 TYR C OXT sing N N 448 TYR CB CG sing N N 449 TYR CB HB2 sing N N 450 TYR CB HB3 sing N N 451 TYR CG CD1 doub Y N 452 TYR CG CD2 sing Y N 453 TYR CD1 CE1 sing Y N 454 TYR CD1 HD1 sing N N 455 TYR CD2 CE2 doub Y N 456 TYR CD2 HD2 sing N N 457 TYR CE1 CZ doub Y N 458 TYR CE1 HE1 sing N N 459 TYR CE2 CZ sing Y N 460 TYR CE2 HE2 sing N N 461 TYR CZ OH sing N N 462 TYR OH HH sing N N 463 TYR OXT HXT sing N N 464 VAL N CA sing N N 465 VAL N H sing N N 466 VAL N H2 sing N N 467 VAL CA C sing N N 468 VAL CA CB sing N N 469 VAL CA HA sing N N 470 VAL C O doub N N 471 VAL C OXT sing N N 472 VAL CB CG1 sing N N 473 VAL CB CG2 sing N N 474 VAL CB HB sing N N 475 VAL CG1 HG11 sing N N 476 VAL CG1 HG12 sing N N 477 VAL CG1 HG13 sing N N 478 VAL CG2 HG21 sing N N 479 VAL CG2 HG22 sing N N 480 VAL CG2 HG23 sing N N 481 VAL OXT HXT sing N N 482 # _pdbx_audit_support.funding_organization 'Japan Society for the Promotion of Science (JSPS)' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5B3I _pdbx_initial_refinement_model.details 'Native state' # _atom_sites.entry_id 8RKP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011952 _atom_sites.fract_transf_matrix[1][2] 0.006900 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013800 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011332 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ #