data_8RLZ # _entry.id 8RLZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RLZ pdb_00008rlz 10.2210/pdb8rlz/pdb WWPDB D_1292135664 ? ? BMRB 34890 ? 10.13018/BMR34890 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 8RLZ _pdbx_database_status.recvd_initial_deposition_date 2024-01-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR solution structure of the N-terminal cytoplasmic domain, DdvANt, of the membrane antisigma factor DdvA' _pdbx_database_related.db_id 34890 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email padhu@iqf.csic.es _pdbx_contact_author.name_first S. _pdbx_contact_author.name_last Padmanabhan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8772-0152 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pantoja-Uceda, D.' 1 0000-0003-4390-6972 'Padmanabhan, S.' 2 0000-0002-8772-0152 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first eadp1053 _citation.page_last eadp1053 _citation.title ;Structural basis for regulation of a CBASS-CRISPR-Cas defense island by a transmembrane anti-sigma factor and its ECF sigma partner. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.adp1053 _citation.pdbx_database_id_PubMed 39454004 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bernal-Bernal, D.' 1 0009-0000-6518-6297 primary 'Pantoja-Uceda, D.' 2 0000-0003-4390-6972 primary 'Lopez-Alonso, J.P.' 3 0000-0003-2081-2607 primary 'Lopez-Rojo, A.' 4 0009-0009-8960-8699 primary 'Lopez-Ruiz, J.A.' 5 ? primary 'Galbis-Martinez, M.' 6 0000-0003-1408-5298 primary 'Ochoa-Lizarralde, B.' 7 0000-0002-5532-0218 primary 'Tascon, I.' 8 0000-0003-2526-6238 primary 'Elias-Arnanz, M.' 9 0000-0003-1980-3092 primary 'Ubarretxena-Belandia, I.' 10 0000-0003-4082-4349 primary 'Padmanabhan, S.' 11 0000-0002-8772-0152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Antisigma factor DdvA' 10068.254 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Antisigma factor DdvA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSHHHHHHSSGLVPRGSHMMSSSPCDQLQSFADGDLPPMEAQAFGQHLADCEKCQVELTRLLQLDQLGRGYIERHGPVD IPWHALPRNR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSHHHHHHSSGLVPRGSHMMSSSPCDQLQSFADGDLPPMEAQAFGQHLADCEKCQVELTRLLQLDQLGRGYIERHGPVD IPWHALPRNR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 SER n 1 11 SER n 1 12 GLY n 1 13 LEU n 1 14 VAL n 1 15 PRO n 1 16 ARG n 1 17 GLY n 1 18 SER n 1 19 HIS n 1 20 MET n 1 21 MET n 1 22 SER n 1 23 SER n 1 24 SER n 1 25 PRO n 1 26 CYS n 1 27 ASP n 1 28 GLN n 1 29 LEU n 1 30 GLN n 1 31 SER n 1 32 PHE n 1 33 ALA n 1 34 ASP n 1 35 GLY n 1 36 ASP n 1 37 LEU n 1 38 PRO n 1 39 PRO n 1 40 MET n 1 41 GLU n 1 42 ALA n 1 43 GLN n 1 44 ALA n 1 45 PHE n 1 46 GLY n 1 47 GLN n 1 48 HIS n 1 49 LEU n 1 50 ALA n 1 51 ASP n 1 52 CYS n 1 53 GLU n 1 54 LYS n 1 55 CYS n 1 56 GLN n 1 57 VAL n 1 58 GLU n 1 59 LEU n 1 60 THR n 1 61 ARG n 1 62 LEU n 1 63 LEU n 1 64 GLN n 1 65 LEU n 1 66 ASP n 1 67 GLN n 1 68 LEU n 1 69 GLY n 1 70 ARG n 1 71 GLY n 1 72 TYR n 1 73 ILE n 1 74 GLU n 1 75 ARG n 1 76 HIS n 1 77 GLY n 1 78 PRO n 1 79 VAL n 1 80 ASP n 1 81 ILE n 1 82 PRO n 1 83 TRP n 1 84 HIS n 1 85 ALA n 1 86 LEU n 1 87 PRO n 1 88 ARG n 1 89 ASN n 1 90 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 90 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene I5Q59_35855 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain DK1050 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Myxococcus xanthus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -19 ? ? ? A . n A 1 2 SER 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 HIS 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 SER 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 GLY 12 -8 ? ? ? A . n A 1 13 LEU 13 -7 -7 LEU LEU A . n A 1 14 VAL 14 -6 -6 VAL VAL A . n A 1 15 PRO 15 -5 -5 PRO PRO A . n A 1 16 ARG 16 -4 -4 ARG ARG A . n A 1 17 GLY 17 -3 -3 GLY GLY A . n A 1 18 SER 18 -2 -2 SER SER A . n A 1 19 HIS 19 -1 -1 HIS HIS A . n A 1 20 MET 20 0 0 MET MET A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 SER 22 2 2 SER SER A . n A 1 23 SER 23 3 3 SER SER A . n A 1 24 SER 24 4 4 SER SER A . n A 1 25 PRO 25 5 5 PRO PRO A . n A 1 26 CYS 26 6 6 CYS CYS A . n A 1 27 ASP 27 7 7 ASP ASP A . n A 1 28 GLN 28 8 8 GLN GLN A . n A 1 29 LEU 29 9 9 LEU LEU A . n A 1 30 GLN 30 10 10 GLN GLN A . n A 1 31 SER 31 11 11 SER SER A . n A 1 32 PHE 32 12 12 PHE PHE A . n A 1 33 ALA 33 13 13 ALA ALA A . n A 1 34 ASP 34 14 14 ASP ASP A . n A 1 35 GLY 35 15 15 GLY GLY A . n A 1 36 ASP 36 16 16 ASP ASP A . n A 1 37 LEU 37 17 17 LEU LEU A . n A 1 38 PRO 38 18 18 PRO PRO A . n A 1 39 PRO 39 19 19 PRO PRO A . n A 1 40 MET 40 20 20 MET MET A . n A 1 41 GLU 41 21 21 GLU GLU A . n A 1 42 ALA 42 22 22 ALA ALA A . n A 1 43 GLN 43 23 23 GLN GLN A . n A 1 44 ALA 44 24 24 ALA ALA A . n A 1 45 PHE 45 25 25 PHE PHE A . n A 1 46 GLY 46 26 26 GLY GLY A . n A 1 47 GLN 47 27 27 GLN GLN A . n A 1 48 HIS 48 28 28 HIS HIS A . n A 1 49 LEU 49 29 29 LEU LEU A . n A 1 50 ALA 50 30 30 ALA ALA A . n A 1 51 ASP 51 31 31 ASP ASP A . n A 1 52 CYS 52 32 32 CYS CYS A . n A 1 53 GLU 53 33 33 GLU GLU A . n A 1 54 LYS 54 34 34 LYS LYS A . n A 1 55 CYS 55 35 35 CYS CYS A . n A 1 56 GLN 56 36 36 GLN GLN A . n A 1 57 VAL 57 37 37 VAL VAL A . n A 1 58 GLU 58 38 38 GLU GLU A . n A 1 59 LEU 59 39 39 LEU LEU A . n A 1 60 THR 60 40 40 THR THR A . n A 1 61 ARG 61 41 41 ARG ARG A . n A 1 62 LEU 62 42 42 LEU LEU A . n A 1 63 LEU 63 43 43 LEU LEU A . n A 1 64 GLN 64 44 44 GLN GLN A . n A 1 65 LEU 65 45 45 LEU LEU A . n A 1 66 ASP 66 46 46 ASP ASP A . n A 1 67 GLN 67 47 47 GLN GLN A . n A 1 68 LEU 68 48 48 LEU LEU A . n A 1 69 GLY 69 49 49 GLY GLY A . n A 1 70 ARG 70 50 50 ARG ARG A . n A 1 71 GLY 71 51 51 GLY GLY A . n A 1 72 TYR 72 52 52 TYR TYR A . n A 1 73 ILE 73 53 53 ILE ILE A . n A 1 74 GLU 74 54 54 GLU GLU A . n A 1 75 ARG 75 55 55 ARG ARG A . n A 1 76 HIS 76 56 56 HIS HIS A . n A 1 77 GLY 77 57 57 GLY GLY A . n A 1 78 PRO 78 58 58 PRO PRO A . n A 1 79 VAL 79 59 59 VAL VAL A . n A 1 80 ASP 80 60 60 ASP ASP A . n A 1 81 ILE 81 61 61 ILE ILE A . n A 1 82 PRO 82 62 62 PRO PRO A . n A 1 83 TRP 83 63 63 TRP TRP A . n A 1 84 HIS 84 64 64 HIS HIS A . n A 1 85 ALA 85 65 65 ALA ALA A . n A 1 86 LEU 86 66 66 LEU LEU A . n A 1 87 PRO 87 67 67 PRO PRO A . n A 1 88 ARG 88 68 68 ARG ARG A . n A 1 89 ASN 89 69 69 ASN ASN A . n A 1 90 ARG 90 70 70 ARG ARG A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 71 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RLZ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8RLZ _struct.title 'NMR solution structure of the N-terminal cytoplasmic domain, DdvANt, of the membrane antisigma factor DdvA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RLZ _struct_keywords.text 'Membrane antisigma, Zinc-associated antisigma domain, ECF sigma binding domain, Three-helix bundle, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A8E4SKQ1_MYXXA _struct_ref.pdbx_db_accession A0A8E4SKQ1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSSSPCDQLQSFADGDLPPMEAQAFGQHLADCEKCQVELTRLLQLDQLGRGYIERHGPVDIPWHALPRNR _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8RLZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A8E4SKQ1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8RLZ GLY A 1 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -19 1 1 8RLZ SER A 2 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -18 2 1 8RLZ SER A 3 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -17 3 1 8RLZ HIS A 4 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -16 4 1 8RLZ HIS A 5 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -15 5 1 8RLZ HIS A 6 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -14 6 1 8RLZ HIS A 7 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -13 7 1 8RLZ HIS A 8 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -12 8 1 8RLZ HIS A 9 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -11 9 1 8RLZ SER A 10 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -10 10 1 8RLZ SER A 11 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -9 11 1 8RLZ GLY A 12 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -8 12 1 8RLZ LEU A 13 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -7 13 1 8RLZ VAL A 14 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -6 14 1 8RLZ PRO A 15 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -5 15 1 8RLZ ARG A 16 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -4 16 1 8RLZ GLY A 17 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -3 17 1 8RLZ SER A 18 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -2 18 1 8RLZ HIS A 19 ? UNP A0A8E4SKQ1 ? ? 'expression tag' -1 19 1 8RLZ MET A 20 ? UNP A0A8E4SKQ1 ? ? 'expression tag' 0 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 24 ? GLY A 35 ? SER A 4 GLY A 15 1 ? 12 HELX_P HELX_P2 AA2 PRO A 38 ? PHE A 45 ? PRO A 18 PHE A 25 1 ? 8 HELX_P HELX_P3 AA3 GLY A 46 ? HIS A 48 ? GLY A 26 HIS A 28 5 ? 3 HELX_P HELX_P4 AA4 CYS A 52 ? GLN A 67 ? CYS A 32 GLN A 47 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 6 A ZN 101 1_555 ? ? ? ? ? ? ? 2.455 ? ? metalc2 metalc ? ? A HIS 48 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 101 1_555 ? ? ? ? ? ? ? 2.221 ? ? metalc3 metalc ? ? A CYS 52 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 101 1_555 ? ? ? ? ? ? ? 2.459 ? ? metalc4 metalc ? ? A CYS 55 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 35 A ZN 101 1_555 ? ? ? ? ? ? ? 2.380 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 26 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 48 ? A HIS 28 ? 1_555 92.8 ? 2 SG ? A CYS 26 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 52 ? A CYS 32 ? 1_555 101.8 ? 3 NE2 ? A HIS 48 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 52 ? A CYS 32 ? 1_555 135.1 ? 4 SG ? A CYS 26 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 55 ? A CYS 35 ? 1_555 90.6 ? 5 NE2 ? A HIS 48 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 55 ? A CYS 35 ? 1_555 116.3 ? 6 SG ? A CYS 52 ? A CYS 32 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 55 ? A CYS 35 ? 1_555 105.8 ? # _pdbx_entry_details.entry_id 8RLZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 31 ? ? -45.80 105.18 2 2 ALA A 30 ? ? -48.39 164.39 3 2 ASP A 31 ? ? -46.20 107.52 4 2 GLU A 54 ? ? -142.85 -54.43 5 3 ASP A 31 ? ? -28.64 100.20 6 3 HIS A 64 ? ? -66.72 10.07 7 4 ASP A 31 ? ? -47.26 105.68 8 4 LEU A 48 ? ? -59.09 106.92 9 5 ASP A 31 ? ? -46.38 102.63 10 5 ALA A 65 ? ? -104.61 77.26 11 6 VAL A -6 ? ? -114.75 69.19 12 6 ASP A 31 ? ? -47.02 102.90 13 6 TRP A 63 ? ? -135.39 -34.00 14 7 ALA A 30 ? ? -49.60 165.37 15 7 ASP A 31 ? ? -47.44 105.64 16 8 VAL A -6 ? ? 35.35 58.08 17 8 SER A -2 ? ? -65.18 85.64 18 8 ASP A 31 ? ? -41.76 102.19 19 8 LEU A 66 ? ? -150.92 66.42 20 9 ASP A 31 ? ? -27.95 103.20 21 10 MET A 1 ? ? -71.92 37.88 22 10 ASP A 31 ? ? -47.32 105.19 23 11 ASP A 31 ? ? -46.53 105.97 24 11 GLN A 47 ? ? -99.51 35.25 25 12 ASP A 31 ? ? -41.36 103.13 26 12 ALA A 65 ? ? -78.31 -169.48 27 13 VAL A -6 ? ? -159.78 77.75 28 13 ALA A 30 ? ? -48.83 165.04 29 13 ASP A 31 ? ? -46.46 108.10 30 14 SER A 3 ? ? -99.36 49.66 31 14 ASP A 31 ? ? -29.95 100.84 32 15 ALA A 30 ? ? -49.54 164.55 33 15 ASP A 31 ? ? -45.47 104.16 34 15 HIS A 64 ? ? -72.29 24.10 35 15 ARG A 68 ? ? -68.52 39.53 36 16 ASP A 31 ? ? -43.23 104.24 37 16 ARG A 55 ? ? -78.60 39.19 38 17 ASP A 31 ? ? -45.87 102.70 39 17 ILE A 53 ? ? -141.81 23.86 40 18 ARG A -4 ? ? -114.42 62.44 41 18 MET A 1 ? ? -62.44 85.41 42 18 ASP A 31 ? ? -46.89 106.60 43 19 ALA A 30 ? ? -49.10 165.18 44 19 ASP A 31 ? ? -43.03 105.07 45 20 SER A 2 ? ? -131.92 -34.37 46 20 SER A 3 ? ? -130.54 -60.75 47 20 ALA A 30 ? ? -46.58 150.05 48 20 ASP A 31 ? ? -37.15 104.17 49 20 ILE A 53 ? ? -53.04 108.20 50 20 HIS A 64 ? ? -73.06 23.58 51 20 ARG A 68 ? ? -119.15 70.63 # _pdbx_nmr_ensemble.entry_id 8RLZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8RLZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.7 mM [U-13C; U-15N] DdvANt, 100 mM sodium chloride, 20 mM Tris, 2 mM beta-mercaptoethanol, 0.05 % sodium azide, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C_15N_sample solution 'DdvANt sample for assignment' 2 '0.7 mM DdvANt, 100 mM sodium chloride, 20 mM Tris, 2 mM beta-mercaptoethanol, 0.05 % sodium azide, 90% H2O/10% D2O' '90% H2O/10% D2O' 1H_sample solution 'DdvANt sample for assignment and structure calculation' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 DdvANt 0.7 ? mM '[U-13C; U-15N]' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 Tris 20 ? mM 'natural abundance' 1 beta-mercaptoethanol 2 ? mM 'natural abundance' 1 'sodium azide' 0.05 ? % 'natural abundance' 2 DdvANt 0.7 ? mM 'natural abundance' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 Tris 20 ? mM 'natural abundance' 2 beta-mercaptoethanol 2 ? mM 'natural abundance' 2 'sodium azide' 0.05 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details 'DdvANt sample for assignment and structure calculation' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '2D 1H-13C HSQC' 1 isotropic 3 1 2 '3D HNCO' 1 isotropic 4 1 2 '3D HN(CA)CO' 1 isotropic 5 1 2 '3D HNCA' 1 isotropic 6 1 2 '3D HNCACB' 1 isotropic 7 1 2 '3D CBCA(CO)NH' 1 isotropic 8 1 2 '3D H(CCO)NH' 1 isotropic 9 1 2 '3D (H)CCCONH' 1 isotropic 10 1 2 '3D HNHA' 1 isotropic 11 1 2 '3D HBHA(CO)NH' 1 isotropic 12 1 2 '3D (H)N(COCA)NH' 1 isotropic 13 1 2 '3D H(MCOCA)NH' 1 isotropic 14 1 2 '2D NOESY' 1 isotropic 15 1 2 '2D TOCSY' 1 isotropic 16 1 2 '3D 1H-15N NOESY' 1 isotropic 17 1 2 '2D NOESY' 1 isotropic 18 1 2 '2D TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 8RLZ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing TopSpin ? 'Bruker Biospin' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'data analysis' NMRView ? 'Johnson, One Moon Scientific' 5 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 7 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 8 'peak picking' NMRView ? 'Johnson, One Moon Scientific' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -19 ? A GLY 1 2 1 Y 1 A SER -18 ? A SER 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A HIS -16 ? A HIS 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A SER -10 ? A SER 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A GLY -8 ? A GLY 12 13 2 Y 1 A GLY -19 ? A GLY 1 14 2 Y 1 A SER -18 ? A SER 2 15 2 Y 1 A SER -17 ? A SER 3 16 2 Y 1 A HIS -16 ? A HIS 4 17 2 Y 1 A HIS -15 ? A HIS 5 18 2 Y 1 A HIS -14 ? A HIS 6 19 2 Y 1 A HIS -13 ? A HIS 7 20 2 Y 1 A HIS -12 ? A HIS 8 21 2 Y 1 A HIS -11 ? A HIS 9 22 2 Y 1 A SER -10 ? A SER 10 23 2 Y 1 A SER -9 ? A SER 11 24 2 Y 1 A GLY -8 ? A GLY 12 25 3 Y 1 A GLY -19 ? A GLY 1 26 3 Y 1 A SER -18 ? A SER 2 27 3 Y 1 A SER -17 ? A SER 3 28 3 Y 1 A HIS -16 ? A HIS 4 29 3 Y 1 A HIS -15 ? A HIS 5 30 3 Y 1 A HIS -14 ? A HIS 6 31 3 Y 1 A HIS -13 ? A HIS 7 32 3 Y 1 A HIS -12 ? A HIS 8 33 3 Y 1 A HIS -11 ? A HIS 9 34 3 Y 1 A SER -10 ? A SER 10 35 3 Y 1 A SER -9 ? A SER 11 36 3 Y 1 A GLY -8 ? A GLY 12 37 4 Y 1 A GLY -19 ? A GLY 1 38 4 Y 1 A SER -18 ? A SER 2 39 4 Y 1 A SER -17 ? A SER 3 40 4 Y 1 A HIS -16 ? A HIS 4 41 4 Y 1 A HIS -15 ? A HIS 5 42 4 Y 1 A HIS -14 ? A HIS 6 43 4 Y 1 A HIS -13 ? A HIS 7 44 4 Y 1 A HIS -12 ? A HIS 8 45 4 Y 1 A HIS -11 ? A HIS 9 46 4 Y 1 A SER -10 ? A SER 10 47 4 Y 1 A SER -9 ? A SER 11 48 4 Y 1 A GLY -8 ? A GLY 12 49 5 Y 1 A GLY -19 ? A GLY 1 50 5 Y 1 A SER -18 ? A SER 2 51 5 Y 1 A SER -17 ? A SER 3 52 5 Y 1 A HIS -16 ? A HIS 4 53 5 Y 1 A HIS -15 ? A HIS 5 54 5 Y 1 A HIS -14 ? A HIS 6 55 5 Y 1 A HIS -13 ? A HIS 7 56 5 Y 1 A HIS -12 ? A HIS 8 57 5 Y 1 A HIS -11 ? A HIS 9 58 5 Y 1 A SER -10 ? A SER 10 59 5 Y 1 A SER -9 ? A SER 11 60 5 Y 1 A GLY -8 ? A GLY 12 61 6 Y 1 A GLY -19 ? A GLY 1 62 6 Y 1 A SER -18 ? A SER 2 63 6 Y 1 A SER -17 ? A SER 3 64 6 Y 1 A HIS -16 ? A HIS 4 65 6 Y 1 A HIS -15 ? A HIS 5 66 6 Y 1 A HIS -14 ? A HIS 6 67 6 Y 1 A HIS -13 ? A HIS 7 68 6 Y 1 A HIS -12 ? A HIS 8 69 6 Y 1 A HIS -11 ? A HIS 9 70 6 Y 1 A SER -10 ? A SER 10 71 6 Y 1 A SER -9 ? A SER 11 72 6 Y 1 A GLY -8 ? A GLY 12 73 7 Y 1 A GLY -19 ? A GLY 1 74 7 Y 1 A SER -18 ? A SER 2 75 7 Y 1 A SER -17 ? A SER 3 76 7 Y 1 A HIS -16 ? A HIS 4 77 7 Y 1 A HIS -15 ? A HIS 5 78 7 Y 1 A HIS -14 ? A HIS 6 79 7 Y 1 A HIS -13 ? A HIS 7 80 7 Y 1 A HIS -12 ? A HIS 8 81 7 Y 1 A HIS -11 ? A HIS 9 82 7 Y 1 A SER -10 ? A SER 10 83 7 Y 1 A SER -9 ? A SER 11 84 7 Y 1 A GLY -8 ? A GLY 12 85 8 Y 1 A GLY -19 ? A GLY 1 86 8 Y 1 A SER -18 ? A SER 2 87 8 Y 1 A SER -17 ? A SER 3 88 8 Y 1 A HIS -16 ? A HIS 4 89 8 Y 1 A HIS -15 ? A HIS 5 90 8 Y 1 A HIS -14 ? A HIS 6 91 8 Y 1 A HIS -13 ? A HIS 7 92 8 Y 1 A HIS -12 ? A HIS 8 93 8 Y 1 A HIS -11 ? A HIS 9 94 8 Y 1 A SER -10 ? A SER 10 95 8 Y 1 A SER -9 ? A SER 11 96 8 Y 1 A GLY -8 ? A GLY 12 97 9 Y 1 A GLY -19 ? A GLY 1 98 9 Y 1 A SER -18 ? A SER 2 99 9 Y 1 A SER -17 ? A SER 3 100 9 Y 1 A HIS -16 ? A HIS 4 101 9 Y 1 A HIS -15 ? A HIS 5 102 9 Y 1 A HIS -14 ? A HIS 6 103 9 Y 1 A HIS -13 ? A HIS 7 104 9 Y 1 A HIS -12 ? A HIS 8 105 9 Y 1 A HIS -11 ? A HIS 9 106 9 Y 1 A SER -10 ? A SER 10 107 9 Y 1 A SER -9 ? A SER 11 108 9 Y 1 A GLY -8 ? A GLY 12 109 10 Y 1 A GLY -19 ? A GLY 1 110 10 Y 1 A SER -18 ? A SER 2 111 10 Y 1 A SER -17 ? A SER 3 112 10 Y 1 A HIS -16 ? A HIS 4 113 10 Y 1 A HIS -15 ? A HIS 5 114 10 Y 1 A HIS -14 ? A HIS 6 115 10 Y 1 A HIS -13 ? A HIS 7 116 10 Y 1 A HIS -12 ? A HIS 8 117 10 Y 1 A HIS -11 ? A HIS 9 118 10 Y 1 A SER -10 ? A SER 10 119 10 Y 1 A SER -9 ? A SER 11 120 10 Y 1 A GLY -8 ? A GLY 12 121 11 Y 1 A GLY -19 ? A GLY 1 122 11 Y 1 A SER -18 ? A SER 2 123 11 Y 1 A SER -17 ? A SER 3 124 11 Y 1 A HIS -16 ? A HIS 4 125 11 Y 1 A HIS -15 ? A HIS 5 126 11 Y 1 A HIS -14 ? A HIS 6 127 11 Y 1 A HIS -13 ? A HIS 7 128 11 Y 1 A HIS -12 ? A HIS 8 129 11 Y 1 A HIS -11 ? A HIS 9 130 11 Y 1 A SER -10 ? A SER 10 131 11 Y 1 A SER -9 ? A SER 11 132 11 Y 1 A GLY -8 ? A GLY 12 133 12 Y 1 A GLY -19 ? A GLY 1 134 12 Y 1 A SER -18 ? A SER 2 135 12 Y 1 A SER -17 ? A SER 3 136 12 Y 1 A HIS -16 ? A HIS 4 137 12 Y 1 A HIS -15 ? A HIS 5 138 12 Y 1 A HIS -14 ? A HIS 6 139 12 Y 1 A HIS -13 ? A HIS 7 140 12 Y 1 A HIS -12 ? A HIS 8 141 12 Y 1 A HIS -11 ? A HIS 9 142 12 Y 1 A SER -10 ? A SER 10 143 12 Y 1 A SER -9 ? A SER 11 144 12 Y 1 A GLY -8 ? A GLY 12 145 13 Y 1 A GLY -19 ? A GLY 1 146 13 Y 1 A SER -18 ? A SER 2 147 13 Y 1 A SER -17 ? A SER 3 148 13 Y 1 A HIS -16 ? A HIS 4 149 13 Y 1 A HIS -15 ? A HIS 5 150 13 Y 1 A HIS -14 ? A HIS 6 151 13 Y 1 A HIS -13 ? A HIS 7 152 13 Y 1 A HIS -12 ? A HIS 8 153 13 Y 1 A HIS -11 ? A HIS 9 154 13 Y 1 A SER -10 ? A SER 10 155 13 Y 1 A SER -9 ? A SER 11 156 13 Y 1 A GLY -8 ? A GLY 12 157 14 Y 1 A GLY -19 ? A GLY 1 158 14 Y 1 A SER -18 ? A SER 2 159 14 Y 1 A SER -17 ? A SER 3 160 14 Y 1 A HIS -16 ? A HIS 4 161 14 Y 1 A HIS -15 ? A HIS 5 162 14 Y 1 A HIS -14 ? A HIS 6 163 14 Y 1 A HIS -13 ? A HIS 7 164 14 Y 1 A HIS -12 ? A HIS 8 165 14 Y 1 A HIS -11 ? A HIS 9 166 14 Y 1 A SER -10 ? A SER 10 167 14 Y 1 A SER -9 ? A SER 11 168 14 Y 1 A GLY -8 ? A GLY 12 169 15 Y 1 A GLY -19 ? A GLY 1 170 15 Y 1 A SER -18 ? A SER 2 171 15 Y 1 A SER -17 ? A SER 3 172 15 Y 1 A HIS -16 ? A HIS 4 173 15 Y 1 A HIS -15 ? A HIS 5 174 15 Y 1 A HIS -14 ? A HIS 6 175 15 Y 1 A HIS -13 ? A HIS 7 176 15 Y 1 A HIS -12 ? A HIS 8 177 15 Y 1 A HIS -11 ? A HIS 9 178 15 Y 1 A SER -10 ? A SER 10 179 15 Y 1 A SER -9 ? A SER 11 180 15 Y 1 A GLY -8 ? A GLY 12 181 16 Y 1 A GLY -19 ? A GLY 1 182 16 Y 1 A SER -18 ? A SER 2 183 16 Y 1 A SER -17 ? A SER 3 184 16 Y 1 A HIS -16 ? A HIS 4 185 16 Y 1 A HIS -15 ? A HIS 5 186 16 Y 1 A HIS -14 ? A HIS 6 187 16 Y 1 A HIS -13 ? A HIS 7 188 16 Y 1 A HIS -12 ? A HIS 8 189 16 Y 1 A HIS -11 ? A HIS 9 190 16 Y 1 A SER -10 ? A SER 10 191 16 Y 1 A SER -9 ? A SER 11 192 16 Y 1 A GLY -8 ? A GLY 12 193 17 Y 1 A GLY -19 ? A GLY 1 194 17 Y 1 A SER -18 ? A SER 2 195 17 Y 1 A SER -17 ? A SER 3 196 17 Y 1 A HIS -16 ? A HIS 4 197 17 Y 1 A HIS -15 ? A HIS 5 198 17 Y 1 A HIS -14 ? A HIS 6 199 17 Y 1 A HIS -13 ? A HIS 7 200 17 Y 1 A HIS -12 ? A HIS 8 201 17 Y 1 A HIS -11 ? A HIS 9 202 17 Y 1 A SER -10 ? A SER 10 203 17 Y 1 A SER -9 ? A SER 11 204 17 Y 1 A GLY -8 ? A GLY 12 205 18 Y 1 A GLY -19 ? A GLY 1 206 18 Y 1 A SER -18 ? A SER 2 207 18 Y 1 A SER -17 ? A SER 3 208 18 Y 1 A HIS -16 ? A HIS 4 209 18 Y 1 A HIS -15 ? A HIS 5 210 18 Y 1 A HIS -14 ? A HIS 6 211 18 Y 1 A HIS -13 ? A HIS 7 212 18 Y 1 A HIS -12 ? A HIS 8 213 18 Y 1 A HIS -11 ? A HIS 9 214 18 Y 1 A SER -10 ? A SER 10 215 18 Y 1 A SER -9 ? A SER 11 216 18 Y 1 A GLY -8 ? A GLY 12 217 19 Y 1 A GLY -19 ? A GLY 1 218 19 Y 1 A SER -18 ? A SER 2 219 19 Y 1 A SER -17 ? A SER 3 220 19 Y 1 A HIS -16 ? A HIS 4 221 19 Y 1 A HIS -15 ? A HIS 5 222 19 Y 1 A HIS -14 ? A HIS 6 223 19 Y 1 A HIS -13 ? A HIS 7 224 19 Y 1 A HIS -12 ? A HIS 8 225 19 Y 1 A HIS -11 ? A HIS 9 226 19 Y 1 A SER -10 ? A SER 10 227 19 Y 1 A SER -9 ? A SER 11 228 19 Y 1 A GLY -8 ? A GLY 12 229 20 Y 1 A GLY -19 ? A GLY 1 230 20 Y 1 A SER -18 ? A SER 2 231 20 Y 1 A SER -17 ? A SER 3 232 20 Y 1 A HIS -16 ? A HIS 4 233 20 Y 1 A HIS -15 ? A HIS 5 234 20 Y 1 A HIS -14 ? A HIS 6 235 20 Y 1 A HIS -13 ? A HIS 7 236 20 Y 1 A HIS -12 ? A HIS 8 237 20 Y 1 A HIS -11 ? A HIS 9 238 20 Y 1 A SER -10 ? A SER 10 239 20 Y 1 A SER -9 ? A SER 11 240 20 Y 1 A GLY -8 ? A GLY 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministerio de Ciencia e Innovacion (MCIN)' Spain PID2021-123336NB-C22 1 'Ministerio de Ciencia e Innovacion (MCIN)' Spain PID2021-123336NB-C21 2 'Ministerio de Ciencia e Innovacion (MCIN)' Spain PID2020-112821GB-I00 3 'Other government' ? 'ICTS R-LRB' 4 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 8RLZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ #