data_8RQ1 # _entry.id 8RQ1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RQ1 pdb_00008rq1 10.2210/pdb8rq1/pdb WWPDB D_1292135907 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-25 2 'Structure model' 1 1 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_entry_details # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8RQ1 _pdbx_database_status.recvd_initial_deposition_date 2024-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email a.ciulli@dundee.ac.uk _pdbx_contact_author.name_first Alessio _pdbx_contact_author.name_last Ciulli _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8654-1670 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kroupova, A.' 1 0000-0003-4166-1270 'Zollman, D.' 2 0000-0002-7613-2013 'Ciulli, A.' 3 0000-0002-8654-1670 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 8885 _citation.page_last 8885 _citation.title 'Design of a Cereblon construct for crystallographic and biophysical studies of protein degraders.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-024-52871-9 _citation.pdbx_database_id_PubMed 39406745 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kroupova, A.' 1 0000-0003-4166-1270 primary 'Spiteri, V.A.' 2 ? primary 'Rutter, Z.J.' 3 ? primary 'Furihata, H.' 4 ? primary 'Darren, D.' 5 0009-0007-7012-3486 primary 'Ramachandran, S.' 6 0000-0002-0922-9448 primary 'Chakraborti, S.' 7 0000-0002-4591-2658 primary 'Haubrich, K.' 8 0000-0001-5025-3821 primary 'Pethe, J.' 9 ? primary 'Gonzales, D.' 10 ? primary 'Wijaya, A.J.' 11 ? primary 'Rodriguez-Rios, M.' 12 0000-0003-2434-1603 primary 'Sturbaut, M.' 13 0000-0002-4026-2211 primary 'Lynch, D.M.' 14 0000-0001-6245-9704 primary 'Farnaby, W.' 15 0000-0001-8610-932X primary 'Nakasone, M.A.' 16 0000-0002-1362-191X primary 'Zollman, D.' 17 0000-0002-7613-2013 primary 'Ciulli, A.' 18 0000-0002-8654-1670 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein cereblon' 37478.805 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSIQVIPVLPQVMMILVPGQTLPLQLFHPQEVSMVRNLIQNDRT FAVLAYSNVQEREAEFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPEGSGDAETLMDRI KKQLREWDENLKDDSLPSNPIDFSYWVAANLPIDDSLRIQLLKIDSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEI FSLSREGPMAAYVNPHGYVHEILTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGL TRSALIPTI ; _entity_poly.pdbx_seq_one_letter_code_can ;SAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSIQVIPVLPQVMMILVPGQTLPLQLFHPQEVSMVRNLIQNDRT FAVLAYSNVQEREAEFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPEGSGDAETLMDRI KKQLREWDENLKDDSLPSNPIDFSYWVAANLPIDDSLRIQLLKIDSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEI FSLSREGPMAAYVNPHGYVHEILTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGL TRSALIPTI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 LYS n 1 4 LYS n 1 5 PRO n 1 6 ASN n 1 7 ILE n 1 8 ILE n 1 9 ASN n 1 10 PHE n 1 11 ASP n 1 12 THR n 1 13 SER n 1 14 LEU n 1 15 PRO n 1 16 THR n 1 17 SER n 1 18 HIS n 1 19 THR n 1 20 TYR n 1 21 LEU n 1 22 GLY n 1 23 ALA n 1 24 ASP n 1 25 MET n 1 26 GLU n 1 27 GLU n 1 28 PHE n 1 29 HIS n 1 30 GLY n 1 31 ARG n 1 32 THR n 1 33 LEU n 1 34 HIS n 1 35 ASP n 1 36 ASP n 1 37 ASP n 1 38 SER n 1 39 ILE n 1 40 GLN n 1 41 VAL n 1 42 ILE n 1 43 PRO n 1 44 VAL n 1 45 LEU n 1 46 PRO n 1 47 GLN n 1 48 VAL n 1 49 MET n 1 50 MET n 1 51 ILE n 1 52 LEU n 1 53 VAL n 1 54 PRO n 1 55 GLY n 1 56 GLN n 1 57 THR n 1 58 LEU n 1 59 PRO n 1 60 LEU n 1 61 GLN n 1 62 LEU n 1 63 PHE n 1 64 HIS n 1 65 PRO n 1 66 GLN n 1 67 GLU n 1 68 VAL n 1 69 SER n 1 70 MET n 1 71 VAL n 1 72 ARG n 1 73 ASN n 1 74 LEU n 1 75 ILE n 1 76 GLN n 1 77 ASN n 1 78 ASP n 1 79 ARG n 1 80 THR n 1 81 PHE n 1 82 ALA n 1 83 VAL n 1 84 LEU n 1 85 ALA n 1 86 TYR n 1 87 SER n 1 88 ASN n 1 89 VAL n 1 90 GLN n 1 91 GLU n 1 92 ARG n 1 93 GLU n 1 94 ALA n 1 95 GLU n 1 96 PHE n 1 97 GLY n 1 98 THR n 1 99 THR n 1 100 ALA n 1 101 GLU n 1 102 ILE n 1 103 TYR n 1 104 ALA n 1 105 TYR n 1 106 ARG n 1 107 GLU n 1 108 GLU n 1 109 GLN n 1 110 ASP n 1 111 PHE n 1 112 GLY n 1 113 ILE n 1 114 GLU n 1 115 ILE n 1 116 VAL n 1 117 LYS n 1 118 VAL n 1 119 LYS n 1 120 ALA n 1 121 ILE n 1 122 GLY n 1 123 ARG n 1 124 GLN n 1 125 ARG n 1 126 PHE n 1 127 LYS n 1 128 VAL n 1 129 LEU n 1 130 GLU n 1 131 LEU n 1 132 ARG n 1 133 THR n 1 134 GLN n 1 135 SER n 1 136 ASP n 1 137 GLY n 1 138 ILE n 1 139 GLN n 1 140 GLN n 1 141 ALA n 1 142 LYS n 1 143 VAL n 1 144 GLN n 1 145 ILE n 1 146 LEU n 1 147 PRO n 1 148 GLU n 1 149 GLY n 1 150 SER n 1 151 GLY n 1 152 ASP n 1 153 ALA n 1 154 GLU n 1 155 THR n 1 156 LEU n 1 157 MET n 1 158 ASP n 1 159 ARG n 1 160 ILE n 1 161 LYS n 1 162 LYS n 1 163 GLN n 1 164 LEU n 1 165 ARG n 1 166 GLU n 1 167 TRP n 1 168 ASP n 1 169 GLU n 1 170 ASN n 1 171 LEU n 1 172 LYS n 1 173 ASP n 1 174 ASP n 1 175 SER n 1 176 LEU n 1 177 PRO n 1 178 SER n 1 179 ASN n 1 180 PRO n 1 181 ILE n 1 182 ASP n 1 183 PHE n 1 184 SER n 1 185 TYR n 1 186 TRP n 1 187 VAL n 1 188 ALA n 1 189 ALA n 1 190 ASN n 1 191 LEU n 1 192 PRO n 1 193 ILE n 1 194 ASP n 1 195 ASP n 1 196 SER n 1 197 LEU n 1 198 ARG n 1 199 ILE n 1 200 GLN n 1 201 LEU n 1 202 LEU n 1 203 LYS n 1 204 ILE n 1 205 ASP n 1 206 SER n 1 207 ALA n 1 208 ILE n 1 209 GLN n 1 210 ARG n 1 211 LEU n 1 212 ARG n 1 213 CYS n 1 214 GLU n 1 215 LEU n 1 216 ASP n 1 217 ILE n 1 218 MET n 1 219 ASN n 1 220 LYS n 1 221 CYS n 1 222 THR n 1 223 SER n 1 224 LEU n 1 225 CYS n 1 226 CYS n 1 227 LYS n 1 228 GLN n 1 229 CYS n 1 230 GLN n 1 231 GLU n 1 232 THR n 1 233 GLU n 1 234 ILE n 1 235 THR n 1 236 THR n 1 237 LYS n 1 238 ASN n 1 239 GLU n 1 240 ILE n 1 241 PHE n 1 242 SER n 1 243 LEU n 1 244 SER n 1 245 ARG n 1 246 GLU n 1 247 GLY n 1 248 PRO n 1 249 MET n 1 250 ALA n 1 251 ALA n 1 252 TYR n 1 253 VAL n 1 254 ASN n 1 255 PRO n 1 256 HIS n 1 257 GLY n 1 258 TYR n 1 259 VAL n 1 260 HIS n 1 261 GLU n 1 262 ILE n 1 263 LEU n 1 264 THR n 1 265 VAL n 1 266 TYR n 1 267 LYS n 1 268 ALA n 1 269 CYS n 1 270 ASN n 1 271 LEU n 1 272 ASN n 1 273 LEU n 1 274 ILE n 1 275 GLY n 1 276 ARG n 1 277 PRO n 1 278 SER n 1 279 THR n 1 280 GLU n 1 281 HIS n 1 282 SER n 1 283 TRP n 1 284 PHE n 1 285 PRO n 1 286 GLY n 1 287 TYR n 1 288 ALA n 1 289 TRP n 1 290 THR n 1 291 VAL n 1 292 ALA n 1 293 GLN n 1 294 CYS n 1 295 LYS n 1 296 ILE n 1 297 CYS n 1 298 ALA n 1 299 SER n 1 300 HIS n 1 301 ILE n 1 302 GLY n 1 303 TRP n 1 304 LYS n 1 305 PHE n 1 306 THR n 1 307 ALA n 1 308 THR n 1 309 LYS n 1 310 LYS n 1 311 ASP n 1 312 MET n 1 313 SER n 1 314 PRO n 1 315 GLN n 1 316 LYS n 1 317 PHE n 1 318 TRP n 1 319 GLY n 1 320 LEU n 1 321 THR n 1 322 ARG n 1 323 SER n 1 324 ALA n 1 325 LEU n 1 326 ILE n 1 327 PRO n 1 328 THR n 1 329 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 151 human ? 'CRBN, AD-006' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 152 329 human ? 'CRBN, AD-006' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 40 ? ? ? A . n A 1 2 ALA 2 41 ? ? ? A . n A 1 3 LYS 3 42 ? ? ? A . n A 1 4 LYS 4 43 ? ? ? A . n A 1 5 PRO 5 44 ? ? ? A . n A 1 6 ASN 6 45 ? ? ? A . n A 1 7 ILE 7 46 ? ? ? A . n A 1 8 ILE 8 47 ? ? ? A . n A 1 9 ASN 9 48 ? ? ? A . n A 1 10 PHE 10 49 ? ? ? A . n A 1 11 ASP 11 50 ? ? ? A . n A 1 12 THR 12 51 ? ? ? A . n A 1 13 SER 13 52 ? ? ? A . n A 1 14 LEU 14 53 ? ? ? A . n A 1 15 PRO 15 54 ? ? ? A . n A 1 16 THR 16 55 ? ? ? A . n A 1 17 SER 17 56 ? ? ? A . n A 1 18 HIS 18 57 ? ? ? A . n A 1 19 THR 19 58 ? ? ? A . n A 1 20 TYR 20 59 ? ? ? A . n A 1 21 LEU 21 60 ? ? ? A . n A 1 22 GLY 22 61 ? ? ? A . n A 1 23 ALA 23 62 ? ? ? A . n A 1 24 ASP 24 63 ? ? ? A . n A 1 25 MET 25 64 ? ? ? A . n A 1 26 GLU 26 65 ? ? ? A . n A 1 27 GLU 27 66 ? ? ? A . n A 1 28 PHE 28 67 ? ? ? A . n A 1 29 HIS 29 68 ? ? ? A . n A 1 30 GLY 30 69 ? ? ? A . n A 1 31 ARG 31 70 ? ? ? A . n A 1 32 THR 32 71 ? ? ? A . n A 1 33 LEU 33 72 72 LEU LEU A . n A 1 34 HIS 34 73 73 HIS HIS A . n A 1 35 ASP 35 74 74 ASP ASP A . n A 1 36 ASP 36 75 75 ASP ASP A . n A 1 37 ASP 37 76 76 ASP ASP A . n A 1 38 SER 38 77 77 SER SER A . n A 1 39 ILE 39 78 78 ILE ILE A . n A 1 40 GLN 40 79 79 GLN GLN A . n A 1 41 VAL 41 80 80 VAL VAL A . n A 1 42 ILE 42 81 81 ILE ILE A . n A 1 43 PRO 43 82 82 PRO PRO A . n A 1 44 VAL 44 83 83 VAL VAL A . n A 1 45 LEU 45 84 84 LEU LEU A . n A 1 46 PRO 46 85 85 PRO PRO A . n A 1 47 GLN 47 86 86 GLN GLN A . n A 1 48 VAL 48 87 87 VAL VAL A . n A 1 49 MET 49 88 88 MET MET A . n A 1 50 MET 50 89 89 MET MET A . n A 1 51 ILE 51 90 90 ILE ILE A . n A 1 52 LEU 52 91 91 LEU LEU A . n A 1 53 VAL 53 92 92 VAL VAL A . n A 1 54 PRO 54 93 93 PRO PRO A . n A 1 55 GLY 55 94 94 GLY GLY A . n A 1 56 GLN 56 95 95 GLN GLN A . n A 1 57 THR 57 96 96 THR THR A . n A 1 58 LEU 58 97 97 LEU LEU A . n A 1 59 PRO 59 98 98 PRO PRO A . n A 1 60 LEU 60 99 99 LEU LEU A . n A 1 61 GLN 61 100 100 GLN GLN A . n A 1 62 LEU 62 101 101 LEU LEU A . n A 1 63 PHE 63 102 102 PHE PHE A . n A 1 64 HIS 64 103 103 HIS HIS A . n A 1 65 PRO 65 104 104 PRO PRO A . n A 1 66 GLN 66 105 105 GLN GLN A . n A 1 67 GLU 67 106 106 GLU GLU A . n A 1 68 VAL 68 107 107 VAL VAL A . n A 1 69 SER 69 108 108 SER SER A . n A 1 70 MET 70 109 109 MET MET A . n A 1 71 VAL 71 110 110 VAL VAL A . n A 1 72 ARG 72 111 111 ARG ARG A . n A 1 73 ASN 73 112 112 ASN ASN A . n A 1 74 LEU 74 113 113 LEU LEU A . n A 1 75 ILE 75 114 114 ILE ILE A . n A 1 76 GLN 76 115 115 GLN GLN A . n A 1 77 ASN 77 116 116 ASN ASN A . n A 1 78 ASP 78 117 117 ASP ASP A . n A 1 79 ARG 79 118 118 ARG ARG A . n A 1 80 THR 80 119 119 THR THR A . n A 1 81 PHE 81 120 120 PHE PHE A . n A 1 82 ALA 82 121 121 ALA ALA A . n A 1 83 VAL 83 122 122 VAL VAL A . n A 1 84 LEU 84 123 123 LEU LEU A . n A 1 85 ALA 85 124 124 ALA ALA A . n A 1 86 TYR 86 125 125 TYR TYR A . n A 1 87 SER 87 126 126 SER SER A . n A 1 88 ASN 88 127 127 ASN ASN A . n A 1 89 VAL 89 128 128 VAL VAL A . n A 1 90 GLN 90 129 129 GLN GLN A . n A 1 91 GLU 91 130 130 GLU GLU A . n A 1 92 ARG 92 131 131 ARG ARG A . n A 1 93 GLU 93 132 132 GLU GLU A . n A 1 94 ALA 94 133 133 ALA ALA A . n A 1 95 GLU 95 134 134 GLU GLU A . n A 1 96 PHE 96 135 135 PHE PHE A . n A 1 97 GLY 97 136 136 GLY GLY A . n A 1 98 THR 98 137 137 THR THR A . n A 1 99 THR 99 138 138 THR THR A . n A 1 100 ALA 100 139 139 ALA ALA A . n A 1 101 GLU 101 140 140 GLU GLU A . n A 1 102 ILE 102 141 141 ILE ILE A . n A 1 103 TYR 103 142 142 TYR TYR A . n A 1 104 ALA 104 143 143 ALA ALA A . n A 1 105 TYR 105 144 144 TYR TYR A . n A 1 106 ARG 106 145 145 ARG ARG A . n A 1 107 GLU 107 146 146 GLU GLU A . n A 1 108 GLU 108 147 147 GLU GLU A . n A 1 109 GLN 109 148 148 GLN GLN A . n A 1 110 ASP 110 149 149 ASP ASP A . n A 1 111 PHE 111 150 150 PHE PHE A . n A 1 112 GLY 112 151 151 GLY GLY A . n A 1 113 ILE 113 152 152 ILE ILE A . n A 1 114 GLU 114 153 153 GLU GLU A . n A 1 115 ILE 115 154 154 ILE ILE A . n A 1 116 VAL 116 155 155 VAL VAL A . n A 1 117 LYS 117 156 156 LYS LYS A . n A 1 118 VAL 118 157 157 VAL VAL A . n A 1 119 LYS 119 158 158 LYS LYS A . n A 1 120 ALA 120 159 159 ALA ALA A . n A 1 121 ILE 121 160 160 ILE ILE A . n A 1 122 GLY 122 161 161 GLY GLY A . n A 1 123 ARG 123 162 162 ARG ARG A . n A 1 124 GLN 124 163 163 GLN GLN A . n A 1 125 ARG 125 164 164 ARG ARG A . n A 1 126 PHE 126 165 165 PHE PHE A . n A 1 127 LYS 127 166 166 LYS LYS A . n A 1 128 VAL 128 167 167 VAL VAL A . n A 1 129 LEU 129 168 168 LEU LEU A . n A 1 130 GLU 130 169 169 GLU GLU A . n A 1 131 LEU 131 170 170 LEU LEU A . n A 1 132 ARG 132 171 171 ARG ARG A . n A 1 133 THR 133 172 172 THR THR A . n A 1 134 GLN 134 173 173 GLN GLN A . n A 1 135 SER 135 174 174 SER SER A . n A 1 136 ASP 136 175 175 ASP ASP A . n A 1 137 GLY 137 176 176 GLY GLY A . n A 1 138 ILE 138 177 177 ILE ILE A . n A 1 139 GLN 139 178 178 GLN GLN A . n A 1 140 GLN 140 179 179 GLN GLN A . n A 1 141 ALA 141 180 180 ALA ALA A . n A 1 142 LYS 142 181 181 LYS LYS A . n A 1 143 VAL 143 182 182 VAL VAL A . n A 1 144 GLN 144 183 183 GLN GLN A . n A 1 145 ILE 145 184 184 ILE ILE A . n A 1 146 LEU 146 185 185 LEU LEU A . n A 1 147 PRO 147 186 186 PRO PRO A . n A 1 148 GLU 148 187 187 GLU GLU A . n A 1 149 GLY 149 188 ? ? ? A . n A 1 150 SER 150 189 ? ? ? A . n A 1 151 GLY 151 190 ? ? ? A . n A 1 152 ASP 152 249 ? ? ? A . n A 1 153 ALA 153 250 250 ALA ALA A . n A 1 154 GLU 154 251 251 GLU GLU A . n A 1 155 THR 155 252 252 THR THR A . n A 1 156 LEU 156 253 253 LEU LEU A . n A 1 157 MET 157 254 254 MET MET A . n A 1 158 ASP 158 255 255 ASP ASP A . n A 1 159 ARG 159 256 256 ARG ARG A . n A 1 160 ILE 160 257 257 ILE ILE A . n A 1 161 LYS 161 258 258 LYS LYS A . n A 1 162 LYS 162 259 259 LYS LYS A . n A 1 163 GLN 163 260 260 GLN GLN A . n A 1 164 LEU 164 261 261 LEU LEU A . n A 1 165 ARG 165 262 262 ARG ARG A . n A 1 166 GLU 166 263 263 GLU GLU A . n A 1 167 TRP 167 264 264 TRP TRP A . n A 1 168 ASP 168 265 265 ASP ASP A . n A 1 169 GLU 169 266 266 GLU GLU A . n A 1 170 ASN 170 267 267 ASN ASN A . n A 1 171 LEU 171 268 268 LEU LEU A . n A 1 172 LYS 172 269 ? ? ? A . n A 1 173 ASP 173 270 ? ? ? A . n A 1 174 ASP 174 271 271 ASP ASP A . n A 1 175 SER 175 272 272 SER SER A . n A 1 176 LEU 176 273 273 LEU LEU A . n A 1 177 PRO 177 274 274 PRO PRO A . n A 1 178 SER 178 275 275 SER SER A . n A 1 179 ASN 179 276 276 ASN ASN A . n A 1 180 PRO 180 277 277 PRO PRO A . n A 1 181 ILE 181 278 278 ILE ILE A . n A 1 182 ASP 182 279 279 ASP ASP A . n A 1 183 PHE 183 280 280 PHE PHE A . n A 1 184 SER 184 281 281 SER SER A . n A 1 185 TYR 185 282 282 TYR TYR A . n A 1 186 TRP 186 283 283 TRP TRP A . n A 1 187 VAL 187 284 284 VAL VAL A . n A 1 188 ALA 188 285 285 ALA ALA A . n A 1 189 ALA 189 286 286 ALA ALA A . n A 1 190 ASN 190 287 287 ASN ASN A . n A 1 191 LEU 191 288 288 LEU LEU A . n A 1 192 PRO 192 289 289 PRO PRO A . n A 1 193 ILE 193 290 290 ILE ILE A . n A 1 194 ASP 194 291 291 ASP ASP A . n A 1 195 ASP 195 292 292 ASP ASP A . n A 1 196 SER 196 293 293 SER SER A . n A 1 197 LEU 197 294 294 LEU LEU A . n A 1 198 ARG 198 295 295 ARG ARG A . n A 1 199 ILE 199 296 296 ILE ILE A . n A 1 200 GLN 200 297 297 GLN GLN A . n A 1 201 LEU 201 298 298 LEU LEU A . n A 1 202 LEU 202 299 299 LEU LEU A . n A 1 203 LYS 203 300 300 LYS LYS A . n A 1 204 ILE 204 301 301 ILE ILE A . n A 1 205 ASP 205 302 302 ASP ASP A . n A 1 206 SER 206 303 303 SER SER A . n A 1 207 ALA 207 304 304 ALA ALA A . n A 1 208 ILE 208 305 305 ILE ILE A . n A 1 209 GLN 209 306 306 GLN GLN A . n A 1 210 ARG 210 307 307 ARG ARG A . n A 1 211 LEU 211 308 308 LEU LEU A . n A 1 212 ARG 212 309 309 ARG ARG A . n A 1 213 CYS 213 310 310 CYS CYS A . n A 1 214 GLU 214 311 311 GLU GLU A . n A 1 215 LEU 215 312 312 LEU LEU A . n A 1 216 ASP 216 313 313 ASP ASP A . n A 1 217 ILE 217 314 314 ILE ILE A . n A 1 218 MET 218 315 315 MET MET A . n A 1 219 ASN 219 316 316 ASN ASN A . n A 1 220 LYS 220 317 317 LYS LYS A . n A 1 221 CYS 221 318 ? ? ? A . n A 1 222 THR 222 319 319 THR THR A . n A 1 223 SER 223 320 320 SER SER A . n A 1 224 LEU 224 321 321 LEU LEU A . n A 1 225 CYS 225 322 322 CYS CYS A . n A 1 226 CYS 226 323 323 CYS CYS A . n A 1 227 LYS 227 324 324 LYS LYS A . n A 1 228 GLN 228 325 325 GLN GLN A . n A 1 229 CYS 229 326 326 CYS CYS A . n A 1 230 GLN 230 327 327 GLN GLN A . n A 1 231 GLU 231 328 328 GLU GLU A . n A 1 232 THR 232 329 329 THR THR A . n A 1 233 GLU 233 330 330 GLU GLU A . n A 1 234 ILE 234 331 331 ILE ILE A . n A 1 235 THR 235 332 332 THR THR A . n A 1 236 THR 236 333 333 THR THR A . n A 1 237 LYS 237 334 334 LYS LYS A . n A 1 238 ASN 238 335 335 ASN ASN A . n A 1 239 GLU 239 336 336 GLU GLU A . n A 1 240 ILE 240 337 337 ILE ILE A . n A 1 241 PHE 241 338 338 PHE PHE A . n A 1 242 SER 242 339 339 SER SER A . n A 1 243 LEU 243 340 340 LEU LEU A . n A 1 244 SER 244 341 341 SER SER A . n A 1 245 ARG 245 342 342 ARG ARG A . n A 1 246 GLU 246 343 343 GLU GLU A . n A 1 247 GLY 247 344 344 GLY GLY A . n A 1 248 PRO 248 345 345 PRO PRO A . n A 1 249 MET 249 346 346 MET MET A . n A 1 250 ALA 250 347 347 ALA ALA A . n A 1 251 ALA 251 348 348 ALA ALA A . n A 1 252 TYR 252 349 349 TYR TYR A . n A 1 253 VAL 253 350 350 VAL VAL A . n A 1 254 ASN 254 351 351 ASN ASN A . n A 1 255 PRO 255 352 352 PRO PRO A . n A 1 256 HIS 256 353 ? ? ? A . n A 1 257 GLY 257 354 354 GLY GLY A . n A 1 258 TYR 258 355 355 TYR TYR A . n A 1 259 VAL 259 356 356 VAL VAL A . n A 1 260 HIS 260 357 357 HIS HIS A . n A 1 261 GLU 261 358 358 GLU GLU A . n A 1 262 ILE 262 359 359 ILE ILE A . n A 1 263 LEU 263 360 360 LEU LEU A . n A 1 264 THR 264 361 361 THR THR A . n A 1 265 VAL 265 362 362 VAL VAL A . n A 1 266 TYR 266 363 363 TYR TYR A . n A 1 267 LYS 267 364 364 LYS LYS A . n A 1 268 ALA 268 365 365 ALA ALA A . n A 1 269 CYS 269 366 366 CYS CYS A . n A 1 270 ASN 270 367 367 ASN ASN A . n A 1 271 LEU 271 368 368 LEU LEU A . n A 1 272 ASN 272 369 369 ASN ASN A . n A 1 273 LEU 273 370 370 LEU LEU A . n A 1 274 ILE 274 371 371 ILE ILE A . n A 1 275 GLY 275 372 372 GLY GLY A . n A 1 276 ARG 276 373 373 ARG ARG A . n A 1 277 PRO 277 374 374 PRO PRO A . n A 1 278 SER 278 375 375 SER SER A . n A 1 279 THR 279 376 376 THR THR A . n A 1 280 GLU 280 377 377 GLU GLU A . n A 1 281 HIS 281 378 378 HIS HIS A . n A 1 282 SER 282 379 379 SER SER A . n A 1 283 TRP 283 380 380 TRP TRP A . n A 1 284 PHE 284 381 381 PHE PHE A . n A 1 285 PRO 285 382 382 PRO PRO A . n A 1 286 GLY 286 383 383 GLY GLY A . n A 1 287 TYR 287 384 384 TYR TYR A . n A 1 288 ALA 288 385 385 ALA ALA A . n A 1 289 TRP 289 386 386 TRP TRP A . n A 1 290 THR 290 387 387 THR THR A . n A 1 291 VAL 291 388 388 VAL VAL A . n A 1 292 ALA 292 389 389 ALA ALA A . n A 1 293 GLN 293 390 390 GLN GLN A . n A 1 294 CYS 294 391 391 CYS CYS A . n A 1 295 LYS 295 392 392 LYS LYS A . n A 1 296 ILE 296 393 393 ILE ILE A . n A 1 297 CYS 297 394 394 CYS CYS A . n A 1 298 ALA 298 395 395 ALA ALA A . n A 1 299 SER 299 396 396 SER SER A . n A 1 300 HIS 300 397 397 HIS HIS A . n A 1 301 ILE 301 398 398 ILE ILE A . n A 1 302 GLY 302 399 399 GLY GLY A . n A 1 303 TRP 303 400 400 TRP TRP A . n A 1 304 LYS 304 401 401 LYS LYS A . n A 1 305 PHE 305 402 402 PHE PHE A . n A 1 306 THR 306 403 403 THR THR A . n A 1 307 ALA 307 404 404 ALA ALA A . n A 1 308 THR 308 405 405 THR THR A . n A 1 309 LYS 309 406 406 LYS LYS A . n A 1 310 LYS 310 407 407 LYS LYS A . n A 1 311 ASP 311 408 408 ASP ASP A . n A 1 312 MET 312 409 409 MET MET A . n A 1 313 SER 313 410 410 SER SER A . n A 1 314 PRO 314 411 411 PRO PRO A . n A 1 315 GLN 315 412 412 GLN GLN A . n A 1 316 LYS 316 413 413 LYS LYS A . n A 1 317 PHE 317 414 414 PHE PHE A . n A 1 318 TRP 318 415 415 TRP TRP A . n A 1 319 GLY 319 416 416 GLY GLY A . n A 1 320 LEU 320 417 417 LEU LEU A . n A 1 321 THR 321 418 418 THR THR A . n A 1 322 ARG 322 419 419 ARG ARG A . n A 1 323 SER 323 420 420 SER SER A . n A 1 324 ALA 324 421 421 ALA ALA A . n A 1 325 LEU 325 422 422 LEU LEU A . n A 1 326 ILE 326 423 423 ILE ILE A . n A 1 327 PRO 327 424 424 PRO PRO A . n A 1 328 THR 328 425 425 THR THR A . n A 1 329 ILE 329 426 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 600 _pdbx_nonpoly_scheme.auth_seq_num 600 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 74 ? CG ? A ASP 35 CG 2 1 Y 1 A ASP 74 ? OD1 ? A ASP 35 OD1 3 1 Y 1 A ASP 74 ? OD2 ? A ASP 35 OD2 4 1 Y 1 A LEU 99 ? CG ? A LEU 60 CG 5 1 Y 1 A LEU 99 ? CD1 ? A LEU 60 CD1 6 1 Y 1 A LEU 99 ? CD2 ? A LEU 60 CD2 7 1 Y 1 A GLN 100 ? CG ? A GLN 61 CG 8 1 Y 1 A GLN 100 ? CD ? A GLN 61 CD 9 1 Y 1 A GLN 100 ? OE1 ? A GLN 61 OE1 10 1 Y 1 A GLN 100 ? NE2 ? A GLN 61 NE2 11 1 Y 1 A GLN 115 ? CG ? A GLN 76 CG 12 1 Y 1 A GLN 115 ? CD ? A GLN 76 CD 13 1 Y 1 A GLN 115 ? OE1 ? A GLN 76 OE1 14 1 Y 1 A GLN 115 ? NE2 ? A GLN 76 NE2 15 1 Y 1 A ASP 117 ? CG ? A ASP 78 CG 16 1 Y 1 A ASP 117 ? OD1 ? A ASP 78 OD1 17 1 Y 1 A ASP 117 ? OD2 ? A ASP 78 OD2 18 1 Y 1 A GLU 130 ? CG ? A GLU 91 CG 19 1 Y 1 A GLU 130 ? CD ? A GLU 91 CD 20 1 Y 1 A GLU 130 ? OE1 ? A GLU 91 OE1 21 1 Y 1 A GLU 130 ? OE2 ? A GLU 91 OE2 22 1 Y 1 A ARG 131 ? CG ? A ARG 92 CG 23 1 Y 1 A ARG 131 ? CD ? A ARG 92 CD 24 1 Y 1 A ARG 131 ? NE ? A ARG 92 NE 25 1 Y 1 A ARG 131 ? CZ ? A ARG 92 CZ 26 1 Y 1 A ARG 131 ? NH1 ? A ARG 92 NH1 27 1 Y 1 A ARG 131 ? NH2 ? A ARG 92 NH2 28 1 Y 1 A GLU 132 ? CG ? A GLU 93 CG 29 1 Y 1 A GLU 132 ? CD ? A GLU 93 CD 30 1 Y 1 A GLU 132 ? OE1 ? A GLU 93 OE1 31 1 Y 1 A GLU 132 ? OE2 ? A GLU 93 OE2 32 1 Y 1 A GLU 134 ? CG ? A GLU 95 CG 33 1 Y 1 A GLU 134 ? CD ? A GLU 95 CD 34 1 Y 1 A GLU 134 ? OE1 ? A GLU 95 OE1 35 1 Y 1 A GLU 134 ? OE2 ? A GLU 95 OE2 36 1 Y 1 A PHE 135 ? CG ? A PHE 96 CG 37 1 Y 1 A PHE 135 ? CD1 ? A PHE 96 CD1 38 1 Y 1 A PHE 135 ? CD2 ? A PHE 96 CD2 39 1 Y 1 A PHE 135 ? CE1 ? A PHE 96 CE1 40 1 Y 1 A PHE 135 ? CE2 ? A PHE 96 CE2 41 1 Y 1 A PHE 135 ? CZ ? A PHE 96 CZ 42 1 Y 1 A ARG 145 ? CG ? A ARG 106 CG 43 1 Y 1 A ARG 145 ? CD ? A ARG 106 CD 44 1 Y 1 A ARG 145 ? NE ? A ARG 106 NE 45 1 Y 1 A ARG 145 ? CZ ? A ARG 106 CZ 46 1 Y 1 A ARG 145 ? NH1 ? A ARG 106 NH1 47 1 Y 1 A ARG 145 ? NH2 ? A ARG 106 NH2 48 1 Y 1 A GLU 146 ? CG ? A GLU 107 CG 49 1 Y 1 A GLU 146 ? CD ? A GLU 107 CD 50 1 Y 1 A GLU 146 ? OE1 ? A GLU 107 OE1 51 1 Y 1 A GLU 146 ? OE2 ? A GLU 107 OE2 52 1 Y 1 A GLU 147 ? CG ? A GLU 108 CG 53 1 Y 1 A GLU 147 ? CD ? A GLU 108 CD 54 1 Y 1 A GLU 147 ? OE1 ? A GLU 108 OE1 55 1 Y 1 A GLU 147 ? OE2 ? A GLU 108 OE2 56 1 Y 1 A PHE 150 ? CG ? A PHE 111 CG 57 1 Y 1 A PHE 150 ? CD1 ? A PHE 111 CD1 58 1 Y 1 A PHE 150 ? CD2 ? A PHE 111 CD2 59 1 Y 1 A PHE 150 ? CE1 ? A PHE 111 CE1 60 1 Y 1 A PHE 150 ? CE2 ? A PHE 111 CE2 61 1 Y 1 A PHE 150 ? CZ ? A PHE 111 CZ 62 1 Y 1 A LYS 156 ? CG ? A LYS 117 CG 63 1 Y 1 A LYS 156 ? CD ? A LYS 117 CD 64 1 Y 1 A LYS 156 ? CE ? A LYS 117 CE 65 1 Y 1 A LYS 156 ? NZ ? A LYS 117 NZ 66 1 Y 1 A GLU 169 ? CG ? A GLU 130 CG 67 1 Y 1 A GLU 169 ? CD ? A GLU 130 CD 68 1 Y 1 A GLU 169 ? OE1 ? A GLU 130 OE1 69 1 Y 1 A GLU 169 ? OE2 ? A GLU 130 OE2 70 1 Y 1 A ARG 171 ? CG ? A ARG 132 CG 71 1 Y 1 A ARG 171 ? CD ? A ARG 132 CD 72 1 Y 1 A ARG 171 ? NE ? A ARG 132 NE 73 1 Y 1 A ARG 171 ? CZ ? A ARG 132 CZ 74 1 Y 1 A ARG 171 ? NH1 ? A ARG 132 NH1 75 1 Y 1 A ARG 171 ? NH2 ? A ARG 132 NH2 76 1 Y 1 A GLN 173 ? CG ? A GLN 134 CG 77 1 Y 1 A GLN 173 ? CD ? A GLN 134 CD 78 1 Y 1 A GLN 173 ? OE1 ? A GLN 134 OE1 79 1 Y 1 A GLN 173 ? NE2 ? A GLN 134 NE2 80 1 Y 1 A ASP 175 ? CG ? A ASP 136 CG 81 1 Y 1 A ASP 175 ? OD1 ? A ASP 136 OD1 82 1 Y 1 A ASP 175 ? OD2 ? A ASP 136 OD2 83 1 Y 1 A LEU 253 ? CG ? A LEU 156 CG 84 1 Y 1 A LEU 253 ? CD1 ? A LEU 156 CD1 85 1 Y 1 A LEU 253 ? CD2 ? A LEU 156 CD2 86 1 Y 1 A ARG 256 ? CG ? A ARG 159 CG 87 1 Y 1 A ARG 256 ? CD ? A ARG 159 CD 88 1 Y 1 A ARG 256 ? NE ? A ARG 159 NE 89 1 Y 1 A ARG 256 ? CZ ? A ARG 159 CZ 90 1 Y 1 A ARG 256 ? NH1 ? A ARG 159 NH1 91 1 Y 1 A ARG 256 ? NH2 ? A ARG 159 NH2 92 1 Y 1 A ILE 257 ? CG1 ? A ILE 160 CG1 93 1 Y 1 A ILE 257 ? CG2 ? A ILE 160 CG2 94 1 Y 1 A ILE 257 ? CD1 ? A ILE 160 CD1 95 1 Y 1 A LYS 259 ? CG ? A LYS 162 CG 96 1 Y 1 A LYS 259 ? CD ? A LYS 162 CD 97 1 Y 1 A LYS 259 ? CE ? A LYS 162 CE 98 1 Y 1 A LYS 259 ? NZ ? A LYS 162 NZ 99 1 Y 1 A LEU 261 ? CG ? A LEU 164 CG 100 1 Y 1 A LEU 261 ? CD1 ? A LEU 164 CD1 101 1 Y 1 A LEU 261 ? CD2 ? A LEU 164 CD2 102 1 Y 1 A ARG 262 ? CG ? A ARG 165 CG 103 1 Y 1 A ARG 262 ? CD ? A ARG 165 CD 104 1 Y 1 A ARG 262 ? NE ? A ARG 165 NE 105 1 Y 1 A ARG 262 ? CZ ? A ARG 165 CZ 106 1 Y 1 A ARG 262 ? NH1 ? A ARG 165 NH1 107 1 Y 1 A ARG 262 ? NH2 ? A ARG 165 NH2 108 1 Y 1 A GLU 263 ? CG ? A GLU 166 CG 109 1 Y 1 A GLU 263 ? CD ? A GLU 166 CD 110 1 Y 1 A GLU 263 ? OE1 ? A GLU 166 OE1 111 1 Y 1 A GLU 263 ? OE2 ? A GLU 166 OE2 112 1 Y 1 A GLU 266 ? CG ? A GLU 169 CG 113 1 Y 1 A GLU 266 ? CD ? A GLU 169 CD 114 1 Y 1 A GLU 266 ? OE1 ? A GLU 169 OE1 115 1 Y 1 A GLU 266 ? OE2 ? A GLU 169 OE2 116 1 Y 1 A ASN 267 ? CG ? A ASN 170 CG 117 1 Y 1 A ASN 267 ? OD1 ? A ASN 170 OD1 118 1 Y 1 A ASN 267 ? ND2 ? A ASN 170 ND2 119 1 Y 1 A LEU 268 ? CG ? A LEU 171 CG 120 1 Y 1 A LEU 268 ? CD1 ? A LEU 171 CD1 121 1 Y 1 A LEU 268 ? CD2 ? A LEU 171 CD2 122 1 Y 1 A LEU 294 ? CG ? A LEU 197 CG 123 1 Y 1 A LEU 294 ? CD1 ? A LEU 197 CD1 124 1 Y 1 A LEU 294 ? CD2 ? A LEU 197 CD2 125 1 Y 1 A ILE 305 ? CG1 ? A ILE 208 CG1 126 1 Y 1 A ILE 305 ? CG2 ? A ILE 208 CG2 127 1 Y 1 A ILE 305 ? CD1 ? A ILE 208 CD1 128 1 Y 1 A ASP 313 ? CG ? A ASP 216 CG 129 1 Y 1 A ASP 313 ? OD1 ? A ASP 216 OD1 130 1 Y 1 A ASP 313 ? OD2 ? A ASP 216 OD2 131 1 Y 1 A ILE 314 ? CG1 ? A ILE 217 CG1 132 1 Y 1 A ILE 314 ? CG2 ? A ILE 217 CG2 133 1 Y 1 A ILE 314 ? CD1 ? A ILE 217 CD1 134 1 Y 1 A LYS 317 ? CG ? A LYS 220 CG 135 1 Y 1 A LYS 317 ? CD ? A LYS 220 CD 136 1 Y 1 A LYS 317 ? CE ? A LYS 220 CE 137 1 Y 1 A LYS 317 ? NZ ? A LYS 220 NZ 138 1 Y 1 A THR 319 ? OG1 ? A THR 222 OG1 139 1 Y 1 A THR 319 ? CG2 ? A THR 222 CG2 140 1 Y 1 A LYS 324 ? CG ? A LYS 227 CG 141 1 Y 1 A LYS 324 ? CD ? A LYS 227 CD 142 1 Y 1 A LYS 324 ? CE ? A LYS 227 CE 143 1 Y 1 A LYS 324 ? NZ ? A LYS 227 NZ 144 1 Y 1 A GLN 327 ? CG ? A GLN 230 CG 145 1 Y 1 A GLN 327 ? CD ? A GLN 230 CD 146 1 Y 1 A GLN 327 ? OE1 ? A GLN 230 OE1 147 1 Y 1 A GLN 327 ? NE2 ? A GLN 230 NE2 148 1 Y 1 A GLU 328 ? CG ? A GLU 231 CG 149 1 Y 1 A GLU 328 ? CD ? A GLU 231 CD 150 1 Y 1 A GLU 328 ? OE1 ? A GLU 231 OE1 151 1 Y 1 A GLU 328 ? OE2 ? A GLU 231 OE2 152 1 Y 1 A GLU 330 ? CG ? A GLU 233 CG 153 1 Y 1 A GLU 330 ? CD ? A GLU 233 CD 154 1 Y 1 A GLU 330 ? OE1 ? A GLU 233 OE1 155 1 Y 1 A GLU 330 ? OE2 ? A GLU 233 OE2 156 1 Y 1 A LYS 334 ? CG ? A LYS 237 CG 157 1 Y 1 A LYS 334 ? CD ? A LYS 237 CD 158 1 Y 1 A LYS 334 ? CE ? A LYS 237 CE 159 1 Y 1 A LYS 334 ? NZ ? A LYS 237 NZ 160 1 Y 1 A ARG 342 ? CG ? A ARG 245 CG 161 1 Y 1 A ARG 342 ? CD ? A ARG 245 CD 162 1 Y 1 A ARG 342 ? NE ? A ARG 245 NE 163 1 Y 1 A ARG 342 ? CZ ? A ARG 245 CZ 164 1 Y 1 A ARG 342 ? NH1 ? A ARG 245 NH1 165 1 Y 1 A ARG 342 ? NH2 ? A ARG 245 NH2 166 1 Y 1 A GLU 343 ? CG ? A GLU 246 CG 167 1 Y 1 A GLU 343 ? CD ? A GLU 246 CD 168 1 Y 1 A GLU 343 ? OE1 ? A GLU 246 OE1 169 1 Y 1 A GLU 343 ? OE2 ? A GLU 246 OE2 170 1 Y 1 A LYS 364 ? CG ? A LYS 267 CG 171 1 Y 1 A LYS 364 ? CD ? A LYS 267 CD 172 1 Y 1 A LYS 364 ? CE ? A LYS 267 CE 173 1 Y 1 A LYS 364 ? NZ ? A LYS 267 NZ 174 1 Y 1 A LEU 368 ? CG ? A LEU 271 CG 175 1 Y 1 A LEU 368 ? CD1 ? A LEU 271 CD1 176 1 Y 1 A LEU 368 ? CD2 ? A LEU 271 CD2 177 1 Y 1 A ARG 373 ? CG ? A ARG 276 CG 178 1 Y 1 A ARG 373 ? CD ? A ARG 276 CD 179 1 Y 1 A ARG 373 ? NE ? A ARG 276 NE 180 1 Y 1 A ARG 373 ? CZ ? A ARG 276 CZ 181 1 Y 1 A ARG 373 ? NH1 ? A ARG 276 NH1 182 1 Y 1 A ARG 373 ? NH2 ? A ARG 276 NH2 183 1 Y 1 A HIS 378 ? CG ? A HIS 281 CG 184 1 Y 1 A HIS 378 ? ND1 ? A HIS 281 ND1 185 1 Y 1 A HIS 378 ? CD2 ? A HIS 281 CD2 186 1 Y 1 A HIS 378 ? CE1 ? A HIS 281 CE1 187 1 Y 1 A HIS 378 ? NE2 ? A HIS 281 NE2 188 1 Y 1 A SER 396 ? OG ? A SER 299 OG 189 1 Y 1 A LYS 406 ? CG ? A LYS 309 CG 190 1 Y 1 A LYS 406 ? CD ? A LYS 309 CD 191 1 Y 1 A LYS 406 ? CE ? A LYS 309 CE 192 1 Y 1 A LYS 406 ? NZ ? A LYS 309 NZ 193 1 Y 1 A MET 409 ? CG ? A MET 312 CG 194 1 Y 1 A MET 409 ? SD ? A MET 312 SD 195 1 Y 1 A MET 409 ? CE ? A MET 312 CE 196 1 Y 1 A SER 410 ? OG ? A SER 313 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8RQ1 _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.031 _cell.length_a_esd ? _cell.length_b 96.405 _cell.length_b_esd ? _cell.length_c 148.086 _cell.length_c_esd ? _cell.volume 742806.566 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8RQ1 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RQ1 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M sodium citrate, 20% (w/v) PEG 3350, and 0.1 M BIS-TRIS propane pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-05-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 88.9 _reflns.entry_id 8RQ1 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.11 _reflns.d_resolution_low 74.04 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6975 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.98 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.410 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.11 _reflns_shell.d_res_low 3.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 688 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.37 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 6.797 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 81.15 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8RQ1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.11 _refine.ls_d_res_low 74.04 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6975 _refine.ls_number_reflns_R_free 359 _refine.ls_number_reflns_R_work 6616 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.50 _refine.ls_percent_reflns_R_free 5.15 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2684 _refine.ls_R_factor_R_free 0.2997 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2667 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.2706 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5138 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.11 _refine_hist.d_res_low 74.04 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2120 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2119 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0034 ? 2161 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6046 ? 2954 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0419 ? 353 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0044 ? 378 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.9669 ? 740 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.11 3.56 . . 112 2143 98.86 . . . . 0.3544 . . . . . . . . . . . 0.3636 'X-RAY DIFFRACTION' 3.56 4.48 . . 122 2182 99.78 . . . . 0.2824 . . . . . . . . . . . 0.3264 'X-RAY DIFFRACTION' 4.48 74.04 . . 125 2291 99.88 . . . . 0.2356 . . . . . . . . . . . 0.2692 # _struct.entry_id 8RQ1 _struct.title 'Crystal structure of CRBN-midi' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RQ1 _struct_keywords.text 'E3 ligase, PROTAC, TPD, molecular glue, targeted protein degradation, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CRBN_HUMAN Q96SW2 ? 1 ;AKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTF AVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPE ; 41 2 UNP CRBN_HUMAN Q96SW2 ? 1 ;DAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQE TEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKD MSPQKFWGLTRSALLPTI ; 249 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8RQ1 A 2 ? 148 ? Q96SW2 41 ? 187 ? 41 187 2 2 8RQ1 A 152 ? 329 ? Q96SW2 249 ? 426 ? 249 426 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8RQ1 SER A 1 ? UNP Q96SW2 ? ? 'expression tag' 40 1 1 8RQ1 ILE A 39 ? UNP Q96SW2 CYS 78 'engineered mutation' 78 2 1 8RQ1 VAL A 53 ? UNP Q96SW2 ILE 92 'engineered mutation' 92 3 1 8RQ1 ASN A 77 ? UNP Q96SW2 LYS 116 'engineered mutation' 116 4 1 8RQ1 GLU A 95 ? UNP Q96SW2 GLN 134 'engineered mutation' 134 5 1 8RQ1 GLY A 149 ? UNP Q96SW2 ? ? linker 188 6 1 8RQ1 SER A 150 ? UNP Q96SW2 ? ? linker 189 7 1 8RQ1 GLY A 151 ? UNP Q96SW2 ? ? linker 190 8 2 8RQ1 TRP A 186 ? UNP Q96SW2 ARG 283 'engineered mutation' 283 9 2 8RQ1 ASN A 190 ? UNP Q96SW2 CYS 287 'engineered mutation' 287 10 2 8RQ1 SER A 196 ? UNP Q96SW2 VAL 293 'engineered mutation' 293 11 2 8RQ1 ASP A 205 ? UNP Q96SW2 GLY 302 'engineered mutation' 302 12 2 8RQ1 ARG A 245 ? UNP Q96SW2 LEU 342 'engineered mutation' 342 13 2 8RQ1 GLU A 246 ? UNP Q96SW2 CYS 343 'engineered mutation' 343 14 2 8RQ1 ILE A 262 ? UNP Q96SW2 THR 359 'engineered mutation' 359 15 2 8RQ1 ILE A 326 ? UNP Q96SW2 LEU 423 'engineered mutation' 423 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 14400 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 64 ? ASN A 77 ? HIS A 103 ASN A 116 1 ? 14 HELX_P HELX_P2 AA2 GLU A 154 ? ASP A 168 ? GLU A 251 ASP A 265 1 ? 15 HELX_P HELX_P3 AA3 ASN A 179 ? ASN A 190 ? ASN A 276 ASN A 287 1 ? 12 HELX_P HELX_P4 AA4 ASP A 194 ? ILE A 204 ? ASP A 291 ILE A 301 1 ? 11 HELX_P HELX_P5 AA5 SER A 206 ? LYS A 220 ? SER A 303 LYS A 317 1 ? 15 HELX_P HELX_P6 AA6 ASN A 238 ? ILE A 240 ? ASN A 335 ILE A 337 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 226 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 323 A ZN 600 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc2 metalc ? ? A CYS 229 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 326 A ZN 600 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc3 metalc ? ? A CYS 294 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 391 A ZN 600 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc4 metalc ? ? A CYS 297 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 394 A ZN 600 1_555 ? ? ? ? ? ? ? 2.320 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 226 ? A CYS 323 ? 1_555 ZN ? B ZN . ? A ZN 600 ? 1_555 SG ? A CYS 229 ? A CYS 326 ? 1_555 110.6 ? 2 SG ? A CYS 226 ? A CYS 323 ? 1_555 ZN ? B ZN . ? A ZN 600 ? 1_555 SG ? A CYS 294 ? A CYS 391 ? 1_555 111.5 ? 3 SG ? A CYS 229 ? A CYS 326 ? 1_555 ZN ? B ZN . ? A ZN 600 ? 1_555 SG ? A CYS 294 ? A CYS 391 ? 1_555 111.0 ? 4 SG ? A CYS 226 ? A CYS 323 ? 1_555 ZN ? B ZN . ? A ZN 600 ? 1_555 SG ? A CYS 297 ? A CYS 394 ? 1_555 103.8 ? 5 SG ? A CYS 229 ? A CYS 326 ? 1_555 ZN ? B ZN . ? A ZN 600 ? 1_555 SG ? A CYS 297 ? A CYS 394 ? 1_555 107.1 ? 6 SG ? A CYS 294 ? A CYS 391 ? 1_555 ZN ? B ZN . ? A ZN 600 ? 1_555 SG ? A CYS 297 ? A CYS 394 ? 1_555 112.6 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 3 ? AA4 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 39 ? PRO A 43 ? ILE A 78 PRO A 82 AA1 2 GLN A 139 ? ILE A 145 ? GLN A 178 ILE A 184 AA1 3 ILE A 113 ? THR A 133 ? ILE A 152 THR A 172 AA1 4 THR A 57 ? LEU A 62 ? THR A 96 LEU A 101 AA2 1 ILE A 39 ? PRO A 43 ? ILE A 78 PRO A 82 AA2 2 GLN A 139 ? ILE A 145 ? GLN A 178 ILE A 184 AA2 3 ILE A 113 ? THR A 133 ? ILE A 152 THR A 172 AA2 4 GLU A 93 ? ASP A 110 ? GLU A 132 ASP A 149 AA2 5 THR A 80 ? ASN A 88 ? THR A 119 ASN A 127 AA3 1 GLU A 233 ? THR A 236 ? GLU A 330 THR A 333 AA3 2 SER A 223 ? CYS A 226 ? SER A 320 CYS A 323 AA3 3 LEU A 325 ? PRO A 327 ? LEU A 422 PRO A 424 AA4 1 MET A 249 ? VAL A 253 ? MET A 346 VAL A 350 AA4 2 VAL A 259 ? VAL A 265 ? VAL A 356 VAL A 362 AA4 3 LYS A 316 ? THR A 321 ? LYS A 413 THR A 418 AA4 4 GLY A 302 ? ALA A 307 ? GLY A 399 ALA A 404 AA4 5 TYR A 287 ? CYS A 294 ? TYR A 384 CYS A 391 AA4 6 LEU A 271 ? SER A 278 ? LEU A 368 SER A 375 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 42 ? N ILE A 81 O ALA A 141 ? O ALA A 180 AA1 2 3 O LYS A 142 ? O LYS A 181 N GLU A 130 ? N GLU A 169 AA1 3 4 O VAL A 116 ? O VAL A 155 N LEU A 62 ? N LEU A 101 AA2 1 2 N ILE A 42 ? N ILE A 81 O ALA A 141 ? O ALA A 180 AA2 2 3 O LYS A 142 ? O LYS A 181 N GLU A 130 ? N GLU A 169 AA2 3 4 O GLN A 124 ? O GLN A 163 N THR A 99 ? N THR A 138 AA2 4 5 O GLU A 93 ? O GLU A 132 N SER A 87 ? N SER A 126 AA3 1 2 O THR A 235 ? O THR A 332 N LEU A 224 ? N LEU A 321 AA3 2 3 N CYS A 225 ? N CYS A 322 O ILE A 326 ? O ILE A 423 AA4 1 2 N ALA A 250 ? N ALA A 347 O ILE A 262 ? O ILE A 359 AA4 2 3 N VAL A 265 ? N VAL A 362 O TRP A 318 ? O TRP A 415 AA4 3 4 O GLY A 319 ? O GLY A 416 N TRP A 303 ? N TRP A 400 AA4 4 5 O LYS A 304 ? O LYS A 401 N THR A 290 ? N THR A 387 AA4 5 6 O GLN A 293 ? O GLN A 390 N ASN A 272 ? N ASN A 369 # _pdbx_entry_details.entry_id 8RQ1 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 116 ? ? -112.67 64.28 2 1 ASP A 117 ? ? 74.40 -5.45 3 1 ARG A 162 ? ? -121.18 -55.57 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 40 ? A SER 1 2 1 Y 1 A ALA 41 ? A ALA 2 3 1 Y 1 A LYS 42 ? A LYS 3 4 1 Y 1 A LYS 43 ? A LYS 4 5 1 Y 1 A PRO 44 ? A PRO 5 6 1 Y 1 A ASN 45 ? A ASN 6 7 1 Y 1 A ILE 46 ? A ILE 7 8 1 Y 1 A ILE 47 ? A ILE 8 9 1 Y 1 A ASN 48 ? A ASN 9 10 1 Y 1 A PHE 49 ? A PHE 10 11 1 Y 1 A ASP 50 ? A ASP 11 12 1 Y 1 A THR 51 ? A THR 12 13 1 Y 1 A SER 52 ? A SER 13 14 1 Y 1 A LEU 53 ? A LEU 14 15 1 Y 1 A PRO 54 ? A PRO 15 16 1 Y 1 A THR 55 ? A THR 16 17 1 Y 1 A SER 56 ? A SER 17 18 1 Y 1 A HIS 57 ? A HIS 18 19 1 Y 1 A THR 58 ? A THR 19 20 1 Y 1 A TYR 59 ? A TYR 20 21 1 Y 1 A LEU 60 ? A LEU 21 22 1 Y 1 A GLY 61 ? A GLY 22 23 1 Y 1 A ALA 62 ? A ALA 23 24 1 Y 1 A ASP 63 ? A ASP 24 25 1 Y 1 A MET 64 ? A MET 25 26 1 Y 1 A GLU 65 ? A GLU 26 27 1 Y 1 A GLU 66 ? A GLU 27 28 1 Y 1 A PHE 67 ? A PHE 28 29 1 Y 1 A HIS 68 ? A HIS 29 30 1 Y 1 A GLY 69 ? A GLY 30 31 1 Y 1 A ARG 70 ? A ARG 31 32 1 Y 1 A THR 71 ? A THR 32 33 1 Y 1 A GLY 188 ? A GLY 149 34 1 Y 1 A SER 189 ? A SER 150 35 1 Y 1 A GLY 190 ? A GLY 151 36 1 Y 1 A ASP 249 ? A ASP 152 37 1 Y 1 A LYS 269 ? A LYS 172 38 1 Y 1 A ASP 270 ? A ASP 173 39 1 Y 1 A CYS 318 ? A CYS 221 40 1 Y 1 A HIS 353 ? A HIS 256 41 1 Y 1 A ILE 426 ? A ILE 329 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'PDB deposition D_1292135928' # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8RQ1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019219 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010373 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006753 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 29.81721 ? ? ? 5.87945 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_