data_8RWU # _entry.id 8RWU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.401 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RWU pdb_00008rwu 10.2210/pdb8rwu/pdb WWPDB D_1292136399 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-03-06 2 'Structure model' 1 1 2024-04-17 3 'Structure model' 2 0 2025-01-22 4 'Structure model' 2 1 2025-01-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' author 'Coordinate replacement' 'Model completeness' 'N-terminal residues added' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' 7 3 'Structure model' 'Polymer sequence' 8 3 'Structure model' 'Refinement description' 9 3 'Structure model' 'Source and taxonomy' 10 3 'Structure model' 'Structure summary' 11 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' struct 2 3 'Structure model' atom_site 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 3 'Structure model' diffrn 6 3 'Structure model' entity 7 3 'Structure model' entity_poly 8 3 'Structure model' entity_poly_seq 9 3 'Structure model' entity_src_gen 10 3 'Structure model' pdbx_contact_author 11 3 'Structure model' pdbx_entry_details 12 3 'Structure model' pdbx_poly_seq_scheme 13 3 'Structure model' pdbx_struct_assembly_prop 14 3 'Structure model' pdbx_unobs_or_zero_occ_residues 15 3 'Structure model' pdbx_validate_torsion 16 3 'Structure model' refine 17 3 'Structure model' refine_hist 18 3 'Structure model' refine_ls_restr 19 3 'Structure model' refine_ls_shell 20 3 'Structure model' reflns_shell 21 3 'Structure model' software 22 3 'Structure model' struct_conf 23 3 'Structure model' struct_keywords 24 3 'Structure model' struct_ref 25 3 'Structure model' struct_ref_seq 26 3 'Structure model' struct_ref_seq_dif 27 4 'Structure model' citation 28 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_struct.title' 2 3 'Structure model' '_citation.country' 3 3 'Structure model' '_citation.journal_abbrev' 4 3 'Structure model' '_citation.journal_id_ISSN' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.pdbx_database_id_DOI' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation.year' 12 3 'Structure model' '_diffrn.ambient_temp' 13 3 'Structure model' '_entity.formula_weight' 14 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 15 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 16 3 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 17 3 'Structure model' '_pdbx_struct_assembly_prop.value' 18 3 'Structure model' '_refine.B_iso_mean' 19 3 'Structure model' '_refine.ls_R_factor_R_free' 20 3 'Structure model' '_refine.ls_R_factor_R_work' 21 3 'Structure model' '_refine.ls_R_factor_obs' 22 3 'Structure model' '_refine.ls_d_res_high' 23 3 'Structure model' '_refine.ls_d_res_low' 24 3 'Structure model' '_refine.ls_number_reflns_obs' 25 3 'Structure model' '_refine.ls_percent_reflns_obs' 26 3 'Structure model' '_refine.overall_SU_ML' 27 3 'Structure model' '_refine.pdbx_overall_phase_error' 28 3 'Structure model' '_refine.pdbx_solvent_vdw_probe_radii' 29 3 'Structure model' '_refine_hist.d_res_high' 30 3 'Structure model' '_refine_hist.d_res_low' 31 3 'Structure model' '_refine_hist.number_atoms_total' 32 3 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 33 3 'Structure model' '_refine_ls_restr.dev_ideal' 34 3 'Structure model' '_refine_ls_restr.number' 35 3 'Structure model' '_refine_ls_shell.R_factor_R_free' 36 3 'Structure model' '_refine_ls_shell.R_factor_R_work' 37 3 'Structure model' '_refine_ls_shell.d_res_high' 38 3 'Structure model' '_refine_ls_shell.d_res_low' 39 3 'Structure model' '_refine_ls_shell.number_reflns_R_work' 40 3 'Structure model' '_reflns_shell.Rmerge_I_obs' 41 3 'Structure model' '_reflns_shell.pdbx_Rrim_I_all' 42 3 'Structure model' '_software.version' 43 3 'Structure model' '_struct_keywords.pdbx_keywords' 44 3 'Structure model' '_struct_keywords.text' 45 3 'Structure model' '_struct_ref.pdbx_align_begin' 46 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 47 3 'Structure model' '_struct_ref_seq.db_align_beg' 48 3 'Structure model' '_struct_ref_seq.db_align_end' 49 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 50 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end' 51 3 'Structure model' '_struct_ref_seq.seq_align_beg' 52 3 'Structure model' '_struct_ref_seq.seq_align_end' 53 4 'Structure model' '_citation.journal_abbrev' 54 4 'Structure model' '_citation.journal_id_ISSN' 55 4 'Structure model' '_citation.pdbx_database_id_PubMed' 56 4 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8RWU _pdbx_database_status.recvd_initial_deposition_date 2024-02-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sylvie.nessler@i2bc.paris-saclay.fr _pdbx_contact_author.name_first Sylvie _pdbx_contact_author.name_last Nessler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4973-9941 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nessler, S.' 1 0000-0003-4973-9941 'Le Berre, M.' 2 0009-0009-0462-0489 'Gallay Li de la Sierra, I.' 3 0000-0003-2770-7439 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 81 _citation.language ? _citation.page_first 38 _citation.page_last 48 _citation.title 'Structural characterization of the ACDC domain from ApiAP2 proteins, a potential molecular target against apicomplexan parasites.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798324012518 _citation.pdbx_database_id_PubMed 39820027 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Le Berre, M.' 1 ? primary 'Tubiana, T.' 2 ? primary 'Reutersward Waldner, P.' 3 ? primary 'Lazar, N.' 4 ? primary 'Li de la Sierra-Gallay, I.' 5 ? primary 'Santos, J.M.' 6 ? primary 'Llinas, M.' 7 ? primary 'Nessler, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'AP2 domain transcription factor AP2-I, putative' _entity.formula_weight 23324.811 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASLNEHEGEVAYDKKEDAEISMHMNEQDKLDVPSLVEICKQQLIVILKDMCADSNSSDEKASFMYHLNRLRSAVTVVDL HNYIAVFGPCLSYNKLPSTWNISVCDYLKQQLNILRAADSQQSSSNHVSYLELHNDYEDIIHDKKGNATTTASNSMQGNM NSNNLNSQLSMKGSSIHMNSANSTSNVSGNATGNASGHISINWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MASLNEHEGEVAYDKKEDAEISMHMNEQDKLDVPSLVEICKQQLIVILKDMCADSNSSDEKASFMYHLNRLRSAVTVVDL HNYIAVFGPCLSYNKLPSTWNISVCDYLKQQLNILRAADSQQSSSNHVSYLELHNDYEDIIHDKKGNATTTASNSMQGNM NSNNLNSQLSMKGSSIHMNSANSTSNVSGNATGNASGHISINWSHPQFEK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 LEU n 1 5 ASN n 1 6 GLU n 1 7 HIS n 1 8 GLU n 1 9 GLY n 1 10 GLU n 1 11 VAL n 1 12 ALA n 1 13 TYR n 1 14 ASP n 1 15 LYS n 1 16 LYS n 1 17 GLU n 1 18 ASP n 1 19 ALA n 1 20 GLU n 1 21 ILE n 1 22 SER n 1 23 MET n 1 24 HIS n 1 25 MET n 1 26 ASN n 1 27 GLU n 1 28 GLN n 1 29 ASP n 1 30 LYS n 1 31 LEU n 1 32 ASP n 1 33 VAL n 1 34 PRO n 1 35 SER n 1 36 LEU n 1 37 VAL n 1 38 GLU n 1 39 ILE n 1 40 CYS n 1 41 LYS n 1 42 GLN n 1 43 GLN n 1 44 LEU n 1 45 ILE n 1 46 VAL n 1 47 ILE n 1 48 LEU n 1 49 LYS n 1 50 ASP n 1 51 MET n 1 52 CYS n 1 53 ALA n 1 54 ASP n 1 55 SER n 1 56 ASN n 1 57 SER n 1 58 SER n 1 59 ASP n 1 60 GLU n 1 61 LYS n 1 62 ALA n 1 63 SER n 1 64 PHE n 1 65 MET n 1 66 TYR n 1 67 HIS n 1 68 LEU n 1 69 ASN n 1 70 ARG n 1 71 LEU n 1 72 ARG n 1 73 SER n 1 74 ALA n 1 75 VAL n 1 76 THR n 1 77 VAL n 1 78 VAL n 1 79 ASP n 1 80 LEU n 1 81 HIS n 1 82 ASN n 1 83 TYR n 1 84 ILE n 1 85 ALA n 1 86 VAL n 1 87 PHE n 1 88 GLY n 1 89 PRO n 1 90 CYS n 1 91 LEU n 1 92 SER n 1 93 TYR n 1 94 ASN n 1 95 LYS n 1 96 LEU n 1 97 PRO n 1 98 SER n 1 99 THR n 1 100 TRP n 1 101 ASN n 1 102 ILE n 1 103 SER n 1 104 VAL n 1 105 CYS n 1 106 ASP n 1 107 TYR n 1 108 LEU n 1 109 LYS n 1 110 GLN n 1 111 GLN n 1 112 LEU n 1 113 ASN n 1 114 ILE n 1 115 LEU n 1 116 ARG n 1 117 ALA n 1 118 ALA n 1 119 ASP n 1 120 SER n 1 121 GLN n 1 122 GLN n 1 123 SER n 1 124 SER n 1 125 SER n 1 126 ASN n 1 127 HIS n 1 128 VAL n 1 129 SER n 1 130 TYR n 1 131 LEU n 1 132 GLU n 1 133 LEU n 1 134 HIS n 1 135 ASN n 1 136 ASP n 1 137 TYR n 1 138 GLU n 1 139 ASP n 1 140 ILE n 1 141 ILE n 1 142 HIS n 1 143 ASP n 1 144 LYS n 1 145 LYS n 1 146 GLY n 1 147 ASN n 1 148 ALA n 1 149 THR n 1 150 THR n 1 151 THR n 1 152 ALA n 1 153 SER n 1 154 ASN n 1 155 SER n 1 156 MET n 1 157 GLN n 1 158 GLY n 1 159 ASN n 1 160 MET n 1 161 ASN n 1 162 SER n 1 163 ASN n 1 164 ASN n 1 165 LEU n 1 166 ASN n 1 167 SER n 1 168 GLN n 1 169 LEU n 1 170 SER n 1 171 MET n 1 172 LYS n 1 173 GLY n 1 174 SER n 1 175 SER n 1 176 ILE n 1 177 HIS n 1 178 MET n 1 179 ASN n 1 180 SER n 1 181 ALA n 1 182 ASN n 1 183 SER n 1 184 THR n 1 185 SER n 1 186 ASN n 1 187 VAL n 1 188 SER n 1 189 GLY n 1 190 ASN n 1 191 ALA n 1 192 THR n 1 193 GLY n 1 194 ASN n 1 195 ALA n 1 196 SER n 1 197 GLY n 1 198 HIS n 1 199 ILE n 1 200 SER n 1 201 ILE n 1 202 ASN n 1 203 TRP n 1 204 SER n 1 205 HIS n 1 206 PRO n 1 207 GLN n 1 208 PHE n 1 209 GLU n 1 210 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 210 _entity_src_gen.gene_src_common_name 'malaria parasite P. vivax' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PVP01_0807400 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium vivax' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5855 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3-Gold _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 28 ? ? ? A . n A 1 2 ALA 2 29 ? ? ? A . n A 1 3 SER 3 30 ? ? ? A . n A 1 4 LEU 4 31 ? ? ? A . n A 1 5 ASN 5 32 ? ? ? A . n A 1 6 GLU 6 33 ? ? ? A . n A 1 7 HIS 7 34 ? ? ? A . n A 1 8 GLU 8 35 ? ? ? A . n A 1 9 GLY 9 36 ? ? ? A . n A 1 10 GLU 10 37 ? ? ? A . n A 1 11 VAL 11 38 ? ? ? A . n A 1 12 ALA 12 39 ? ? ? A . n A 1 13 TYR 13 40 ? ? ? A . n A 1 14 ASP 14 41 ? ? ? A . n A 1 15 LYS 15 42 ? ? ? A . n A 1 16 LYS 16 43 ? ? ? A . n A 1 17 GLU 17 44 ? ? ? A . n A 1 18 ASP 18 45 ? ? ? A . n A 1 19 ALA 19 46 ? ? ? A . n A 1 20 GLU 20 47 ? ? ? A . n A 1 21 ILE 21 48 ? ? ? A . n A 1 22 SER 22 49 ? ? ? A . n A 1 23 MET 23 50 ? ? ? A . n A 1 24 HIS 24 51 ? ? ? A . n A 1 25 MET 25 52 ? ? ? A . n A 1 26 ASN 26 53 ? ? ? A . n A 1 27 GLU 27 54 ? ? ? A . n A 1 28 GLN 28 55 56 GLN GLN A . n A 1 29 ASP 29 56 57 ASP ASP A . n A 1 30 LYS 30 57 58 LYS LYS A . n A 1 31 LEU 31 58 59 LEU LEU A . n A 1 32 ASP 32 59 60 ASP ASP A . n A 1 33 VAL 33 60 61 VAL VAL A . n A 1 34 PRO 34 61 62 PRO PRO A . n A 1 35 SER 35 62 63 SER SER A . n A 1 36 LEU 36 63 64 LEU LEU A . n A 1 37 VAL 37 64 65 VAL VAL A . n A 1 38 GLU 38 65 66 GLU GLU A . n A 1 39 ILE 39 66 67 ILE ILE A . n A 1 40 CYS 40 67 68 CYS CYS A . n A 1 41 LYS 41 68 69 LYS LYS A . n A 1 42 GLN 42 69 70 GLN GLN A . n A 1 43 GLN 43 70 71 GLN GLN A . n A 1 44 LEU 44 71 72 LEU LEU A . n A 1 45 ILE 45 72 73 ILE ILE A . n A 1 46 VAL 46 73 74 VAL VAL A . n A 1 47 ILE 47 74 75 ILE ILE A . n A 1 48 LEU 48 75 76 LEU LEU A . n A 1 49 LYS 49 76 77 LYS LYS A . n A 1 50 ASP 50 77 78 ASP ASP A . n A 1 51 MET 51 78 79 MET MET A . n A 1 52 CYS 52 79 80 CYS CYS A . n A 1 53 ALA 53 80 81 ALA ALA A . n A 1 54 ASP 54 81 82 ASP ASP A . n A 1 55 SER 55 82 83 SER SER A . n A 1 56 ASN 56 83 84 ASN ASN A . n A 1 57 SER 57 84 85 SER SER A . n A 1 58 SER 58 85 86 SER SER A . n A 1 59 ASP 59 86 87 ASP ASP A . n A 1 60 GLU 60 87 88 GLU GLU A . n A 1 61 LYS 61 88 89 LYS LYS A . n A 1 62 ALA 62 89 90 ALA ALA A . n A 1 63 SER 63 90 91 SER SER A . n A 1 64 PHE 64 91 92 PHE PHE A . n A 1 65 MET 65 92 93 MET MET A . n A 1 66 TYR 66 93 94 TYR TYR A . n A 1 67 HIS 67 94 95 HIS HIS A . n A 1 68 LEU 68 95 96 LEU LEU A . n A 1 69 ASN 69 96 97 ASN ASN A . n A 1 70 ARG 70 97 98 ARG ARG A . n A 1 71 LEU 71 98 99 LEU LEU A . n A 1 72 ARG 72 99 100 ARG ARG A . n A 1 73 SER 73 100 101 SER SER A . n A 1 74 ALA 74 101 102 ALA ALA A . n A 1 75 VAL 75 102 103 VAL VAL A . n A 1 76 THR 76 103 104 THR THR A . n A 1 77 VAL 77 104 105 VAL VAL A . n A 1 78 VAL 78 105 106 VAL VAL A . n A 1 79 ASP 79 106 107 ASP ASP A . n A 1 80 LEU 80 107 108 LEU LEU A . n A 1 81 HIS 81 108 109 HIS HIS A . n A 1 82 ASN 82 109 110 ASN ASN A . n A 1 83 TYR 83 110 111 TYR TYR A . n A 1 84 ILE 84 111 112 ILE ILE A . n A 1 85 ALA 85 112 113 ALA ALA A . n A 1 86 VAL 86 113 114 VAL VAL A . n A 1 87 PHE 87 114 115 PHE PHE A . n A 1 88 GLY 88 115 116 GLY GLY A . n A 1 89 PRO 89 116 117 PRO PRO A . n A 1 90 CYS 90 117 118 CYS CYS A . n A 1 91 LEU 91 118 119 LEU LEU A . n A 1 92 SER 92 119 120 SER SER A . n A 1 93 TYR 93 120 121 TYR TYR A . n A 1 94 ASN 94 121 122 ASN ASN A . n A 1 95 LYS 95 122 123 LYS LYS A . n A 1 96 LEU 96 123 124 LEU LEU A . n A 1 97 PRO 97 124 125 PRO PRO A . n A 1 98 SER 98 125 126 SER SER A . n A 1 99 THR 99 126 127 THR THR A . n A 1 100 TRP 100 127 128 TRP TRP A . n A 1 101 ASN 101 128 129 ASN ASN A . n A 1 102 ILE 102 129 130 ILE ILE A . n A 1 103 SER 103 130 131 SER SER A . n A 1 104 VAL 104 131 132 VAL VAL A . n A 1 105 CYS 105 132 133 CYS CYS A . n A 1 106 ASP 106 133 134 ASP ASP A . n A 1 107 TYR 107 134 135 TYR TYR A . n A 1 108 LEU 108 135 136 LEU LEU A . n A 1 109 LYS 109 136 137 LYS LYS A . n A 1 110 GLN 110 137 138 GLN GLN A . n A 1 111 GLN 111 138 139 GLN GLN A . n A 1 112 LEU 112 139 140 LEU LEU A . n A 1 113 ASN 113 140 141 ASN ASN A . n A 1 114 ILE 114 141 142 ILE ILE A . n A 1 115 LEU 115 142 143 LEU LEU A . n A 1 116 ARG 116 143 144 ARG ARG A . n A 1 117 ALA 117 144 145 ALA ALA A . n A 1 118 ALA 118 145 146 ALA ALA A . n A 1 119 ASP 119 146 147 ASP ASP A . n A 1 120 SER 120 147 148 SER SER A . n A 1 121 GLN 121 148 ? ? ? A . n A 1 122 GLN 122 149 ? ? ? A . n A 1 123 SER 123 150 ? ? ? A . n A 1 124 SER 124 151 ? ? ? A . n A 1 125 SER 125 152 ? ? ? A . n A 1 126 ASN 126 153 ? ? ? A . n A 1 127 HIS 127 154 ? ? ? A . n A 1 128 VAL 128 155 ? ? ? A . n A 1 129 SER 129 156 ? ? ? A . n A 1 130 TYR 130 157 ? ? ? A . n A 1 131 LEU 131 158 ? ? ? A . n A 1 132 GLU 132 159 ? ? ? A . n A 1 133 LEU 133 160 ? ? ? A . n A 1 134 HIS 134 161 ? ? ? A . n A 1 135 ASN 135 162 ? ? ? A . n A 1 136 ASP 136 163 ? ? ? A . n A 1 137 TYR 137 164 ? ? ? A . n A 1 138 GLU 138 165 ? ? ? A . n A 1 139 ASP 139 166 ? ? ? A . n A 1 140 ILE 140 167 ? ? ? A . n A 1 141 ILE 141 168 ? ? ? A . n A 1 142 HIS 142 169 ? ? ? A . n A 1 143 ASP 143 170 ? ? ? A . n A 1 144 LYS 144 171 ? ? ? A . n A 1 145 LYS 145 172 ? ? ? A . n A 1 146 GLY 146 173 ? ? ? A . n A 1 147 ASN 147 174 ? ? ? A . n A 1 148 ALA 148 175 ? ? ? A . n A 1 149 THR 149 176 ? ? ? A . n A 1 150 THR 150 177 ? ? ? A . n A 1 151 THR 151 178 ? ? ? A . n A 1 152 ALA 152 179 ? ? ? A . n A 1 153 SER 153 180 ? ? ? A . n A 1 154 ASN 154 181 ? ? ? A . n A 1 155 SER 155 182 ? ? ? A . n A 1 156 MET 156 183 ? ? ? A . n A 1 157 GLN 157 184 ? ? ? A . n A 1 158 GLY 158 185 ? ? ? A . n A 1 159 ASN 159 186 ? ? ? A . n A 1 160 MET 160 187 ? ? ? A . n A 1 161 ASN 161 188 ? ? ? A . n A 1 162 SER 162 189 ? ? ? A . n A 1 163 ASN 163 190 ? ? ? A . n A 1 164 ASN 164 191 ? ? ? A . n A 1 165 LEU 165 192 ? ? ? A . n A 1 166 ASN 166 193 ? ? ? A . n A 1 167 SER 167 194 ? ? ? A . n A 1 168 GLN 168 195 ? ? ? A . n A 1 169 LEU 169 196 ? ? ? A . n A 1 170 SER 170 197 ? ? ? A . n A 1 171 MET 171 198 ? ? ? A . n A 1 172 LYS 172 199 ? ? ? A . n A 1 173 GLY 173 200 ? ? ? A . n A 1 174 SER 174 201 ? ? ? A . n A 1 175 SER 175 202 ? ? ? A . n A 1 176 ILE 176 203 ? ? ? A . n A 1 177 HIS 177 204 ? ? ? A . n A 1 178 MET 178 205 ? ? ? A . n A 1 179 ASN 179 206 ? ? ? A . n A 1 180 SER 180 207 ? ? ? A . n A 1 181 ALA 181 208 ? ? ? A . n A 1 182 ASN 182 209 ? ? ? A . n A 1 183 SER 183 210 ? ? ? A . n A 1 184 THR 184 211 ? ? ? A . n A 1 185 SER 185 212 ? ? ? A . n A 1 186 ASN 186 213 ? ? ? A . n A 1 187 VAL 187 214 ? ? ? A . n A 1 188 SER 188 215 ? ? ? A . n A 1 189 GLY 189 216 ? ? ? A . n A 1 190 ASN 190 217 ? ? ? A . n A 1 191 ALA 191 218 ? ? ? A . n A 1 192 THR 192 219 ? ? ? A . n A 1 193 GLY 193 220 ? ? ? A . n A 1 194 ASN 194 221 ? ? ? A . n A 1 195 ALA 195 222 ? ? ? A . n A 1 196 SER 196 223 ? ? ? A . n A 1 197 GLY 197 224 ? ? ? A . n A 1 198 HIS 198 225 ? ? ? A . n A 1 199 ILE 199 226 ? ? ? A . n A 1 200 SER 200 227 ? ? ? A . n A 1 201 ILE 201 228 ? ? ? A . n A 1 202 ASN 202 229 ? ? ? A . n A 1 203 TRP 203 230 ? ? ? A . n A 1 204 SER 204 231 ? ? ? A . n A 1 205 HIS 205 232 ? ? ? A . n A 1 206 PRO 206 233 ? ? ? A . n A 1 207 GLN 207 234 ? ? ? A . n A 1 208 PHE 208 235 ? ? ? A . n A 1 209 GLU 209 236 ? ? ? A . n A 1 210 LYS 210 237 ? ? ? A . n B 1 1 MET 1 28 ? ? ? B . n B 1 2 ALA 2 29 ? ? ? B . n B 1 3 SER 3 30 ? ? ? B . n B 1 4 LEU 4 31 ? ? ? B . n B 1 5 ASN 5 32 ? ? ? B . n B 1 6 GLU 6 33 ? ? ? B . n B 1 7 HIS 7 34 ? ? ? B . n B 1 8 GLU 8 35 ? ? ? B . n B 1 9 GLY 9 36 ? ? ? B . n B 1 10 GLU 10 37 ? ? ? B . n B 1 11 VAL 11 38 ? ? ? B . n B 1 12 ALA 12 39 ? ? ? B . n B 1 13 TYR 13 40 ? ? ? B . n B 1 14 ASP 14 41 ? ? ? B . n B 1 15 LYS 15 42 ? ? ? B . n B 1 16 LYS 16 43 ? ? ? B . n B 1 17 GLU 17 44 ? ? ? B . n B 1 18 ASP 18 45 ? ? ? B . n B 1 19 ALA 19 46 ? ? ? B . n B 1 20 GLU 20 47 ? ? ? B . n B 1 21 ILE 21 48 ? ? ? B . n B 1 22 SER 22 49 ? ? ? B . n B 1 23 MET 23 50 ? ? ? B . n B 1 24 HIS 24 51 ? ? ? B . n B 1 25 MET 25 52 ? ? ? B . n B 1 26 ASN 26 53 ? ? ? B . n B 1 27 GLU 27 54 ? ? ? B . n B 1 28 GLN 28 55 ? ? ? B . n B 1 29 ASP 29 56 ? ? ? B . n B 1 30 LYS 30 57 58 LYS LYS B . n B 1 31 LEU 31 58 59 LEU LEU B . n B 1 32 ASP 32 59 60 ASP ASP B . n B 1 33 VAL 33 60 61 VAL VAL B . n B 1 34 PRO 34 61 62 PRO PRO B . n B 1 35 SER 35 62 63 SER SER B . n B 1 36 LEU 36 63 64 LEU LEU B . n B 1 37 VAL 37 64 65 VAL VAL B . n B 1 38 GLU 38 65 66 GLU GLU B . n B 1 39 ILE 39 66 67 ILE ILE B . n B 1 40 CYS 40 67 68 CYS CYS B . n B 1 41 LYS 41 68 69 LYS LYS B . n B 1 42 GLN 42 69 70 GLN GLN B . n B 1 43 GLN 43 70 71 GLN GLN B . n B 1 44 LEU 44 71 72 LEU LEU B . n B 1 45 ILE 45 72 73 ILE ILE B . n B 1 46 VAL 46 73 74 VAL VAL B . n B 1 47 ILE 47 74 75 ILE ILE B . n B 1 48 LEU 48 75 76 LEU LEU B . n B 1 49 LYS 49 76 77 LYS LYS B . n B 1 50 ASP 50 77 78 ASP ASP B . n B 1 51 MET 51 78 79 MET MET B . n B 1 52 CYS 52 79 80 CYS CYS B . n B 1 53 ALA 53 80 81 ALA ALA B . n B 1 54 ASP 54 81 82 ASP ASP B . n B 1 55 SER 55 82 83 SER SER B . n B 1 56 ASN 56 83 84 ASN ASN B . n B 1 57 SER 57 84 85 SER SER B . n B 1 58 SER 58 85 86 SER SER B . n B 1 59 ASP 59 86 87 ASP ASP B . n B 1 60 GLU 60 87 88 GLU GLU B . n B 1 61 LYS 61 88 89 LYS LYS B . n B 1 62 ALA 62 89 90 ALA ALA B . n B 1 63 SER 63 90 91 SER SER B . n B 1 64 PHE 64 91 92 PHE PHE B . n B 1 65 MET 65 92 93 MET MET B . n B 1 66 TYR 66 93 94 TYR TYR B . n B 1 67 HIS 67 94 95 HIS HIS B . n B 1 68 LEU 68 95 96 LEU LEU B . n B 1 69 ASN 69 96 97 ASN ASN B . n B 1 70 ARG 70 97 98 ARG ARG B . n B 1 71 LEU 71 98 99 LEU LEU B . n B 1 72 ARG 72 99 100 ARG ARG B . n B 1 73 SER 73 100 101 SER SER B . n B 1 74 ALA 74 101 102 ALA ALA B . n B 1 75 VAL 75 102 103 VAL VAL B . n B 1 76 THR 76 103 104 THR THR B . n B 1 77 VAL 77 104 105 VAL VAL B . n B 1 78 VAL 78 105 106 VAL VAL B . n B 1 79 ASP 79 106 107 ASP ASP B . n B 1 80 LEU 80 107 108 LEU LEU B . n B 1 81 HIS 81 108 109 HIS HIS B . n B 1 82 ASN 82 109 110 ASN ASN B . n B 1 83 TYR 83 110 111 TYR TYR B . n B 1 84 ILE 84 111 112 ILE ILE B . n B 1 85 ALA 85 112 113 ALA ALA B . n B 1 86 VAL 86 113 114 VAL VAL B . n B 1 87 PHE 87 114 115 PHE PHE B . n B 1 88 GLY 88 115 116 GLY GLY B . n B 1 89 PRO 89 116 117 PRO PRO B . n B 1 90 CYS 90 117 118 CYS CYS B . n B 1 91 LEU 91 118 119 LEU LEU B . n B 1 92 SER 92 119 120 SER SER B . n B 1 93 TYR 93 120 121 TYR TYR B . n B 1 94 ASN 94 121 122 ASN ASN B . n B 1 95 LYS 95 122 123 LYS LYS B . n B 1 96 LEU 96 123 124 LEU LEU B . n B 1 97 PRO 97 124 125 PRO PRO B . n B 1 98 SER 98 125 126 SER SER B . n B 1 99 THR 99 126 127 THR THR B . n B 1 100 TRP 100 127 128 TRP TRP B . n B 1 101 ASN 101 128 129 ASN ASN B . n B 1 102 ILE 102 129 130 ILE ILE B . n B 1 103 SER 103 130 131 SER SER B . n B 1 104 VAL 104 131 132 VAL VAL B . n B 1 105 CYS 105 132 133 CYS CYS B . n B 1 106 ASP 106 133 134 ASP ASP B . n B 1 107 TYR 107 134 135 TYR TYR B . n B 1 108 LEU 108 135 136 LEU LEU B . n B 1 109 LYS 109 136 137 LYS LYS B . n B 1 110 GLN 110 137 138 GLN GLN B . n B 1 111 GLN 111 138 139 GLN GLN B . n B 1 112 LEU 112 139 140 LEU LEU B . n B 1 113 ASN 113 140 141 ASN ASN B . n B 1 114 ILE 114 141 142 ILE ILE B . n B 1 115 LEU 115 142 143 LEU LEU B . n B 1 116 ARG 116 143 144 ARG ARG B . n B 1 117 ALA 117 144 145 ALA ALA B . n B 1 118 ALA 118 145 146 ALA ALA B . n B 1 119 ASP 119 146 147 ASP ASP B . n B 1 120 SER 120 147 148 SER SER B . n B 1 121 GLN 121 148 ? ? ? B . n B 1 122 GLN 122 149 ? ? ? B . n B 1 123 SER 123 150 ? ? ? B . n B 1 124 SER 124 151 ? ? ? B . n B 1 125 SER 125 152 ? ? ? B . n B 1 126 ASN 126 153 ? ? ? B . n B 1 127 HIS 127 154 ? ? ? B . n B 1 128 VAL 128 155 ? ? ? B . n B 1 129 SER 129 156 ? ? ? B . n B 1 130 TYR 130 157 ? ? ? B . n B 1 131 LEU 131 158 ? ? ? B . n B 1 132 GLU 132 159 ? ? ? B . n B 1 133 LEU 133 160 ? ? ? B . n B 1 134 HIS 134 161 ? ? ? B . n B 1 135 ASN 135 162 ? ? ? B . n B 1 136 ASP 136 163 ? ? ? B . n B 1 137 TYR 137 164 ? ? ? B . n B 1 138 GLU 138 165 ? ? ? B . n B 1 139 ASP 139 166 ? ? ? B . n B 1 140 ILE 140 167 ? ? ? B . n B 1 141 ILE 141 168 ? ? ? B . n B 1 142 HIS 142 169 ? ? ? B . n B 1 143 ASP 143 170 ? ? ? B . n B 1 144 LYS 144 171 ? ? ? B . n B 1 145 LYS 145 172 ? ? ? B . n B 1 146 GLY 146 173 ? ? ? B . n B 1 147 ASN 147 174 ? ? ? B . n B 1 148 ALA 148 175 ? ? ? B . n B 1 149 THR 149 176 ? ? ? B . n B 1 150 THR 150 177 ? ? ? B . n B 1 151 THR 151 178 ? ? ? B . n B 1 152 ALA 152 179 ? ? ? B . n B 1 153 SER 153 180 ? ? ? B . n B 1 154 ASN 154 181 ? ? ? B . n B 1 155 SER 155 182 ? ? ? B . n B 1 156 MET 156 183 ? ? ? B . n B 1 157 GLN 157 184 ? ? ? B . n B 1 158 GLY 158 185 ? ? ? B . n B 1 159 ASN 159 186 ? ? ? B . n B 1 160 MET 160 187 ? ? ? B . n B 1 161 ASN 161 188 ? ? ? B . n B 1 162 SER 162 189 ? ? ? B . n B 1 163 ASN 163 190 ? ? ? B . n B 1 164 ASN 164 191 ? ? ? B . n B 1 165 LEU 165 192 ? ? ? B . n B 1 166 ASN 166 193 ? ? ? B . n B 1 167 SER 167 194 ? ? ? B . n B 1 168 GLN 168 195 ? ? ? B . n B 1 169 LEU 169 196 ? ? ? B . n B 1 170 SER 170 197 ? ? ? B . n B 1 171 MET 171 198 ? ? ? B . n B 1 172 LYS 172 199 ? ? ? B . n B 1 173 GLY 173 200 ? ? ? B . n B 1 174 SER 174 201 ? ? ? B . n B 1 175 SER 175 202 ? ? ? B . n B 1 176 ILE 176 203 ? ? ? B . n B 1 177 HIS 177 204 ? ? ? B . n B 1 178 MET 178 205 ? ? ? B . n B 1 179 ASN 179 206 ? ? ? B . n B 1 180 SER 180 207 ? ? ? B . n B 1 181 ALA 181 208 ? ? ? B . n B 1 182 ASN 182 209 ? ? ? B . n B 1 183 SER 183 210 ? ? ? B . n B 1 184 THR 184 211 ? ? ? B . n B 1 185 SER 185 212 ? ? ? B . n B 1 186 ASN 186 213 ? ? ? B . n B 1 187 VAL 187 214 ? ? ? B . n B 1 188 SER 188 215 ? ? ? B . n B 1 189 GLY 189 216 ? ? ? B . n B 1 190 ASN 190 217 ? ? ? B . n B 1 191 ALA 191 218 ? ? ? B . n B 1 192 THR 192 219 ? ? ? B . n B 1 193 GLY 193 220 ? ? ? B . n B 1 194 ASN 194 221 ? ? ? B . n B 1 195 ALA 195 222 ? ? ? B . n B 1 196 SER 196 223 ? ? ? B . n B 1 197 GLY 197 224 ? ? ? B . n B 1 198 HIS 198 225 ? ? ? B . n B 1 199 ILE 199 226 ? ? ? B . n B 1 200 SER 200 227 ? ? ? B . n B 1 201 ILE 201 228 ? ? ? B . n B 1 202 ASN 202 229 ? ? ? B . n B 1 203 TRP 203 230 ? ? ? B . n B 1 204 SER 204 231 ? ? ? B . n B 1 205 HIS 205 232 ? ? ? B . n B 1 206 PRO 206 233 ? ? ? B . n B 1 207 GLN 207 234 ? ? ? B . n B 1 208 PHE 208 235 ? ? ? B . n B 1 209 GLU 209 236 ? ? ? B . n B 1 210 LYS 210 237 ? ? ? B . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21.2_5419: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8RWU _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.490 _cell.length_a_esd ? _cell.length_b 78.490 _cell.length_b_esd ? _cell.length_c 123.880 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8RWU _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RWU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 400 , 0.1 M Mes pH 6.5, 0.1 M Sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-06-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.980118 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.980118 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8RWU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.15 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7133 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.53 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.11800000000000001 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.15 3.34 ? 1.18 ? ? ? ? 1106 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3.084 ? ? 1 1 0.495 ? ? ? ? 3.024 ? ? ? ? ? ? ? ? ? 3.34 3.57 ? ? ? ? ? ? 1058 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.372 ? ? 2 1 0.856 ? ? ? ? 1.345 ? ? ? ? ? ? ? ? ? 3.57 3.85 ? ? ? ? ? ? 979 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.669 ? ? 3 1 0.97 ? ? ? ? 0.657 ? ? ? ? ? ? ? ? ? 3.85 4.22 ? ? ? ? ? ? 911 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.307 ? ? 4 1 0.993 ? ? ? ? 0.301 ? ? ? ? ? ? ? ? ? 4.22 4.71 ? ? ? ? ? ? 833 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.156 ? ? 5 1 0.997 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? ? 4.71 5.43 ? ? ? ? ? ? 754 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.112 ? ? 6 1 0.998 ? ? ? ? 0.11 ? ? ? ? ? ? ? ? ? 5.43 6.63 ? ? ? ? ? ? 645 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.107 ? ? 7 1 0.998 ? ? ? ? 0.105 ? ? ? ? ? ? ? ? ? 6.63 9.3 ? ? ? ? ? ? 520 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.046 ? ? 8 1 1.0 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8RWU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.15 _refine.ls_d_res_low 48.62 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7119 _refine.ls_number_reflns_R_free 356 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.69 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2286 _refine.ls_R_factor_R_free 0.2737 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2262 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.20 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.59 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.15 _refine_hist.d_res_low 48.62 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1453 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1453 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1477 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.727 ? 2003 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 5.249 ? 196 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 238 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 252 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.15 3.61 . . 114 2174 99.00 . . . . 0.3397 . . . . . . . . . . . 0.3843 'X-RAY DIFFRACTION' 3.61 4.54 . . 117 2226 100.00 . . . . 0.2515 . . . . . . . . . . . 0.3015 'X-RAY DIFFRACTION' 4.55 48.62 . . 125 2363 100.00 . . . . 0.1992 . . . . . . . . . . . 0.2455 # _struct.entry_id 8RWU _struct.title 'ACDC domain of the AP2-I transcription factor from Plasmodium vivax' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RWU _struct_keywords.text 'AP2-coincident domain mainly at the C-terminus, orthogonal four helix bundle, TRANSCRIPTION, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A564ZT73_PLAVI _struct_ref.pdbx_db_accession A0A564ZT73 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASLNEHEGEVAYDKKEDAEISMHMNEQDKLDVPSLVEICKQQLIVILKDMCADSNSSDEKASFMYHLNRLRSAVTVVDLH NYIAVFGPCLSYNKLPSTWNISVCDYLKQQLNILRAADSQQSSSNHVSYLELHNDYEDIIHDKKGNATTTASNSMQGNMN SNNLNSQLSMKGSSIHMNSANSTSNVSGNATGNASGHISIN ; _struct_ref.pdbx_align_begin 29 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8RWU A 2 ? 202 ? A0A564ZT73 29 ? 229 ? 29 229 2 1 8RWU B 2 ? 202 ? A0A564ZT73 29 ? 229 ? 29 229 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8RWU MET A 1 ? UNP A0A564ZT73 ? ? 'initiating methionine' 28 1 1 8RWU TRP A 203 ? UNP A0A564ZT73 ? ? 'expression tag' 230 2 1 8RWU SER A 204 ? UNP A0A564ZT73 ? ? 'expression tag' 231 3 1 8RWU HIS A 205 ? UNP A0A564ZT73 ? ? 'expression tag' 232 4 1 8RWU PRO A 206 ? UNP A0A564ZT73 ? ? 'expression tag' 233 5 1 8RWU GLN A 207 ? UNP A0A564ZT73 ? ? 'expression tag' 234 6 1 8RWU PHE A 208 ? UNP A0A564ZT73 ? ? 'expression tag' 235 7 1 8RWU GLU A 209 ? UNP A0A564ZT73 ? ? 'expression tag' 236 8 1 8RWU LYS A 210 ? UNP A0A564ZT73 ? ? 'expression tag' 237 9 2 8RWU MET B 1 ? UNP A0A564ZT73 ? ? 'initiating methionine' 28 10 2 8RWU TRP B 203 ? UNP A0A564ZT73 ? ? 'expression tag' 230 11 2 8RWU SER B 204 ? UNP A0A564ZT73 ? ? 'expression tag' 231 12 2 8RWU HIS B 205 ? UNP A0A564ZT73 ? ? 'expression tag' 232 13 2 8RWU PRO B 206 ? UNP A0A564ZT73 ? ? 'expression tag' 233 14 2 8RWU GLN B 207 ? UNP A0A564ZT73 ? ? 'expression tag' 234 15 2 8RWU PHE B 208 ? UNP A0A564ZT73 ? ? 'expression tag' 235 16 2 8RWU GLU B 209 ? UNP A0A564ZT73 ? ? 'expression tag' 236 17 2 8RWU LYS B 210 ? UNP A0A564ZT73 ? ? 'expression tag' 237 18 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2710 ? 1 MORE -24 ? 1 'SSA (A^2)' 10700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Eluted as a monomer from the SEC column.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 31 ? ALA A 53 ? LEU A 58 ALA A 80 1 ? 23 HELX_P HELX_P2 AA2 SER A 57 ? ALA A 74 ? SER A 84 ALA A 101 1 ? 18 HELX_P HELX_P3 AA3 LEU A 80 ? TYR A 93 ? LEU A 107 TYR A 120 1 ? 14 HELX_P HELX_P4 AA4 LEU A 96 ? ASN A 101 ? LEU A 123 ASN A 128 1 ? 6 HELX_P HELX_P5 AA5 SER A 103 ? SER A 120 ? SER A 130 SER A 147 1 ? 18 HELX_P HELX_P6 AA6 VAL B 33 ? CYS B 52 ? VAL B 60 CYS B 79 1 ? 20 HELX_P HELX_P7 AA7 SER B 57 ? SER B 73 ? SER B 84 SER B 100 1 ? 17 HELX_P HELX_P8 AA8 THR B 76 ? SER B 92 ? THR B 103 SER B 119 1 ? 17 HELX_P HELX_P9 AA9 TYR B 93 ? LYS B 95 ? TYR B 120 LYS B 122 5 ? 3 HELX_P HELX_P10 AB1 SER B 103 ? ALA B 118 ? SER B 130 ALA B 145 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 8RWU _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 83 ? ? -148.48 47.21 2 1 ASN A 128 ? ? 60.90 67.30 3 1 ASN B 83 ? ? -146.99 26.78 4 1 TYR B 120 ? ? 71.49 -18.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 28 ? A MET 1 2 1 Y 1 A ALA 29 ? A ALA 2 3 1 Y 1 A SER 30 ? A SER 3 4 1 Y 1 A LEU 31 ? A LEU 4 5 1 Y 1 A ASN 32 ? A ASN 5 6 1 Y 1 A GLU 33 ? A GLU 6 7 1 Y 1 A HIS 34 ? A HIS 7 8 1 Y 1 A GLU 35 ? A GLU 8 9 1 Y 1 A GLY 36 ? A GLY 9 10 1 Y 1 A GLU 37 ? A GLU 10 11 1 Y 1 A VAL 38 ? A VAL 11 12 1 Y 1 A ALA 39 ? A ALA 12 13 1 Y 1 A TYR 40 ? A TYR 13 14 1 Y 1 A ASP 41 ? A ASP 14 15 1 Y 1 A LYS 42 ? A LYS 15 16 1 Y 1 A LYS 43 ? A LYS 16 17 1 Y 1 A GLU 44 ? A GLU 17 18 1 Y 1 A ASP 45 ? A ASP 18 19 1 Y 1 A ALA 46 ? A ALA 19 20 1 Y 1 A GLU 47 ? A GLU 20 21 1 Y 1 A ILE 48 ? A ILE 21 22 1 Y 1 A SER 49 ? A SER 22 23 1 Y 1 A MET 50 ? A MET 23 24 1 Y 1 A HIS 51 ? A HIS 24 25 1 Y 1 A MET 52 ? A MET 25 26 1 Y 1 A ASN 53 ? A ASN 26 27 1 Y 1 A GLU 54 ? A GLU 27 28 1 Y 1 A GLN 148 ? A GLN 121 29 1 Y 1 A GLN 149 ? A GLN 122 30 1 Y 1 A SER 150 ? A SER 123 31 1 Y 1 A SER 151 ? A SER 124 32 1 Y 1 A SER 152 ? A SER 125 33 1 Y 1 A ASN 153 ? A ASN 126 34 1 Y 1 A HIS 154 ? A HIS 127 35 1 Y 1 A VAL 155 ? A VAL 128 36 1 Y 1 A SER 156 ? A SER 129 37 1 Y 1 A TYR 157 ? A TYR 130 38 1 Y 1 A LEU 158 ? A LEU 131 39 1 Y 1 A GLU 159 ? A GLU 132 40 1 Y 1 A LEU 160 ? A LEU 133 41 1 Y 1 A HIS 161 ? A HIS 134 42 1 Y 1 A ASN 162 ? A ASN 135 43 1 Y 1 A ASP 163 ? A ASP 136 44 1 Y 1 A TYR 164 ? A TYR 137 45 1 Y 1 A GLU 165 ? A GLU 138 46 1 Y 1 A ASP 166 ? A ASP 139 47 1 Y 1 A ILE 167 ? A ILE 140 48 1 Y 1 A ILE 168 ? A ILE 141 49 1 Y 1 A HIS 169 ? A HIS 142 50 1 Y 1 A ASP 170 ? A ASP 143 51 1 Y 1 A LYS 171 ? A LYS 144 52 1 Y 1 A LYS 172 ? A LYS 145 53 1 Y 1 A GLY 173 ? A GLY 146 54 1 Y 1 A ASN 174 ? A ASN 147 55 1 Y 1 A ALA 175 ? A ALA 148 56 1 Y 1 A THR 176 ? A THR 149 57 1 Y 1 A THR 177 ? A THR 150 58 1 Y 1 A THR 178 ? A THR 151 59 1 Y 1 A ALA 179 ? A ALA 152 60 1 Y 1 A SER 180 ? A SER 153 61 1 Y 1 A ASN 181 ? A ASN 154 62 1 Y 1 A SER 182 ? A SER 155 63 1 Y 1 A MET 183 ? A MET 156 64 1 Y 1 A GLN 184 ? A GLN 157 65 1 Y 1 A GLY 185 ? A GLY 158 66 1 Y 1 A ASN 186 ? A ASN 159 67 1 Y 1 A MET 187 ? A MET 160 68 1 Y 1 A ASN 188 ? A ASN 161 69 1 Y 1 A SER 189 ? A SER 162 70 1 Y 1 A ASN 190 ? A ASN 163 71 1 Y 1 A ASN 191 ? A ASN 164 72 1 Y 1 A LEU 192 ? A LEU 165 73 1 Y 1 A ASN 193 ? A ASN 166 74 1 Y 1 A SER 194 ? A SER 167 75 1 Y 1 A GLN 195 ? A GLN 168 76 1 Y 1 A LEU 196 ? A LEU 169 77 1 Y 1 A SER 197 ? A SER 170 78 1 Y 1 A MET 198 ? A MET 171 79 1 Y 1 A LYS 199 ? A LYS 172 80 1 Y 1 A GLY 200 ? A GLY 173 81 1 Y 1 A SER 201 ? A SER 174 82 1 Y 1 A SER 202 ? A SER 175 83 1 Y 1 A ILE 203 ? A ILE 176 84 1 Y 1 A HIS 204 ? A HIS 177 85 1 Y 1 A MET 205 ? A MET 178 86 1 Y 1 A ASN 206 ? A ASN 179 87 1 Y 1 A SER 207 ? A SER 180 88 1 Y 1 A ALA 208 ? A ALA 181 89 1 Y 1 A ASN 209 ? A ASN 182 90 1 Y 1 A SER 210 ? A SER 183 91 1 Y 1 A THR 211 ? A THR 184 92 1 Y 1 A SER 212 ? A SER 185 93 1 Y 1 A ASN 213 ? A ASN 186 94 1 Y 1 A VAL 214 ? A VAL 187 95 1 Y 1 A SER 215 ? A SER 188 96 1 Y 1 A GLY 216 ? A GLY 189 97 1 Y 1 A ASN 217 ? A ASN 190 98 1 Y 1 A ALA 218 ? A ALA 191 99 1 Y 1 A THR 219 ? A THR 192 100 1 Y 1 A GLY 220 ? A GLY 193 101 1 Y 1 A ASN 221 ? A ASN 194 102 1 Y 1 A ALA 222 ? A ALA 195 103 1 Y 1 A SER 223 ? A SER 196 104 1 Y 1 A GLY 224 ? A GLY 197 105 1 Y 1 A HIS 225 ? A HIS 198 106 1 Y 1 A ILE 226 ? A ILE 199 107 1 Y 1 A SER 227 ? A SER 200 108 1 Y 1 A ILE 228 ? A ILE 201 109 1 Y 1 A ASN 229 ? A ASN 202 110 1 Y 1 A TRP 230 ? A TRP 203 111 1 Y 1 A SER 231 ? A SER 204 112 1 Y 1 A HIS 232 ? A HIS 205 113 1 Y 1 A PRO 233 ? A PRO 206 114 1 Y 1 A GLN 234 ? A GLN 207 115 1 Y 1 A PHE 235 ? A PHE 208 116 1 Y 1 A GLU 236 ? A GLU 209 117 1 Y 1 A LYS 237 ? A LYS 210 118 1 Y 1 B MET 28 ? B MET 1 119 1 Y 1 B ALA 29 ? B ALA 2 120 1 Y 1 B SER 30 ? B SER 3 121 1 Y 1 B LEU 31 ? B LEU 4 122 1 Y 1 B ASN 32 ? B ASN 5 123 1 Y 1 B GLU 33 ? B GLU 6 124 1 Y 1 B HIS 34 ? B HIS 7 125 1 Y 1 B GLU 35 ? B GLU 8 126 1 Y 1 B GLY 36 ? B GLY 9 127 1 Y 1 B GLU 37 ? B GLU 10 128 1 Y 1 B VAL 38 ? B VAL 11 129 1 Y 1 B ALA 39 ? B ALA 12 130 1 Y 1 B TYR 40 ? B TYR 13 131 1 Y 1 B ASP 41 ? B ASP 14 132 1 Y 1 B LYS 42 ? B LYS 15 133 1 Y 1 B LYS 43 ? B LYS 16 134 1 Y 1 B GLU 44 ? B GLU 17 135 1 Y 1 B ASP 45 ? B ASP 18 136 1 Y 1 B ALA 46 ? B ALA 19 137 1 Y 1 B GLU 47 ? B GLU 20 138 1 Y 1 B ILE 48 ? B ILE 21 139 1 Y 1 B SER 49 ? B SER 22 140 1 Y 1 B MET 50 ? B MET 23 141 1 Y 1 B HIS 51 ? B HIS 24 142 1 Y 1 B MET 52 ? B MET 25 143 1 Y 1 B ASN 53 ? B ASN 26 144 1 Y 1 B GLU 54 ? B GLU 27 145 1 Y 1 B GLN 55 ? B GLN 28 146 1 Y 1 B ASP 56 ? B ASP 29 147 1 Y 1 B GLN 148 ? B GLN 121 148 1 Y 1 B GLN 149 ? B GLN 122 149 1 Y 1 B SER 150 ? B SER 123 150 1 Y 1 B SER 151 ? B SER 124 151 1 Y 1 B SER 152 ? B SER 125 152 1 Y 1 B ASN 153 ? B ASN 126 153 1 Y 1 B HIS 154 ? B HIS 127 154 1 Y 1 B VAL 155 ? B VAL 128 155 1 Y 1 B SER 156 ? B SER 129 156 1 Y 1 B TYR 157 ? B TYR 130 157 1 Y 1 B LEU 158 ? B LEU 131 158 1 Y 1 B GLU 159 ? B GLU 132 159 1 Y 1 B LEU 160 ? B LEU 133 160 1 Y 1 B HIS 161 ? B HIS 134 161 1 Y 1 B ASN 162 ? B ASN 135 162 1 Y 1 B ASP 163 ? B ASP 136 163 1 Y 1 B TYR 164 ? B TYR 137 164 1 Y 1 B GLU 165 ? B GLU 138 165 1 Y 1 B ASP 166 ? B ASP 139 166 1 Y 1 B ILE 167 ? B ILE 140 167 1 Y 1 B ILE 168 ? B ILE 141 168 1 Y 1 B HIS 169 ? B HIS 142 169 1 Y 1 B ASP 170 ? B ASP 143 170 1 Y 1 B LYS 171 ? B LYS 144 171 1 Y 1 B LYS 172 ? B LYS 145 172 1 Y 1 B GLY 173 ? B GLY 146 173 1 Y 1 B ASN 174 ? B ASN 147 174 1 Y 1 B ALA 175 ? B ALA 148 175 1 Y 1 B THR 176 ? B THR 149 176 1 Y 1 B THR 177 ? B THR 150 177 1 Y 1 B THR 178 ? B THR 151 178 1 Y 1 B ALA 179 ? B ALA 152 179 1 Y 1 B SER 180 ? B SER 153 180 1 Y 1 B ASN 181 ? B ASN 154 181 1 Y 1 B SER 182 ? B SER 155 182 1 Y 1 B MET 183 ? B MET 156 183 1 Y 1 B GLN 184 ? B GLN 157 184 1 Y 1 B GLY 185 ? B GLY 158 185 1 Y 1 B ASN 186 ? B ASN 159 186 1 Y 1 B MET 187 ? B MET 160 187 1 Y 1 B ASN 188 ? B ASN 161 188 1 Y 1 B SER 189 ? B SER 162 189 1 Y 1 B ASN 190 ? B ASN 163 190 1 Y 1 B ASN 191 ? B ASN 164 191 1 Y 1 B LEU 192 ? B LEU 165 192 1 Y 1 B ASN 193 ? B ASN 166 193 1 Y 1 B SER 194 ? B SER 167 194 1 Y 1 B GLN 195 ? B GLN 168 195 1 Y 1 B LEU 196 ? B LEU 169 196 1 Y 1 B SER 197 ? B SER 170 197 1 Y 1 B MET 198 ? B MET 171 198 1 Y 1 B LYS 199 ? B LYS 172 199 1 Y 1 B GLY 200 ? B GLY 173 200 1 Y 1 B SER 201 ? B SER 174 201 1 Y 1 B SER 202 ? B SER 175 202 1 Y 1 B ILE 203 ? B ILE 176 203 1 Y 1 B HIS 204 ? B HIS 177 204 1 Y 1 B MET 205 ? B MET 178 205 1 Y 1 B ASN 206 ? B ASN 179 206 1 Y 1 B SER 207 ? B SER 180 207 1 Y 1 B ALA 208 ? B ALA 181 208 1 Y 1 B ASN 209 ? B ASN 182 209 1 Y 1 B SER 210 ? B SER 183 210 1 Y 1 B THR 211 ? B THR 184 211 1 Y 1 B SER 212 ? B SER 185 212 1 Y 1 B ASN 213 ? B ASN 186 213 1 Y 1 B VAL 214 ? B VAL 187 214 1 Y 1 B SER 215 ? B SER 188 215 1 Y 1 B GLY 216 ? B GLY 189 216 1 Y 1 B ASN 217 ? B ASN 190 217 1 Y 1 B ALA 218 ? B ALA 191 218 1 Y 1 B THR 219 ? B THR 192 219 1 Y 1 B GLY 220 ? B GLY 193 220 1 Y 1 B ASN 221 ? B ASN 194 221 1 Y 1 B ALA 222 ? B ALA 195 222 1 Y 1 B SER 223 ? B SER 196 223 1 Y 1 B GLY 224 ? B GLY 197 224 1 Y 1 B HIS 225 ? B HIS 198 225 1 Y 1 B ILE 226 ? B ILE 199 226 1 Y 1 B SER 227 ? B SER 200 227 1 Y 1 B ILE 228 ? B ILE 201 228 1 Y 1 B ASN 229 ? B ASN 202 229 1 Y 1 B TRP 230 ? B TRP 203 230 1 Y 1 B SER 231 ? B SER 204 231 1 Y 1 B HIS 232 ? B HIS 205 232 1 Y 1 B PRO 233 ? B PRO 206 233 1 Y 1 B GLN 234 ? B GLN 207 234 1 Y 1 B PHE 235 ? B PHE 208 235 1 Y 1 B GLU 236 ? B GLU 209 236 1 Y 1 B LYS 237 ? B LYS 210 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8RWU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012740 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012740 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008072 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #