data_8RXA # _entry.id 8RXA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.401 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8RXA pdb_00008rxa 10.2210/pdb8rxa/pdb WWPDB D_1292136443 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-03-06 2 'Structure model' 2 0 2024-12-25 3 'Structure model' 2 1 2025-01-22 4 'Structure model' 2 2 2025-01-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Model completeness' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Atomic model' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Polymer sequence' 7 2 'Structure model' 'Refinement description' 8 2 'Structure model' 'Source and taxonomy' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Data collection' 11 3 'Structure model' 'Database references' 12 3 'Structure model' 'Structure summary' 13 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' diffrn 3 2 'Structure model' entity 4 2 'Structure model' entity_poly 5 2 'Structure model' entity_poly_seq 6 2 'Structure model' entity_src_gen 7 2 'Structure model' pdbx_contact_author 8 2 'Structure model' pdbx_entry_details 9 2 'Structure model' pdbx_nonpoly_scheme 10 2 'Structure model' pdbx_poly_seq_scheme 11 2 'Structure model' pdbx_struct_assembly 12 2 'Structure model' pdbx_struct_assembly_gen 13 2 'Structure model' pdbx_struct_assembly_prop 14 2 'Structure model' pdbx_struct_special_symmetry 15 2 'Structure model' pdbx_unobs_or_zero_occ_residues 16 2 'Structure model' pdbx_validate_symm_contact 17 2 'Structure model' refine 18 2 'Structure model' refine_hist 19 2 'Structure model' refine_ls_restr 20 2 'Structure model' refine_ls_shell 21 2 'Structure model' software 22 2 'Structure model' struct_conf 23 2 'Structure model' struct_ref 24 2 'Structure model' struct_ref_seq 25 2 'Structure model' struct_ref_seq_dif 26 3 'Structure model' citation 27 3 'Structure model' citation_author 28 3 'Structure model' diffrn 29 3 'Structure model' struct_keywords 30 4 'Structure model' citation 31 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn.ambient_temp' 2 2 'Structure model' '_entity.formula_weight' 3 2 'Structure model' '_entity.pdbx_number_of_molecules' 4 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 5 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 6 2 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 7 2 'Structure model' '_pdbx_struct_special_symmetry.auth_comp_id' 8 2 'Structure model' '_pdbx_struct_special_symmetry.auth_seq_id' 9 2 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 10 2 'Structure model' '_pdbx_struct_special_symmetry.label_comp_id' 11 2 'Structure model' '_pdbx_struct_special_symmetry.label_seq_id' 12 2 'Structure model' '_refine.ls_R_factor_R_free' 13 2 'Structure model' '_refine.ls_R_factor_R_work' 14 2 'Structure model' '_refine.ls_R_factor_obs' 15 2 'Structure model' '_refine.ls_d_res_high' 16 2 'Structure model' '_refine.ls_d_res_low' 17 2 'Structure model' '_refine.ls_number_reflns_obs' 18 2 'Structure model' '_refine.ls_percent_reflns_obs' 19 2 'Structure model' '_refine.overall_SU_ML' 20 2 'Structure model' '_refine.pdbx_overall_phase_error' 21 2 'Structure model' '_refine.pdbx_solvent_vdw_probe_radii' 22 2 'Structure model' '_refine_hist.d_res_high' 23 2 'Structure model' '_refine_hist.d_res_low' 24 2 'Structure model' '_refine_hist.number_atoms_solvent' 25 2 'Structure model' '_refine_hist.number_atoms_total' 26 2 'Structure model' '_refine_hist.pdbx_number_atoms_protein' 27 2 'Structure model' '_refine_ls_restr.dev_ideal' 28 2 'Structure model' '_refine_ls_restr.number' 29 2 'Structure model' '_refine_ls_shell.R_factor_R_free' 30 2 'Structure model' '_refine_ls_shell.R_factor_R_work' 31 2 'Structure model' '_refine_ls_shell.d_res_high' 32 2 'Structure model' '_refine_ls_shell.d_res_low' 33 2 'Structure model' '_refine_ls_shell.number_reflns_R_work' 34 2 'Structure model' '_software.version' 35 2 'Structure model' '_struct_ref.pdbx_align_begin' 36 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 37 2 'Structure model' '_struct_ref_seq.db_align_beg' 38 2 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 39 2 'Structure model' '_struct_ref_seq.seq_align_beg' 40 2 'Structure model' '_struct_ref_seq.seq_align_end' 41 3 'Structure model' '_citation.country' 42 3 'Structure model' '_citation.journal_abbrev' 43 3 'Structure model' '_citation.journal_id_ISSN' 44 3 'Structure model' '_citation.journal_volume' 45 3 'Structure model' '_citation.page_first' 46 3 'Structure model' '_citation.page_last' 47 3 'Structure model' '_citation.pdbx_database_id_DOI' 48 3 'Structure model' '_citation.pdbx_database_id_PubMed' 49 3 'Structure model' '_citation.title' 50 3 'Structure model' '_citation.year' 51 3 'Structure model' '_diffrn.ambient_temp' 52 3 'Structure model' '_struct_keywords.pdbx_keywords' 53 3 'Structure model' '_struct_keywords.text' 54 4 'Structure model' '_citation.journal_abbrev' 55 4 'Structure model' '_citation.journal_id_ISSN' 56 4 'Structure model' '_citation.pdbx_database_id_PubMed' 57 4 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8RXA _pdbx_database_status.recvd_initial_deposition_date 2024-02-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sylvie.nessler@i2bc.paris-saclay.fr _pdbx_contact_author.name_first Sylvie _pdbx_contact_author.name_last Nessler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4973-9941 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nessler, S.' 1 0000-0003-4973-9941 'Le Berre, M.' 2 0009-0009-0462-0489 'Gallay Li de la Sierra, I.' 3 0000-0003-2770-7439 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 81 _citation.language ? _citation.page_first 38 _citation.page_last 48 _citation.title 'Structural characterization of the ACDC domain from ApiAP2 proteins, a potential molecular target against apicomplexan parasites.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798324012518 _citation.pdbx_database_id_PubMed 39820027 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Le Berre, M.' 1 ? primary 'Tubiana, T.' 2 ? primary 'Reutersward Waldner, P.' 3 ? primary 'Lazar, N.' 4 ? primary 'Li de la Sierra-Gallay, I.' 5 ? primary 'Santos, J.M.' 6 ? primary 'Llinas, M.' 7 ? primary 'Nessler, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'AP2 domain transcription factor AP2-O5, putative' 13068.062 2 ? ? ? ? 2 water nat water 18.015 50 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDEYKTNFIDLTREALSLILQDLKNNVIPKIPVGIEKRERYKNSLRLCLKSARNTQHMNELEPYLELFSECIKNSKLPSH MSLKDQLFYLDKLLENLYFQGVEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDEYKTNFIDLTREALSLILQDLKNNVIPKIPVGIEKRERYKNSLRLCLKSARNTQHMNELEPYLELFSECIKNSKLPSH MSLKDQLFYLDKLLENLYFQGVEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 TYR n 1 5 LYS n 1 6 THR n 1 7 ASN n 1 8 PHE n 1 9 ILE n 1 10 ASP n 1 11 LEU n 1 12 THR n 1 13 ARG n 1 14 GLU n 1 15 ALA n 1 16 LEU n 1 17 SER n 1 18 LEU n 1 19 ILE n 1 20 LEU n 1 21 GLN n 1 22 ASP n 1 23 LEU n 1 24 LYS n 1 25 ASN n 1 26 ASN n 1 27 VAL n 1 28 ILE n 1 29 PRO n 1 30 LYS n 1 31 ILE n 1 32 PRO n 1 33 VAL n 1 34 GLY n 1 35 ILE n 1 36 GLU n 1 37 LYS n 1 38 ARG n 1 39 GLU n 1 40 ARG n 1 41 TYR n 1 42 LYS n 1 43 ASN n 1 44 SER n 1 45 LEU n 1 46 ARG n 1 47 LEU n 1 48 CYS n 1 49 LEU n 1 50 LYS n 1 51 SER n 1 52 ALA n 1 53 ARG n 1 54 ASN n 1 55 THR n 1 56 GLN n 1 57 HIS n 1 58 MET n 1 59 ASN n 1 60 GLU n 1 61 LEU n 1 62 GLU n 1 63 PRO n 1 64 TYR n 1 65 LEU n 1 66 GLU n 1 67 LEU n 1 68 PHE n 1 69 SER n 1 70 GLU n 1 71 CYS n 1 72 ILE n 1 73 LYS n 1 74 ASN n 1 75 SER n 1 76 LYS n 1 77 LEU n 1 78 PRO n 1 79 SER n 1 80 HIS n 1 81 MET n 1 82 SER n 1 83 LEU n 1 84 LYS n 1 85 ASP n 1 86 GLN n 1 87 LEU n 1 88 PHE n 1 89 TYR n 1 90 LEU n 1 91 ASP n 1 92 LYS n 1 93 LEU n 1 94 LEU n 1 95 GLU n 1 96 ASN n 1 97 LEU n 1 98 TYR n 1 99 PHE n 1 100 GLN n 1 101 GLY n 1 102 VAL n 1 103 GLU n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 109 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF3D7_1449500 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum 3D7' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3-Gold _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 623 ? ? ? A . n A 1 2 ASP 2 624 624 ASP ASP A . n A 1 3 GLU 3 625 625 GLU GLU A . n A 1 4 TYR 4 626 626 TYR TYR A . n A 1 5 LYS 5 627 627 LYS LYS A . n A 1 6 THR 6 628 628 THR THR A . n A 1 7 ASN 7 629 629 ASN ASN A . n A 1 8 PHE 8 630 630 PHE PHE A . n A 1 9 ILE 9 631 631 ILE ILE A . n A 1 10 ASP 10 632 632 ASP ASP A . n A 1 11 LEU 11 633 633 LEU LEU A . n A 1 12 THR 12 634 634 THR THR A . n A 1 13 ARG 13 635 635 ARG ARG A . n A 1 14 GLU 14 636 636 GLU GLU A . n A 1 15 ALA 15 637 637 ALA ALA A . n A 1 16 LEU 16 638 638 LEU LEU A . n A 1 17 SER 17 639 639 SER SER A . n A 1 18 LEU 18 640 640 LEU LEU A . n A 1 19 ILE 19 641 641 ILE ILE A . n A 1 20 LEU 20 642 642 LEU LEU A . n A 1 21 GLN 21 643 643 GLN GLN A . n A 1 22 ASP 22 644 644 ASP ASP A . n A 1 23 LEU 23 645 645 LEU LEU A . n A 1 24 LYS 24 646 646 LYS LYS A . n A 1 25 ASN 25 647 647 ASN ASN A . n A 1 26 ASN 26 648 648 ASN ASN A . n A 1 27 VAL 27 649 649 VAL VAL A . n A 1 28 ILE 28 650 650 ILE ILE A . n A 1 29 PRO 29 651 651 PRO PRO A . n A 1 30 LYS 30 652 652 LYS LYS A . n A 1 31 ILE 31 653 653 ILE ILE A . n A 1 32 PRO 32 654 654 PRO PRO A . n A 1 33 VAL 33 655 655 VAL VAL A . n A 1 34 GLY 34 656 656 GLY GLY A . n A 1 35 ILE 35 657 657 ILE ILE A . n A 1 36 GLU 36 658 658 GLU GLU A . n A 1 37 LYS 37 659 659 LYS LYS A . n A 1 38 ARG 38 660 660 ARG ARG A . n A 1 39 GLU 39 661 661 GLU GLU A . n A 1 40 ARG 40 662 662 ARG ARG A . n A 1 41 TYR 41 663 663 TYR TYR A . n A 1 42 LYS 42 664 664 LYS LYS A . n A 1 43 ASN 43 665 665 ASN ASN A . n A 1 44 SER 44 666 666 SER SER A . n A 1 45 LEU 45 667 667 LEU LEU A . n A 1 46 ARG 46 668 668 ARG ARG A . n A 1 47 LEU 47 669 669 LEU LEU A . n A 1 48 CYS 48 670 670 CYS CYS A . n A 1 49 LEU 49 671 671 LEU LEU A . n A 1 50 LYS 50 672 672 LYS LYS A . n A 1 51 SER 51 673 673 SER SER A . n A 1 52 ALA 52 674 674 ALA ALA A . n A 1 53 ARG 53 675 675 ARG ARG A . n A 1 54 ASN 54 676 676 ASN ASN A . n A 1 55 THR 55 677 677 THR THR A . n A 1 56 GLN 56 678 678 GLN GLN A . n A 1 57 HIS 57 679 679 HIS HIS A . n A 1 58 MET 58 680 680 MET MET A . n A 1 59 ASN 59 681 681 ASN ASN A . n A 1 60 GLU 60 682 682 GLU GLU A . n A 1 61 LEU 61 683 683 LEU LEU A . n A 1 62 GLU 62 684 684 GLU GLU A . n A 1 63 PRO 63 685 685 PRO PRO A . n A 1 64 TYR 64 686 686 TYR TYR A . n A 1 65 LEU 65 687 687 LEU LEU A . n A 1 66 GLU 66 688 688 GLU GLU A . n A 1 67 LEU 67 689 689 LEU LEU A . n A 1 68 PHE 68 690 690 PHE PHE A . n A 1 69 SER 69 691 691 SER SER A . n A 1 70 GLU 70 692 692 GLU GLU A . n A 1 71 CYS 71 693 693 CYS CYS A . n A 1 72 ILE 72 694 694 ILE ILE A . n A 1 73 LYS 73 695 695 LYS LYS A . n A 1 74 ASN 74 696 696 ASN ASN A . n A 1 75 SER 75 697 697 SER SER A . n A 1 76 LYS 76 698 698 LYS LYS A . n A 1 77 LEU 77 699 699 LEU LEU A . n A 1 78 PRO 78 700 700 PRO PRO A . n A 1 79 SER 79 701 701 SER SER A . n A 1 80 HIS 80 702 702 HIS HIS A . n A 1 81 MET 81 703 703 MET MET A . n A 1 82 SER 82 704 704 SER SER A . n A 1 83 LEU 83 705 705 LEU LEU A . n A 1 84 LYS 84 706 706 LYS LYS A . n A 1 85 ASP 85 707 707 ASP ASP A . n A 1 86 GLN 86 708 708 GLN GLN A . n A 1 87 LEU 87 709 709 LEU LEU A . n A 1 88 PHE 88 710 710 PHE PHE A . n A 1 89 TYR 89 711 711 TYR TYR A . n A 1 90 LEU 90 712 712 LEU LEU A . n A 1 91 ASP 91 713 713 ASP ASP A . n A 1 92 LYS 92 714 714 LYS LYS A . n A 1 93 LEU 93 715 715 LEU LEU A . n A 1 94 LEU 94 716 716 LEU LEU A . n A 1 95 GLU 95 717 717 GLU GLU A . n A 1 96 ASN 96 718 718 ASN ASN A . n A 1 97 LEU 97 719 719 LEU LEU A . n A 1 98 TYR 98 720 720 TYR TYR A . n A 1 99 PHE 99 721 721 PHE PHE A . n A 1 100 GLN 100 722 722 GLN GLN A . n A 1 101 GLY 101 723 723 GLY GLY A . n A 1 102 VAL 102 724 724 VAL VAL A . n A 1 103 GLU 103 725 725 GLU GLU A . n A 1 104 HIS 104 726 ? ? ? A . n A 1 105 HIS 105 727 ? ? ? A . n A 1 106 HIS 106 728 ? ? ? A . n A 1 107 HIS 107 729 ? ? ? A . n A 1 108 HIS 108 730 ? ? ? A . n A 1 109 HIS 109 731 ? ? ? A . n B 1 1 MET 1 623 ? ? ? B . n B 1 2 ASP 2 624 624 ASP ASP B . n B 1 3 GLU 3 625 625 GLU GLU B . n B 1 4 TYR 4 626 626 TYR TYR B . n B 1 5 LYS 5 627 627 LYS LYS B . n B 1 6 THR 6 628 628 THR THR B . n B 1 7 ASN 7 629 629 ASN ASN B . n B 1 8 PHE 8 630 630 PHE PHE B . n B 1 9 ILE 9 631 631 ILE ILE B . n B 1 10 ASP 10 632 632 ASP ASP B . n B 1 11 LEU 11 633 633 LEU LEU B . n B 1 12 THR 12 634 634 THR THR B . n B 1 13 ARG 13 635 635 ARG ARG B . n B 1 14 GLU 14 636 636 GLU GLU B . n B 1 15 ALA 15 637 637 ALA ALA B . n B 1 16 LEU 16 638 638 LEU LEU B . n B 1 17 SER 17 639 639 SER SER B . n B 1 18 LEU 18 640 640 LEU LEU B . n B 1 19 ILE 19 641 641 ILE ILE B . n B 1 20 LEU 20 642 642 LEU LEU B . n B 1 21 GLN 21 643 643 GLN GLN B . n B 1 22 ASP 22 644 644 ASP ASP B . n B 1 23 LEU 23 645 645 LEU LEU B . n B 1 24 LYS 24 646 646 LYS LYS B . n B 1 25 ASN 25 647 647 ASN ASN B . n B 1 26 ASN 26 648 648 ASN ASN B . n B 1 27 VAL 27 649 649 VAL VAL B . n B 1 28 ILE 28 650 650 ILE ILE B . n B 1 29 PRO 29 651 651 PRO PRO B . n B 1 30 LYS 30 652 652 LYS LYS B . n B 1 31 ILE 31 653 653 ILE ILE B . n B 1 32 PRO 32 654 654 PRO PRO B . n B 1 33 VAL 33 655 655 VAL VAL B . n B 1 34 GLY 34 656 656 GLY GLY B . n B 1 35 ILE 35 657 657 ILE ILE B . n B 1 36 GLU 36 658 658 GLU GLU B . n B 1 37 LYS 37 659 659 LYS LYS B . n B 1 38 ARG 38 660 660 ARG ARG B . n B 1 39 GLU 39 661 661 GLU GLU B . n B 1 40 ARG 40 662 662 ARG ARG B . n B 1 41 TYR 41 663 663 TYR TYR B . n B 1 42 LYS 42 664 664 LYS LYS B . n B 1 43 ASN 43 665 665 ASN ASN B . n B 1 44 SER 44 666 666 SER SER B . n B 1 45 LEU 45 667 667 LEU LEU B . n B 1 46 ARG 46 668 668 ARG ARG B . n B 1 47 LEU 47 669 669 LEU LEU B . n B 1 48 CYS 48 670 670 CYS CYS B . n B 1 49 LEU 49 671 671 LEU LEU B . n B 1 50 LYS 50 672 672 LYS LYS B . n B 1 51 SER 51 673 673 SER SER B . n B 1 52 ALA 52 674 674 ALA ALA B . n B 1 53 ARG 53 675 675 ARG ARG B . n B 1 54 ASN 54 676 676 ASN ASN B . n B 1 55 THR 55 677 677 THR THR B . n B 1 56 GLN 56 678 678 GLN GLN B . n B 1 57 HIS 57 679 679 HIS HIS B . n B 1 58 MET 58 680 680 MET MET B . n B 1 59 ASN 59 681 681 ASN ASN B . n B 1 60 GLU 60 682 682 GLU GLU B . n B 1 61 LEU 61 683 683 LEU LEU B . n B 1 62 GLU 62 684 684 GLU GLU B . n B 1 63 PRO 63 685 685 PRO PRO B . n B 1 64 TYR 64 686 686 TYR TYR B . n B 1 65 LEU 65 687 687 LEU LEU B . n B 1 66 GLU 66 688 688 GLU GLU B . n B 1 67 LEU 67 689 689 LEU LEU B . n B 1 68 PHE 68 690 690 PHE PHE B . n B 1 69 SER 69 691 691 SER SER B . n B 1 70 GLU 70 692 692 GLU GLU B . n B 1 71 CYS 71 693 693 CYS CYS B . n B 1 72 ILE 72 694 694 ILE ILE B . n B 1 73 LYS 73 695 695 LYS LYS B . n B 1 74 ASN 74 696 696 ASN ASN B . n B 1 75 SER 75 697 697 SER SER B . n B 1 76 LYS 76 698 698 LYS LYS B . n B 1 77 LEU 77 699 699 LEU LEU B . n B 1 78 PRO 78 700 700 PRO PRO B . n B 1 79 SER 79 701 701 SER SER B . n B 1 80 HIS 80 702 702 HIS HIS B . n B 1 81 MET 81 703 703 MET MET B . n B 1 82 SER 82 704 704 SER SER B . n B 1 83 LEU 83 705 705 LEU LEU B . n B 1 84 LYS 84 706 706 LYS LYS B . n B 1 85 ASP 85 707 707 ASP ASP B . n B 1 86 GLN 86 708 708 GLN GLN B . n B 1 87 LEU 87 709 709 LEU LEU B . n B 1 88 PHE 88 710 710 PHE PHE B . n B 1 89 TYR 89 711 711 TYR TYR B . n B 1 90 LEU 90 712 712 LEU LEU B . n B 1 91 ASP 91 713 713 ASP ASP B . n B 1 92 LYS 92 714 714 LYS LYS B . n B 1 93 LEU 93 715 715 LEU LEU B . n B 1 94 LEU 94 716 716 LEU LEU B . n B 1 95 GLU 95 717 717 GLU GLU B . n B 1 96 ASN 96 718 718 ASN ASN B . n B 1 97 LEU 97 719 ? ? ? B . n B 1 98 TYR 98 720 ? ? ? B . n B 1 99 PHE 99 721 ? ? ? B . n B 1 100 GLN 100 722 ? ? ? B . n B 1 101 GLY 101 723 ? ? ? B . n B 1 102 VAL 102 724 ? ? ? B . n B 1 103 GLU 103 725 ? ? ? B . n B 1 104 HIS 104 726 ? ? ? B . n B 1 105 HIS 105 727 ? ? ? B . n B 1 106 HIS 106 728 ? ? ? B . n B 1 107 HIS 107 729 ? ? ? B . n B 1 108 HIS 108 730 ? ? ? B . n B 1 109 HIS 109 731 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 801 2 HOH HOH A . C 2 HOH 2 802 48 HOH HOH A . C 2 HOH 3 803 35 HOH HOH A . C 2 HOH 4 804 20 HOH HOH A . C 2 HOH 5 805 53 HOH HOH A . C 2 HOH 6 806 27 HOH HOH A . C 2 HOH 7 807 3 HOH HOH A . C 2 HOH 8 808 14 HOH HOH A . C 2 HOH 9 809 11 HOH HOH A . C 2 HOH 10 810 22 HOH HOH A . C 2 HOH 11 811 36 HOH HOH A . C 2 HOH 12 812 29 HOH HOH A . C 2 HOH 13 813 19 HOH HOH A . C 2 HOH 14 814 37 HOH HOH A . C 2 HOH 15 815 60 HOH HOH A . C 2 HOH 16 816 7 HOH HOH A . C 2 HOH 17 817 24 HOH HOH A . D 2 HOH 1 801 28 HOH HOH B . D 2 HOH 2 802 44 HOH HOH B . D 2 HOH 3 803 38 HOH HOH B . D 2 HOH 4 804 57 HOH HOH B . D 2 HOH 5 805 61 HOH HOH B . D 2 HOH 6 806 54 HOH HOH B . D 2 HOH 7 807 41 HOH HOH B . D 2 HOH 8 808 58 HOH HOH B . D 2 HOH 9 809 23 HOH HOH B . D 2 HOH 10 810 4 HOH HOH B . D 2 HOH 11 811 15 HOH HOH B . D 2 HOH 12 812 13 HOH HOH B . D 2 HOH 13 813 32 HOH HOH B . D 2 HOH 14 814 8 HOH HOH B . D 2 HOH 15 815 6 HOH HOH B . D 2 HOH 16 816 17 HOH HOH B . D 2 HOH 17 817 30 HOH HOH B . D 2 HOH 18 818 10 HOH HOH B . D 2 HOH 19 819 42 HOH HOH B . D 2 HOH 20 820 49 HOH HOH B . D 2 HOH 21 821 31 HOH HOH B . D 2 HOH 22 822 39 HOH HOH B . D 2 HOH 23 823 9 HOH HOH B . D 2 HOH 24 824 26 HOH HOH B . D 2 HOH 25 825 12 HOH HOH B . D 2 HOH 26 826 51 HOH HOH B . D 2 HOH 27 827 56 HOH HOH B . D 2 HOH 28 828 21 HOH HOH B . D 2 HOH 29 829 5 HOH HOH B . D 2 HOH 30 830 33 HOH HOH B . D 2 HOH 31 831 25 HOH HOH B . D 2 HOH 32 832 62 HOH HOH B . D 2 HOH 33 833 47 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21.2_5419: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8RXA _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.930 _cell.length_a_esd ? _cell.length_b 108.930 _cell.length_b_esd ? _cell.length_c 34.010 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8RXA _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8RXA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG400, 0.1 M MES pH 6.5, 0.1 M Sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-06-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.980112 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.980112 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8RXA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22718 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059000000000000004 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9990000000000001 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.055999999999999994 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.75 1.86 ? ? ? ? ? ? 3510 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.9740000000000001 ? ? 1 1 0.941 ? ? ? ? 0.937 ? ? ? ? ? ? ? ? ? 1.86 1.99 ? ? ? ? ? ? 3408 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.542 ? ? 2 1 0.986 ? ? ? ? 0.522 ? ? ? ? ? ? ? ? ? 1.99 2.14 ? ? ? ? ? ? 3203 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.27699999999999997 ? ? 3 1 0.9940000000000001 ? ? ? ? 0.265 ? ? ? ? ? ? ? ? ? 2.14 2.35 ? ? ? ? ? ? 2917 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.14800000000000002 ? ? 4 1 0.997 ? ? ? ? 0.14300000000000002 ? ? ? ? ? ? ? ? ? 2.35 2.62 ? ? ? ? ? ? 2699 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.092 ? ? 5 1 0.998 ? ? ? ? 0.08800000000000001 ? ? ? ? ? ? ? ? ? 2.62 3.03 ? ? ? ? ? ? 2353 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.063 ? ? 6 1 0.9990000000000001 ? ? ? ? 0.06 ? ? ? ? ? ? ? ? ? 3.03 3.7 ? ? ? ? ? ? 2043 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.047 ? ? 7 1 0.9990000000000001 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? ? 3.70 5.21 ? ? ? ? ? ? 1612 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.039 ? ? 8 1 0.9990000000000001 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8RXA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 40.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22658 _refine.ls_number_reflns_R_free 2099 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.12 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2096 _refine.ls_R_factor_R_free 0.2397 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2080 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.61 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.20 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 40.00 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 1688 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1638 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.787 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 20.041 ? 678 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 255 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 289 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.75 1.79 . . 131 2514 91.00 . . . . 0.3208 . . . . . . . . . . . 0.3540 'X-RAY DIFFRACTION' 1.79 1.84 . . 145 2682 99.00 . . . . 0.2861 . . . . . . . . . . . 0.3396 'X-RAY DIFFRACTION' 1.84 1.89 . . 143 2683 100.00 . . . . 0.2606 . . . . . . . . . . . 0.2511 'X-RAY DIFFRACTION' 1.89 1.94 . . 140 2634 99.00 . . . . 0.2416 . . . . . . . . . . . 0.3045 'X-RAY DIFFRACTION' 1.94 2.00 . . 143 2742 100.00 . . . . 0.2466 . . . . . . . . . . . 0.2690 'X-RAY DIFFRACTION' 2.00 2.08 . . 139 2639 99.00 . . . . 0.2265 . . . . . . . . . . . 0.2517 'X-RAY DIFFRACTION' 2.08 2.16 . . 138 2669 100.00 . . . . 0.2188 . . . . . . . . . . . 0.2402 'X-RAY DIFFRACTION' 2.16 2.26 . . 142 2743 100.00 . . . . 0.2109 . . . . . . . . . . . 0.2473 'X-RAY DIFFRACTION' 2.26 2.38 . . 141 2658 100.00 . . . . 0.2108 . . . . . . . . . . . 0.2910 'X-RAY DIFFRACTION' 2.38 2.53 . . 134 2693 100.00 . . . . 0.2377 . . . . . . . . . . . 0.2595 'X-RAY DIFFRACTION' 2.53 2.72 . . 144 2722 100.00 . . . . 0.2224 . . . . . . . . . . . 0.2735 'X-RAY DIFFRACTION' 2.72 2.99 . . 134 2675 100.00 . . . . 0.2277 . . . . . . . . . . . 0.2744 'X-RAY DIFFRACTION' 2.99 3.43 . . 143 2705 100.00 . . . . 0.2215 . . . . . . . . . . . 0.2856 'X-RAY DIFFRACTION' 3.43 4.32 . . 143 2694 100.00 . . . . 0.1824 . . . . . . . . . . . 0.2090 'X-RAY DIFFRACTION' 4.32 40. . . 139 2697 100.00 . . . . 0.1798 . . . . . . . . . . . 0.1854 # _struct.entry_id 8RXA _struct.title 'ACDC domain of AP2-O5 from Plasmodium falciparum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8RXA _struct_keywords.text 'AP2-coincident domain mainly at the C-terminus, Orthogonal four helix bundle, TRANSCRIPTION, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IKY0_PLAF7 _struct_ref.pdbx_db_accession Q8IKY0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DEYKTNFIDLTREALSLILQDLKNNVIPKIPVGIEKRERYKNSLRLCLKSARNTQHMNELEPYLELFSECIKNSKLPSHM SLKDQLFYLDKL ; _struct_ref.pdbx_align_begin 624 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8RXA A 2 ? 93 ? Q8IKY0 624 ? 715 ? 624 715 2 1 8RXA B 2 ? 93 ? Q8IKY0 624 ? 715 ? 624 715 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8RXA MET A 1 ? UNP Q8IKY0 ? ? 'initiating methionine' 623 1 1 8RXA LEU A 94 ? UNP Q8IKY0 ? ? 'expression tag' 716 2 1 8RXA GLU A 95 ? UNP Q8IKY0 ? ? 'expression tag' 717 3 1 8RXA ASN A 96 ? UNP Q8IKY0 ? ? 'expression tag' 718 4 1 8RXA LEU A 97 ? UNP Q8IKY0 ? ? 'expression tag' 719 5 1 8RXA TYR A 98 ? UNP Q8IKY0 ? ? 'expression tag' 720 6 1 8RXA PHE A 99 ? UNP Q8IKY0 ? ? 'expression tag' 721 7 1 8RXA GLN A 100 ? UNP Q8IKY0 ? ? 'expression tag' 722 8 1 8RXA GLY A 101 ? UNP Q8IKY0 ? ? 'expression tag' 723 9 1 8RXA VAL A 102 ? UNP Q8IKY0 ? ? 'expression tag' 724 10 1 8RXA GLU A 103 ? UNP Q8IKY0 ? ? 'expression tag' 725 11 1 8RXA HIS A 104 ? UNP Q8IKY0 ? ? 'expression tag' 726 12 1 8RXA HIS A 105 ? UNP Q8IKY0 ? ? 'expression tag' 727 13 1 8RXA HIS A 106 ? UNP Q8IKY0 ? ? 'expression tag' 728 14 1 8RXA HIS A 107 ? UNP Q8IKY0 ? ? 'expression tag' 729 15 1 8RXA HIS A 108 ? UNP Q8IKY0 ? ? 'expression tag' 730 16 1 8RXA HIS A 109 ? UNP Q8IKY0 ? ? 'expression tag' 731 17 2 8RXA MET B 1 ? UNP Q8IKY0 ? ? 'initiating methionine' 623 18 2 8RXA LEU B 94 ? UNP Q8IKY0 ? ? 'expression tag' 716 19 2 8RXA GLU B 95 ? UNP Q8IKY0 ? ? 'expression tag' 717 20 2 8RXA ASN B 96 ? UNP Q8IKY0 ? ? 'expression tag' 718 21 2 8RXA LEU B 97 ? UNP Q8IKY0 ? ? 'expression tag' 719 22 2 8RXA TYR B 98 ? UNP Q8IKY0 ? ? 'expression tag' 720 23 2 8RXA PHE B 99 ? UNP Q8IKY0 ? ? 'expression tag' 721 24 2 8RXA GLN B 100 ? UNP Q8IKY0 ? ? 'expression tag' 722 25 2 8RXA GLY B 101 ? UNP Q8IKY0 ? ? 'expression tag' 723 26 2 8RXA VAL B 102 ? UNP Q8IKY0 ? ? 'expression tag' 724 27 2 8RXA GLU B 103 ? UNP Q8IKY0 ? ? 'expression tag' 725 28 2 8RXA HIS B 104 ? UNP Q8IKY0 ? ? 'expression tag' 726 29 2 8RXA HIS B 105 ? UNP Q8IKY0 ? ? 'expression tag' 727 30 2 8RXA HIS B 106 ? UNP Q8IKY0 ? ? 'expression tag' 728 31 2 8RXA HIS B 107 ? UNP Q8IKY0 ? ? 'expression tag' 729 32 2 8RXA HIS B 108 ? UNP Q8IKY0 ? ? 'expression tag' 730 33 2 8RXA HIS B 109 ? UNP Q8IKY0 ? ? 'expression tag' 731 34 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Eluted as a monomer on a SEC column.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 4 ? VAL A 27 ? TYR A 626 VAL A 649 1 ? 24 HELX_P HELX_P2 AA2 GLY A 34 ? ARG A 53 ? GLY A 656 ARG A 675 1 ? 20 HELX_P HELX_P3 AA3 HIS A 57 ? GLU A 60 ? HIS A 679 GLU A 682 5 ? 4 HELX_P HELX_P4 AA4 LEU A 61 ? PHE A 68 ? LEU A 683 PHE A 690 1 ? 8 HELX_P HELX_P5 AA5 PHE A 68 ? ASN A 74 ? PHE A 690 ASN A 696 1 ? 7 HELX_P HELX_P6 AA6 LEU A 77 ? MET A 81 ? LEU A 699 MET A 703 5 ? 5 HELX_P HELX_P7 AA7 SER A 82 ? GLY A 101 ? SER A 704 GLY A 723 1 ? 20 HELX_P HELX_P8 AA8 TYR B 4 ? ASN B 26 ? TYR B 626 ASN B 648 1 ? 23 HELX_P HELX_P9 AA9 VAL B 27 ? ILE B 31 ? VAL B 649 ILE B 653 5 ? 5 HELX_P HELX_P10 AB1 GLY B 34 ? THR B 55 ? GLY B 656 THR B 677 1 ? 22 HELX_P HELX_P11 AB2 HIS B 57 ? GLU B 60 ? HIS B 679 GLU B 682 5 ? 4 HELX_P HELX_P12 AB3 LEU B 61 ? PHE B 68 ? LEU B 683 PHE B 690 1 ? 8 HELX_P HELX_P13 AB4 PHE B 68 ? SER B 75 ? PHE B 690 SER B 697 1 ? 8 HELX_P HELX_P14 AB5 LEU B 77 ? MET B 81 ? LEU B 699 MET B 703 5 ? 5 HELX_P HELX_P15 AB6 SER B 82 ? ASN B 96 ? SER B 704 ASN B 718 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 8RXA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 833 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 623 ? A MET 1 2 1 Y 1 A HIS 726 ? A HIS 104 3 1 Y 1 A HIS 727 ? A HIS 105 4 1 Y 1 A HIS 728 ? A HIS 106 5 1 Y 1 A HIS 729 ? A HIS 107 6 1 Y 1 A HIS 730 ? A HIS 108 7 1 Y 1 A HIS 731 ? A HIS 109 8 1 Y 1 B MET 623 ? B MET 1 9 1 Y 1 B LEU 719 ? B LEU 97 10 1 Y 1 B TYR 720 ? B TYR 98 11 1 Y 1 B PHE 721 ? B PHE 99 12 1 Y 1 B GLN 722 ? B GLN 100 13 1 Y 1 B GLY 723 ? B GLY 101 14 1 Y 1 B VAL 724 ? B VAL 102 15 1 Y 1 B GLU 725 ? B GLU 103 16 1 Y 1 B HIS 726 ? B HIS 104 17 1 Y 1 B HIS 727 ? B HIS 105 18 1 Y 1 B HIS 728 ? B HIS 106 19 1 Y 1 B HIS 729 ? B HIS 107 20 1 Y 1 B HIS 730 ? B HIS 108 21 1 Y 1 B HIS 731 ? B HIS 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8RXA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016969 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009180 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029403 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #