data_8SDW # _entry.id 8SDW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8SDW pdb_00008sdw 10.2210/pdb8sdw/pdb WWPDB D_1000273577 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-28 2 'Structure model' 1 1 2024-04-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8SDW _pdbx_database_status.recvd_initial_deposition_date 2023-04-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category CASP _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email randazzp@mail.nih.gov _pdbx_contact_author.name_first Paul _pdbx_contact_author.name_last Randazzo _pdbx_contact_author.name_mi A _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5349-0881 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Rosenberg Jr., E.M.' 1 ? 'Randazzo, P.A.' 2 ? 'Esser, L.' 3 ? 'Xia, D.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos One' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1932-6203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 19 _citation.language ? _citation.page_first e0295103 _citation.page_last e0295103 _citation.title ;Point mutations in Arf1 reveal cooperative effects of the N-terminal extension and myristate for GTPase-activating protein catalytic activity. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.pone.0295103 _citation.pdbx_database_id_PubMed 38574162 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rosenberg Jr., E.M.' 1 0000-0001-9016-3839 primary 'Jian, X.' 2 ? primary 'Soubias, O.' 3 ? primary 'Jackson, R.A.' 4 0000-0002-9195-3186 primary 'Gladu, E.' 5 ? primary 'Andersen, E.' 6 ? primary 'Esser, L.' 7 ? primary 'Sodt, A.J.' 8 ? primary 'Xia, D.' 9 ? primary 'Byrd, R.A.' 10 0000-0003-3625-4232 primary 'Randazzo, P.A.' 11 0000-0001-5349-0881 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ADP-ribosylation factor 1' 20737.764 1 3.6.5.2 L8K ? ? 2 non-polymer syn "GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE" 523.180 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 296 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGNIFANKFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH YFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCA TSGDGLYEGLDWLSNQLRNQK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGNIFANKFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH YFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCA TSGDGLYEGLDWLSNQLRNQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE" G3D 3 'MAGNESIUM ION' MG 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 ILE n 1 5 PHE n 1 6 ALA n 1 7 ASN n 1 8 LYS n 1 9 PHE n 1 10 LYS n 1 11 GLY n 1 12 LEU n 1 13 PHE n 1 14 GLY n 1 15 LYS n 1 16 LYS n 1 17 GLU n 1 18 MET n 1 19 ARG n 1 20 ILE n 1 21 LEU n 1 22 MET n 1 23 VAL n 1 24 GLY n 1 25 LEU n 1 26 ASP n 1 27 ALA n 1 28 ALA n 1 29 GLY n 1 30 LYS n 1 31 THR n 1 32 THR n 1 33 ILE n 1 34 LEU n 1 35 TYR n 1 36 LYS n 1 37 LEU n 1 38 LYS n 1 39 LEU n 1 40 GLY n 1 41 GLU n 1 42 ILE n 1 43 VAL n 1 44 THR n 1 45 THR n 1 46 ILE n 1 47 PRO n 1 48 THR n 1 49 ILE n 1 50 GLY n 1 51 PHE n 1 52 ASN n 1 53 VAL n 1 54 GLU n 1 55 THR n 1 56 VAL n 1 57 GLU n 1 58 TYR n 1 59 LYS n 1 60 ASN n 1 61 ILE n 1 62 SER n 1 63 PHE n 1 64 THR n 1 65 VAL n 1 66 TRP n 1 67 ASP n 1 68 VAL n 1 69 GLY n 1 70 GLY n 1 71 GLN n 1 72 ASP n 1 73 LYS n 1 74 ILE n 1 75 ARG n 1 76 PRO n 1 77 LEU n 1 78 TRP n 1 79 ARG n 1 80 HIS n 1 81 TYR n 1 82 PHE n 1 83 GLN n 1 84 ASN n 1 85 THR n 1 86 GLN n 1 87 GLY n 1 88 LEU n 1 89 ILE n 1 90 PHE n 1 91 VAL n 1 92 VAL n 1 93 ASP n 1 94 SER n 1 95 ASN n 1 96 ASP n 1 97 ARG n 1 98 GLU n 1 99 ARG n 1 100 VAL n 1 101 ASN n 1 102 GLU n 1 103 ALA n 1 104 ARG n 1 105 GLU n 1 106 GLU n 1 107 LEU n 1 108 MET n 1 109 ARG n 1 110 MET n 1 111 LEU n 1 112 ALA n 1 113 GLU n 1 114 ASP n 1 115 GLU n 1 116 LEU n 1 117 ARG n 1 118 ASP n 1 119 ALA n 1 120 VAL n 1 121 LEU n 1 122 LEU n 1 123 VAL n 1 124 PHE n 1 125 ALA n 1 126 ASN n 1 127 LYS n 1 128 GLN n 1 129 ASP n 1 130 LEU n 1 131 PRO n 1 132 ASN n 1 133 ALA n 1 134 MET n 1 135 ASN n 1 136 ALA n 1 137 ALA n 1 138 GLU n 1 139 ILE n 1 140 THR n 1 141 ASP n 1 142 LYS n 1 143 LEU n 1 144 GLY n 1 145 LEU n 1 146 HIS n 1 147 SER n 1 148 LEU n 1 149 ARG n 1 150 HIS n 1 151 ARG n 1 152 ASN n 1 153 TRP n 1 154 TYR n 1 155 ILE n 1 156 GLN n 1 157 ALA n 1 158 THR n 1 159 CYS n 1 160 ALA n 1 161 THR n 1 162 SER n 1 163 GLY n 1 164 ASP n 1 165 GLY n 1 166 LEU n 1 167 TYR n 1 168 GLU n 1 169 GLY n 1 170 LEU n 1 171 ASP n 1 172 TRP n 1 173 LEU n 1 174 SER n 1 175 ASN n 1 176 GLN n 1 177 LEU n 1 178 ARG n 1 179 ASN n 1 180 GLN n 1 181 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 181 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ARF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL-21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G3D non-polymer . "GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ASN 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 ? ? ? A . n A 1 71 GLN 71 71 ? ? ? A . n A 1 72 ASP 72 72 ? ? ? A . n A 1 73 LYS 73 73 ? ? ? A . n A 1 74 ILE 74 74 ? ? ? A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 TRP 153 153 153 TRP TRP A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 TRP 172 172 172 TRP TRP A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 GLN 180 180 180 GLN GLN A . n A 1 181 LYS 181 181 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 G3D 1 201 1 G3D G3D A . C 3 MG 1 202 2 MG MG A . D 4 HOH 1 301 282 HOH HOH A . D 4 HOH 2 302 262 HOH HOH A . D 4 HOH 3 303 104 HOH HOH A . D 4 HOH 4 304 130 HOH HOH A . D 4 HOH 5 305 55 HOH HOH A . D 4 HOH 6 306 164 HOH HOH A . D 4 HOH 7 307 18 HOH HOH A . D 4 HOH 8 308 189 HOH HOH A . D 4 HOH 9 309 7 HOH HOH A . D 4 HOH 10 310 64 HOH HOH A . D 4 HOH 11 311 85 HOH HOH A . D 4 HOH 12 312 86 HOH HOH A . D 4 HOH 13 313 105 HOH HOH A . D 4 HOH 14 314 206 HOH HOH A . D 4 HOH 15 315 113 HOH HOH A . D 4 HOH 16 316 184 HOH HOH A . D 4 HOH 17 317 212 HOH HOH A . D 4 HOH 18 318 245 HOH HOH A . D 4 HOH 19 319 114 HOH HOH A . D 4 HOH 20 320 61 HOH HOH A . D 4 HOH 21 321 207 HOH HOH A . D 4 HOH 22 322 112 HOH HOH A . D 4 HOH 23 323 127 HOH HOH A . D 4 HOH 24 324 258 HOH HOH A . D 4 HOH 25 325 201 HOH HOH A . D 4 HOH 26 326 77 HOH HOH A . D 4 HOH 27 327 181 HOH HOH A . D 4 HOH 28 328 154 HOH HOH A . D 4 HOH 29 329 227 HOH HOH A . D 4 HOH 30 330 269 HOH HOH A . D 4 HOH 31 331 132 HOH HOH A . D 4 HOH 32 332 240 HOH HOH A . D 4 HOH 33 333 93 HOH HOH A . D 4 HOH 34 334 3 HOH HOH A . D 4 HOH 35 335 75 HOH HOH A . D 4 HOH 36 336 20 HOH HOH A . D 4 HOH 37 337 103 HOH HOH A . D 4 HOH 38 338 216 HOH HOH A . D 4 HOH 39 339 83 HOH HOH A . D 4 HOH 40 340 32 HOH HOH A . D 4 HOH 41 341 4 HOH HOH A . D 4 HOH 42 342 89 HOH HOH A . D 4 HOH 43 343 60 HOH HOH A . D 4 HOH 44 344 148 HOH HOH A . D 4 HOH 45 345 238 HOH HOH A . D 4 HOH 46 346 253 HOH HOH A . D 4 HOH 47 347 151 HOH HOH A . D 4 HOH 48 348 47 HOH HOH A . D 4 HOH 49 349 42 HOH HOH A . D 4 HOH 50 350 241 HOH HOH A . D 4 HOH 51 351 265 HOH HOH A . D 4 HOH 52 352 234 HOH HOH A . D 4 HOH 53 353 136 HOH HOH A . D 4 HOH 54 354 273 HOH HOH A . D 4 HOH 55 355 2 HOH HOH A . D 4 HOH 56 356 97 HOH HOH A . D 4 HOH 57 357 24 HOH HOH A . D 4 HOH 58 358 249 HOH HOH A . D 4 HOH 59 359 23 HOH HOH A . D 4 HOH 60 360 78 HOH HOH A . D 4 HOH 61 361 5 HOH HOH A . D 4 HOH 62 362 283 HOH HOH A . D 4 HOH 63 363 140 HOH HOH A . D 4 HOH 64 364 179 HOH HOH A . D 4 HOH 65 365 256 HOH HOH A . D 4 HOH 66 366 288 HOH HOH A . D 4 HOH 67 367 214 HOH HOH A . D 4 HOH 68 368 41 HOH HOH A . D 4 HOH 69 369 174 HOH HOH A . D 4 HOH 70 370 91 HOH HOH A . D 4 HOH 71 371 68 HOH HOH A . D 4 HOH 72 372 248 HOH HOH A . D 4 HOH 73 373 28 HOH HOH A . D 4 HOH 74 374 289 HOH HOH A . D 4 HOH 75 375 110 HOH HOH A . D 4 HOH 76 376 129 HOH HOH A . D 4 HOH 77 377 202 HOH HOH A . D 4 HOH 78 378 35 HOH HOH A . D 4 HOH 79 379 53 HOH HOH A . D 4 HOH 80 380 8 HOH HOH A . D 4 HOH 81 381 25 HOH HOH A . D 4 HOH 82 382 59 HOH HOH A . D 4 HOH 83 383 296 HOH HOH A . D 4 HOH 84 384 133 HOH HOH A . D 4 HOH 85 385 149 HOH HOH A . D 4 HOH 86 386 56 HOH HOH A . D 4 HOH 87 387 11 HOH HOH A . D 4 HOH 88 388 232 HOH HOH A . D 4 HOH 89 389 63 HOH HOH A . D 4 HOH 90 390 17 HOH HOH A . D 4 HOH 91 391 108 HOH HOH A . D 4 HOH 92 392 266 HOH HOH A . D 4 HOH 93 393 229 HOH HOH A . D 4 HOH 94 394 9 HOH HOH A . D 4 HOH 95 395 29 HOH HOH A . D 4 HOH 96 396 244 HOH HOH A . D 4 HOH 97 397 209 HOH HOH A . D 4 HOH 98 398 50 HOH HOH A . D 4 HOH 99 399 37 HOH HOH A . D 4 HOH 100 400 19 HOH HOH A . D 4 HOH 101 401 168 HOH HOH A . D 4 HOH 102 402 171 HOH HOH A . D 4 HOH 103 403 106 HOH HOH A . D 4 HOH 104 404 292 HOH HOH A . D 4 HOH 105 405 43 HOH HOH A . D 4 HOH 106 406 27 HOH HOH A . D 4 HOH 107 407 38 HOH HOH A . D 4 HOH 108 408 26 HOH HOH A . D 4 HOH 109 409 177 HOH HOH A . D 4 HOH 110 410 99 HOH HOH A . D 4 HOH 111 411 118 HOH HOH A . D 4 HOH 112 412 67 HOH HOH A . D 4 HOH 113 413 173 HOH HOH A . D 4 HOH 114 414 128 HOH HOH A . D 4 HOH 115 415 12 HOH HOH A . D 4 HOH 116 416 163 HOH HOH A . D 4 HOH 117 417 250 HOH HOH A . D 4 HOH 118 418 10 HOH HOH A . D 4 HOH 119 419 219 HOH HOH A . D 4 HOH 120 420 160 HOH HOH A . D 4 HOH 121 421 45 HOH HOH A . D 4 HOH 122 422 94 HOH HOH A . D 4 HOH 123 423 221 HOH HOH A . D 4 HOH 124 424 54 HOH HOH A . D 4 HOH 125 425 16 HOH HOH A . D 4 HOH 126 426 14 HOH HOH A . D 4 HOH 127 427 73 HOH HOH A . D 4 HOH 128 428 36 HOH HOH A . D 4 HOH 129 429 242 HOH HOH A . D 4 HOH 130 430 153 HOH HOH A . D 4 HOH 131 431 71 HOH HOH A . D 4 HOH 132 432 141 HOH HOH A . D 4 HOH 133 433 217 HOH HOH A . D 4 HOH 134 434 210 HOH HOH A . D 4 HOH 135 435 100 HOH HOH A . D 4 HOH 136 436 172 HOH HOH A . D 4 HOH 137 437 79 HOH HOH A . D 4 HOH 138 438 48 HOH HOH A . D 4 HOH 139 439 203 HOH HOH A . D 4 HOH 140 440 66 HOH HOH A . D 4 HOH 141 441 193 HOH HOH A . D 4 HOH 142 442 259 HOH HOH A . D 4 HOH 143 443 80 HOH HOH A . D 4 HOH 144 444 21 HOH HOH A . D 4 HOH 145 445 82 HOH HOH A . D 4 HOH 146 446 6 HOH HOH A . D 4 HOH 147 447 33 HOH HOH A . D 4 HOH 148 448 46 HOH HOH A . D 4 HOH 149 449 81 HOH HOH A . D 4 HOH 150 450 213 HOH HOH A . D 4 HOH 151 451 52 HOH HOH A . D 4 HOH 152 452 178 HOH HOH A . D 4 HOH 153 453 1 HOH HOH A . D 4 HOH 154 454 191 HOH HOH A . D 4 HOH 155 455 109 HOH HOH A . D 4 HOH 156 456 116 HOH HOH A . D 4 HOH 157 457 40 HOH HOH A . D 4 HOH 158 458 138 HOH HOH A . D 4 HOH 159 459 76 HOH HOH A . D 4 HOH 160 460 286 HOH HOH A . D 4 HOH 161 461 49 HOH HOH A . D 4 HOH 162 462 124 HOH HOH A . D 4 HOH 163 463 30 HOH HOH A . D 4 HOH 164 464 101 HOH HOH A . D 4 HOH 165 465 239 HOH HOH A . D 4 HOH 166 466 176 HOH HOH A . D 4 HOH 167 467 51 HOH HOH A . D 4 HOH 168 468 57 HOH HOH A . D 4 HOH 169 469 22 HOH HOH A . D 4 HOH 170 470 34 HOH HOH A . D 4 HOH 171 471 13 HOH HOH A . D 4 HOH 172 472 95 HOH HOH A . D 4 HOH 173 473 270 HOH HOH A . D 4 HOH 174 474 155 HOH HOH A . D 4 HOH 175 475 284 HOH HOH A . D 4 HOH 176 476 31 HOH HOH A . D 4 HOH 177 477 145 HOH HOH A . D 4 HOH 178 478 228 HOH HOH A . D 4 HOH 179 479 285 HOH HOH A . D 4 HOH 180 480 15 HOH HOH A . D 4 HOH 181 481 123 HOH HOH A . D 4 HOH 182 482 65 HOH HOH A . D 4 HOH 183 483 150 HOH HOH A . D 4 HOH 184 484 272 HOH HOH A . D 4 HOH 185 485 215 HOH HOH A . D 4 HOH 186 486 161 HOH HOH A . D 4 HOH 187 487 264 HOH HOH A . D 4 HOH 188 488 225 HOH HOH A . D 4 HOH 189 489 126 HOH HOH A . D 4 HOH 190 490 196 HOH HOH A . D 4 HOH 191 491 39 HOH HOH A . D 4 HOH 192 492 287 HOH HOH A . D 4 HOH 193 493 170 HOH HOH A . D 4 HOH 194 494 125 HOH HOH A . D 4 HOH 195 495 274 HOH HOH A . D 4 HOH 196 496 143 HOH HOH A . D 4 HOH 197 497 263 HOH HOH A . D 4 HOH 198 498 257 HOH HOH A . D 4 HOH 199 499 146 HOH HOH A . D 4 HOH 200 500 294 HOH HOH A . D 4 HOH 201 501 233 HOH HOH A . D 4 HOH 202 502 226 HOH HOH A . D 4 HOH 203 503 205 HOH HOH A . D 4 HOH 204 504 131 HOH HOH A . D 4 HOH 205 505 98 HOH HOH A . D 4 HOH 206 506 185 HOH HOH A . D 4 HOH 207 507 267 HOH HOH A . D 4 HOH 208 508 84 HOH HOH A . D 4 HOH 209 509 260 HOH HOH A . D 4 HOH 210 510 70 HOH HOH A . D 4 HOH 211 511 247 HOH HOH A . D 4 HOH 212 512 152 HOH HOH A . D 4 HOH 213 513 180 HOH HOH A . D 4 HOH 214 514 137 HOH HOH A . D 4 HOH 215 515 280 HOH HOH A . D 4 HOH 216 516 167 HOH HOH A . D 4 HOH 217 517 222 HOH HOH A . D 4 HOH 218 518 200 HOH HOH A . D 4 HOH 219 519 74 HOH HOH A . D 4 HOH 220 520 120 HOH HOH A . D 4 HOH 221 521 290 HOH HOH A . D 4 HOH 222 522 208 HOH HOH A . D 4 HOH 223 523 165 HOH HOH A . D 4 HOH 224 524 111 HOH HOH A . D 4 HOH 225 525 175 HOH HOH A . D 4 HOH 226 526 252 HOH HOH A . D 4 HOH 227 527 58 HOH HOH A . D 4 HOH 228 528 281 HOH HOH A . D 4 HOH 229 529 135 HOH HOH A . D 4 HOH 230 530 278 HOH HOH A . D 4 HOH 231 531 88 HOH HOH A . D 4 HOH 232 532 198 HOH HOH A . D 4 HOH 233 533 115 HOH HOH A . D 4 HOH 234 534 139 HOH HOH A . D 4 HOH 235 535 235 HOH HOH A . D 4 HOH 236 536 186 HOH HOH A . D 4 HOH 237 537 195 HOH HOH A . D 4 HOH 238 538 102 HOH HOH A . D 4 HOH 239 539 246 HOH HOH A . D 4 HOH 240 540 157 HOH HOH A . D 4 HOH 241 541 147 HOH HOH A . D 4 HOH 242 542 156 HOH HOH A . D 4 HOH 243 543 261 HOH HOH A . D 4 HOH 244 544 223 HOH HOH A . D 4 HOH 245 545 291 HOH HOH A . D 4 HOH 246 546 194 HOH HOH A . D 4 HOH 247 547 122 HOH HOH A . D 4 HOH 248 548 134 HOH HOH A . D 4 HOH 249 549 197 HOH HOH A . D 4 HOH 250 550 142 HOH HOH A . D 4 HOH 251 551 72 HOH HOH A . D 4 HOH 252 552 87 HOH HOH A . D 4 HOH 253 553 117 HOH HOH A . D 4 HOH 254 554 144 HOH HOH A . D 4 HOH 255 555 254 HOH HOH A . D 4 HOH 256 556 62 HOH HOH A . D 4 HOH 257 557 255 HOH HOH A . D 4 HOH 258 558 218 HOH HOH A . D 4 HOH 259 559 276 HOH HOH A . D 4 HOH 260 560 187 HOH HOH A . D 4 HOH 261 561 188 HOH HOH A . D 4 HOH 262 562 192 HOH HOH A . D 4 HOH 263 563 169 HOH HOH A . D 4 HOH 264 564 268 HOH HOH A . D 4 HOH 265 565 293 HOH HOH A . D 4 HOH 266 566 182 HOH HOH A . D 4 HOH 267 567 96 HOH HOH A . D 4 HOH 268 568 220 HOH HOH A . D 4 HOH 269 569 119 HOH HOH A . D 4 HOH 270 570 236 HOH HOH A . D 4 HOH 271 571 199 HOH HOH A . D 4 HOH 272 572 90 HOH HOH A . D 4 HOH 273 573 162 HOH HOH A . D 4 HOH 274 574 183 HOH HOH A . D 4 HOH 275 575 159 HOH HOH A . D 4 HOH 276 576 277 HOH HOH A . D 4 HOH 277 577 211 HOH HOH A . D 4 HOH 278 578 190 HOH HOH A . D 4 HOH 279 579 158 HOH HOH A . D 4 HOH 280 580 231 HOH HOH A . D 4 HOH 281 581 121 HOH HOH A . D 4 HOH 282 582 44 HOH HOH A . D 4 HOH 283 583 275 HOH HOH A . D 4 HOH 284 584 69 HOH HOH A . D 4 HOH 285 585 166 HOH HOH A . D 4 HOH 286 586 92 HOH HOH A . D 4 HOH 287 587 271 HOH HOH A . D 4 HOH 288 588 243 HOH HOH A . D 4 HOH 289 589 224 HOH HOH A . D 4 HOH 290 590 251 HOH HOH A . D 4 HOH 291 591 279 HOH HOH A . D 4 HOH 292 592 107 HOH HOH A . D 4 HOH 293 593 204 HOH HOH A . D 4 HOH 294 594 237 HOH HOH A . D 4 HOH 295 595 295 HOH HOH A . D 4 HOH 296 596 230 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 38 ? CE ? A LYS 38 CE 2 1 Y 1 A LYS 38 ? NZ ? A LYS 38 NZ 3 1 Y 1 A ARG 75 ? CG ? A ARG 75 CG 4 1 Y 1 A ARG 75 ? CD ? A ARG 75 CD 5 1 Y 1 A ARG 75 ? NE ? A ARG 75 NE 6 1 Y 1 A ARG 75 ? CZ ? A ARG 75 CZ 7 1 Y 1 A ARG 75 ? NH1 ? A ARG 75 NH1 8 1 Y 1 A ARG 75 ? NH2 ? A ARG 75 NH2 9 1 Y 1 A LEU 77 ? CG ? A LEU 77 CG 10 1 Y 1 A LEU 77 ? CD1 ? A LEU 77 CD1 11 1 Y 1 A LEU 77 ? CD2 ? A LEU 77 CD2 12 1 Y 1 A ARG 79 ? CG ? A ARG 79 CG 13 1 Y 1 A ARG 79 ? CD ? A ARG 79 CD 14 1 Y 1 A ARG 79 ? NE ? A ARG 79 NE 15 1 Y 1 A ARG 79 ? CZ ? A ARG 79 CZ 16 1 Y 1 A ARG 79 ? NH1 ? A ARG 79 NH1 17 1 Y 1 A ARG 79 ? NH2 ? A ARG 79 NH2 18 1 Y 1 A HIS 80 ? CG ? A HIS 80 CG 19 1 Y 1 A HIS 80 ? ND1 ? A HIS 80 ND1 20 1 Y 1 A HIS 80 ? CD2 ? A HIS 80 CD2 21 1 Y 1 A HIS 80 ? CE1 ? A HIS 80 CE1 22 1 Y 1 A HIS 80 ? NE2 ? A HIS 80 NE2 23 1 Y 1 A ARG 109 ? CG ? A ARG 109 CG 24 1 Y 1 A ARG 109 ? CD ? A ARG 109 CD 25 1 Y 1 A ARG 109 ? NE ? A ARG 109 NE 26 1 Y 1 A ARG 109 ? CZ ? A ARG 109 CZ 27 1 Y 1 A ARG 109 ? NH1 ? A ARG 109 NH1 28 1 Y 1 A ARG 109 ? NH2 ? A ARG 109 NH2 29 1 Y 1 A ARG 117 ? CG ? A ARG 117 CG 30 1 Y 1 A ARG 117 ? CD ? A ARG 117 CD 31 1 Y 1 A ARG 117 ? NE ? A ARG 117 NE 32 1 Y 1 A ARG 117 ? CZ ? A ARG 117 CZ 33 1 Y 1 A ARG 117 ? NH1 ? A ARG 117 NH1 34 1 Y 1 A ARG 117 ? NH2 ? A ARG 117 NH2 35 1 Y 1 A ARG 149 ? CG ? A ARG 149 CG 36 1 Y 1 A ARG 149 ? CD ? A ARG 149 CD 37 1 Y 1 A ARG 149 ? NE ? A ARG 149 NE 38 1 Y 1 A ARG 149 ? CZ ? A ARG 149 CZ 39 1 Y 1 A ARG 149 ? NH1 ? A ARG 149 NH1 40 1 Y 1 A ARG 149 ? NH2 ? A ARG 149 NH2 41 1 Y 1 A HIS 150 ? CG ? A HIS 150 CG 42 1 Y 1 A HIS 150 ? ND1 ? A HIS 150 ND1 43 1 Y 1 A HIS 150 ? CD2 ? A HIS 150 CD2 44 1 Y 1 A HIS 150 ? CE1 ? A HIS 150 CE1 45 1 Y 1 A HIS 150 ? NE2 ? A HIS 150 NE2 46 1 Y 1 A GLN 180 ? CG ? A GLN 180 CG 47 1 Y 1 A GLN 180 ? CD ? A GLN 180 CD 48 1 Y 1 A GLN 180 ? OE1 ? A GLN 180 OE1 49 1 Y 1 A GLN 180 ? NE2 ? A GLN 180 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20rc3-4406 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8SDW _cell.details ? _cell.formula_units_Z ? _cell.length_a 41.654 _cell.length_a_esd ? _cell.length_b 55.015 _cell.length_b_esd ? _cell.length_c 78.472 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8SDW _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8SDW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.26 _exptl_crystal.description 'Needle-like crystals' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium nitrate, 20% w/v Polyethylene glycol 3,350, pH 6.8' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8SDW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18613 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.10 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.981 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.75 1.78 ? ? ? ? ? ? 819 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 1 0.976 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.78 1.81 ? ? ? ? ? ? 918 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 0.983 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.81 1.85 ? ? ? ? ? ? 912 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3 1 0.986 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.85 1.89 ? ? ? ? ? ? 924 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4 1 0.988 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.89 1.93 ? ? ? ? ? ? 911 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5 1 0.992 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.93 1.97 ? ? ? ? ? ? 936 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6 1 0.992 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.97 2.02 ? ? ? ? ? ? 918 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7 1 0.990 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.02 2.07 ? ? ? ? ? ? 923 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8 1 0.993 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.07 2.14 ? ? ? ? ? ? 926 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9 1 0.994 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.14 2.20 ? ? ? ? ? ? 915 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 0.995 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.20 2.28 ? ? ? ? ? ? 924 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 0.995 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.28 2.38 ? ? ? ? ? ? 923 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 0.996 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.38 2.48 ? ? ? ? ? ? 954 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.48 2.61 ? ? ? ? ? ? 939 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.61 2.78 ? ? ? ? ? ? 936 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 0.996 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.78 2.99 ? ? ? ? ? ? 938 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 0.996 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.99 3.29 ? ? ? ? ? ? 935 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3.29 3.77 ? ? ? ? ? ? 948 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3.77 4.75 ? ? ? ? ? ? 979 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4.75 50 ? ? ? ? ? ? 1035 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 0.997 ? ? ? ? ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8SDW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 39.24 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18573 _refine.ls_number_reflns_R_free ? _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.96 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.21 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1322 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 296 _refine_hist.number_atoms_total 1651 _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 39.24 # _refine_ls_shell.R_factor_R_free 0.2323 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2151 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.d_res_high 1.75 _refine_ls_shell.d_res_low 1.81 _refine_ls_shell.number_reflns_R_free 1852 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? # _struct.entry_id 8SDW _struct.title 'Crystal structure of the non-myristoylated mutant [L8K]Arf1 in complex with a GDP analogue' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag Y # _struct_keywords.entry_id 8SDW _struct_keywords.text 'GTPase, G protein, GDP, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARF1_HUMAN _struct_ref.pdbx_db_accession P84077 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH YFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCA TSGDGLYEGLDWLSNQLRNQK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8SDW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P84077 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8SDW _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 8 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P84077 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 8 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 8 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 29 ? LYS A 38 ? GLY A 29 LYS A 38 1 ? 10 HELX_P HELX_P2 AA2 PRO A 76 ? ASN A 84 ? PRO A 76 ASN A 84 1 ? 9 HELX_P HELX_P3 AA3 ASP A 96 ? GLU A 98 ? ASP A 96 GLU A 98 5 ? 3 HELX_P HELX_P4 AA4 ARG A 99 ? ALA A 112 ? ARG A 99 ALA A 112 1 ? 14 HELX_P HELX_P5 AA5 GLU A 113 ? ARG A 117 ? GLU A 113 ARG A 117 5 ? 5 HELX_P HELX_P6 AA6 ASN A 135 ? GLY A 144 ? ASN A 135 GLY A 144 1 ? 10 HELX_P HELX_P7 AA7 LEU A 145 ? LEU A 148 ? LEU A 145 LEU A 148 5 ? 4 HELX_P HELX_P8 AA8 GLY A 165 ? ASN A 179 ? GLY A 165 ASN A 179 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A THR 31 OG1 ? ? ? 1_555 C MG . MG ? ? A THR 31 A MG 202 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc2 metalc ? ? B G3D . O2B ? ? ? 1_555 C MG . MG ? ? A G3D 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.159 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 334 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 341 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 453 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 202 A HOH 471 1_555 ? ? ? ? ? ? ? 2.100 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG1 ? A THR 31 ? A THR 31 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O2B ? B G3D . ? A G3D 201 ? 1_555 85.0 ? 2 OG1 ? A THR 31 ? A THR 31 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 334 ? 1_555 176.6 ? 3 O2B ? B G3D . ? A G3D 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 334 ? 1_555 95.5 ? 4 OG1 ? A THR 31 ? A THR 31 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 341 ? 1_555 88.4 ? 5 O2B ? B G3D . ? A G3D 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 341 ? 1_555 86.1 ? 6 O ? D HOH . ? A HOH 334 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 341 ? 1_555 88.3 ? 7 OG1 ? A THR 31 ? A THR 31 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 453 ? 1_555 91.8 ? 8 O2B ? B G3D . ? A G3D 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 453 ? 1_555 92.7 ? 9 O ? D HOH . ? A HOH 334 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 453 ? 1_555 91.5 ? 10 O ? D HOH . ? A HOH 341 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 453 ? 1_555 178.8 ? 11 OG1 ? A THR 31 ? A THR 31 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 471 ? 1_555 90.4 ? 12 O2B ? B G3D . ? A G3D 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 471 ? 1_555 172.6 ? 13 O ? D HOH . ? A HOH 334 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 471 ? 1_555 88.9 ? 14 O ? D HOH . ? A HOH 341 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 471 ? 1_555 88.0 ? 15 O ? D HOH . ? A HOH 453 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? D HOH . ? A HOH 471 ? 1_555 93.2 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 43 ? THR A 48 ? VAL A 43 THR A 48 AA1 2 PHE A 51 ? TYR A 58 ? PHE A 51 TYR A 58 AA1 3 ILE A 61 ? ASP A 67 ? ILE A 61 ASP A 67 AA1 4 MET A 18 ? GLY A 24 ? MET A 18 GLY A 24 AA1 5 GLY A 87 ? ASP A 93 ? GLY A 87 ASP A 93 AA1 6 VAL A 120 ? ASN A 126 ? VAL A 120 ASN A 126 AA1 7 TRP A 153 ? ALA A 157 ? TRP A 153 ALA A 157 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 45 ? N THR A 45 O VAL A 53 ? O VAL A 53 AA1 2 3 N VAL A 56 ? N VAL A 56 O PHE A 63 ? O PHE A 63 AA1 3 4 O THR A 64 ? O THR A 64 N MET A 22 ? N MET A 22 AA1 4 5 N LEU A 21 ? N LEU A 21 O ILE A 89 ? O ILE A 89 AA1 5 6 N LEU A 88 ? N LEU A 88 O VAL A 120 ? O VAL A 120 AA1 6 7 N VAL A 123 ? N VAL A 123 O GLN A 156 ? O GLN A 156 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 59 ? ? 48.77 -113.97 2 1 LYS A 127 ? ? 70.42 35.41 # _pdbx_entry_details.entry_id 8SDW _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 596 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.53 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ASN 3 ? A ASN 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A GLY 70 ? A GLY 70 7 1 Y 1 A GLN 71 ? A GLN 71 8 1 Y 1 A ASP 72 ? A ASP 72 9 1 Y 1 A LYS 73 ? A LYS 73 10 1 Y 1 A ILE 74 ? A ILE 74 11 1 Y 1 A LYS 181 ? A LYS 181 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 G3D PB P N N 88 G3D O1B O N N 89 G3D O2B O N N 90 G3D O3B O N N 91 G3D PA P N S 92 G3D O3A O N N 93 G3D O1A O N N 94 G3D O2A O N N 95 G3D "O5'" O N N 96 G3D "C5'" C N N 97 G3D "C4'" C N R 98 G3D "O4'" O N N 99 G3D "C3'" C N S 100 G3D "O3'" O N N 101 G3D "C2'" C N R 102 G3D "O2'" O N N 103 G3D "C1'" C N R 104 G3D N9 N Y N 105 G3D C8 C Y N 106 G3D N7 N Y N 107 G3D C5 C Y N 108 G3D C6 C N N 109 G3D O6 O N N 110 G3D N1 N N N 111 G3D C2 C N N 112 G3D N2 N N N 113 G3D N3 N N N 114 G3D C4 C Y N 115 G3D P1 P N N 116 G3D O4P O N N 117 G3D O5P O N N 118 G3D O6P O N N 119 G3D HOB2 H N N 120 G3D HOB3 H N N 121 G3D HOA2 H N N 122 G3D "H5'1" H N N 123 G3D "H5'2" H N N 124 G3D "H4'" H N N 125 G3D "H3'" H N N 126 G3D "H2'" H N N 127 G3D "HO2'" H N N 128 G3D "H1'" H N N 129 G3D H8 H N N 130 G3D HN1 H N N 131 G3D HN21 H N N 132 G3D HN22 H N N 133 G3D HO4P H N N 134 G3D HO5P H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 MG MG MG N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 G3D PB O1B doub N N 83 G3D PB O2B sing N N 84 G3D PB O3B sing N N 85 G3D PB O3A sing N N 86 G3D O2B HOB2 sing N N 87 G3D O3B HOB3 sing N N 88 G3D PA O3A sing N N 89 G3D PA O1A doub N N 90 G3D PA O2A sing N N 91 G3D PA "O5'" sing N N 92 G3D O2A HOA2 sing N N 93 G3D "O5'" "C5'" sing N N 94 G3D "C5'" "C4'" sing N N 95 G3D "C5'" "H5'1" sing N N 96 G3D "C5'" "H5'2" sing N N 97 G3D "C4'" "O4'" sing N N 98 G3D "C4'" "C3'" sing N N 99 G3D "C4'" "H4'" sing N N 100 G3D "O4'" "C1'" sing N N 101 G3D "C3'" "O3'" sing N N 102 G3D "C3'" "C2'" sing N N 103 G3D "C3'" "H3'" sing N N 104 G3D "O3'" P1 sing N N 105 G3D "C2'" "O2'" sing N N 106 G3D "C2'" "C1'" sing N N 107 G3D "C2'" "H2'" sing N N 108 G3D "O2'" "HO2'" sing N N 109 G3D "C1'" N9 sing N N 110 G3D "C1'" "H1'" sing N N 111 G3D N9 C8 sing Y N 112 G3D N9 C4 sing Y N 113 G3D C8 N7 doub Y N 114 G3D C8 H8 sing N N 115 G3D N7 C5 sing Y N 116 G3D C5 C6 sing N N 117 G3D C5 C4 doub Y N 118 G3D C6 O6 doub N N 119 G3D C6 N1 sing N N 120 G3D N1 C2 sing N N 121 G3D N1 HN1 sing N N 122 G3D C2 N2 sing N N 123 G3D C2 N3 doub N N 124 G3D N2 HN21 sing N N 125 G3D N2 HN22 sing N N 126 G3D N3 C4 sing N N 127 G3D P1 O4P sing N N 128 G3D P1 O5P sing N N 129 G3D P1 O6P doub N N 130 G3D O4P HO4P sing N N 131 G3D O5P HO5P sing N N 132 GLN N CA sing N N 133 GLN N H sing N N 134 GLN N H2 sing N N 135 GLN CA C sing N N 136 GLN CA CB sing N N 137 GLN CA HA sing N N 138 GLN C O doub N N 139 GLN C OXT sing N N 140 GLN CB CG sing N N 141 GLN CB HB2 sing N N 142 GLN CB HB3 sing N N 143 GLN CG CD sing N N 144 GLN CG HG2 sing N N 145 GLN CG HG3 sing N N 146 GLN CD OE1 doub N N 147 GLN CD NE2 sing N N 148 GLN NE2 HE21 sing N N 149 GLN NE2 HE22 sing N N 150 GLN OXT HXT sing N N 151 GLU N CA sing N N 152 GLU N H sing N N 153 GLU N H2 sing N N 154 GLU CA C sing N N 155 GLU CA CB sing N N 156 GLU CA HA sing N N 157 GLU C O doub N N 158 GLU C OXT sing N N 159 GLU CB CG sing N N 160 GLU CB HB2 sing N N 161 GLU CB HB3 sing N N 162 GLU CG CD sing N N 163 GLU CG HG2 sing N N 164 GLU CG HG3 sing N N 165 GLU CD OE1 doub N N 166 GLU CD OE2 sing N N 167 GLU OE2 HE2 sing N N 168 GLU OXT HXT sing N N 169 GLY N CA sing N N 170 GLY N H sing N N 171 GLY N H2 sing N N 172 GLY CA C sing N N 173 GLY CA HA2 sing N N 174 GLY CA HA3 sing N N 175 GLY C O doub N N 176 GLY C OXT sing N N 177 GLY OXT HXT sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number BC007365 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 G3D ? ? G3D ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1HUR _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8SDW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.024007 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018177 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012743 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O P S # loop_