data_8SEM # _entry.id 8SEM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8SEM pdb_00008sem 10.2210/pdb8sem/pdb WWPDB D_1000273664 ? ? BMRB 31079 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 51901 unspecified BMRB ;Structural and functional characterisation of Tst2, a novel TRPV1 inhibitory peptide from the Australian sea anemone Telmatactis stephensoni ; 31079 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8SEM _pdbx_database_status.recvd_initial_deposition_date 2023-04-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Elnahriry, K.A.' 1 0000-0002-4378-1228 'Wai, D.C.C.' 2 0000-0003-1545-0269 'Norton, R.S.' 3 0000-0001-8893-0584 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochim Biophys Acta Proteins Proteom' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1878-1454 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1872 _citation.language ? _citation.page_first 140952 _citation.page_last ? _citation.title ;Structural and functional characterisation of Tst2, a novel TRPV1 inhibitory peptide from the Australian sea anemone Telmatactis stephensoni. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2023.140952 _citation.pdbx_database_id_PubMed 37640250 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Elnahriry, K.A.' 1 ? primary 'Wai, D.C.C.' 2 ? primary 'Ashwood, L.M.' 3 ? primary 'Naseem, M.U.' 4 ? primary 'Szanto, T.G.' 5 ? primary 'Guo, S.' 6 ? primary 'Panyi, G.' 7 ? primary 'Prentis, P.J.' 8 ? primary 'Norton, R.S.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRPV1 inhibitory peptide Tst2' _entity.formula_weight 4035.715 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GCKGQDAPCSKSKDCCGEASMCSKGADGKKTCMIDKLWG _entity_poly.pdbx_seq_one_letter_code_can GCKGQDAPCSKSKDCCGEASMCSKGADGKKTCMIDKLWG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 CYS n 1 3 LYS n 1 4 GLY n 1 5 GLN n 1 6 ASP n 1 7 ALA n 1 8 PRO n 1 9 CYS n 1 10 SER n 1 11 LYS n 1 12 SER n 1 13 LYS n 1 14 ASP n 1 15 CYS n 1 16 CYS n 1 17 GLY n 1 18 GLU n 1 19 ALA n 1 20 SER n 1 21 MET n 1 22 CYS n 1 23 SER n 1 24 LYS n 1 25 GLY n 1 26 ALA n 1 27 ASP n 1 28 GLY n 1 29 LYS n 1 30 LYS n 1 31 THR n 1 32 CYS n 1 33 MET n 1 34 ILE n 1 35 ASP n 1 36 LYS n 1 37 LEU n 1 38 TRP n 1 39 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 39 _entity_src_gen.gene_src_common_name 'sea anemones' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Telmatactis stephensoni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2835637 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8SEM _struct_ref.pdbx_db_accession 8SEM _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8SEM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8SEM _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.55 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '550 uM [U-100% 13C; U-100% 15N] Tst2, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label Tst2 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8SEM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 8SEM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8SEM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement 'X-PLOR NIH' 2.48 'Schwieters, Kuszewski, Tjandra and Clore' 2 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Sparky 3.134 Goddard 4 'peak picking' Sparky 3.134 Goddard # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8SEM _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8SEM _struct.title ;Structural and functional characterisation of Tst2, a novel TRPV1 inhibitory peptide from the Australian sea anemone Telmatactis stephensoni ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8SEM _struct_keywords.text 'sea anemone, disulfide-rich peptides, ICK scaffold, TRPV1 channel inhibitor, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 15 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 11 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 15 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 2 A CYS 16 1_555 ? ? ? ? ? ? ? 1.973 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 9 A CYS 22 1_555 ? ? ? ? ? ? ? 2.115 ? ? disulf3 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 9 A CYS 32 1_555 ? ? ? ? ? ? ? 2.787 ? ? disulf4 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 15 A CYS 32 1_555 ? ? ? ? ? ? ? 1.959 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 22 ? LYS A 24 ? CYS A 22 LYS A 24 AA1 2 LYS A 30 ? CYS A 32 ? LYS A 30 CYS A 32 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id THR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 31 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id THR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 31 # _atom_sites.entry_id 8SEM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 GLY 39 39 39 GLY GLY A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email ray.norton@monash.edu _pdbx_contact_author.name_first Raymond _pdbx_contact_author.name_last Norton _pdbx_contact_author.name_mi S. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8893-0584 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_entry_details.entry_id 8SEM _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component Tst2 _pdbx_nmr_exptl_sample.concentration 550 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 19 ? ? -145.83 35.13 2 1 SER A 23 ? ? -128.32 -169.82 3 1 ALA A 26 ? ? -140.81 -41.75 4 1 ASP A 27 ? ? -97.99 34.50 5 1 LYS A 29 ? ? -56.94 -179.82 6 1 MET A 33 ? ? -144.69 53.81 7 1 ILE A 34 ? ? -51.45 171.15 8 1 TRP A 38 ? ? -77.95 -72.74 9 2 CYS A 2 ? ? -49.97 150.10 10 2 CYS A 16 ? ? -88.38 39.28 11 2 GLU A 18 ? ? -51.26 -74.61 12 2 ALA A 19 ? ? -96.44 32.99 13 2 SER A 23 ? ? -125.77 -169.54 14 2 MET A 33 ? ? -148.58 51.66 15 2 ASP A 35 ? ? -141.10 35.71 16 3 ALA A 26 ? ? -141.68 -41.73 17 3 ASP A 27 ? ? -95.41 34.42 18 3 LYS A 29 ? ? -57.93 -177.37 19 3 MET A 33 ? ? -145.35 56.53 20 3 ILE A 34 ? ? -55.23 178.44 21 3 ASP A 35 ? ? -141.94 35.19 22 4 LYS A 3 ? ? -68.46 -174.94 23 4 LYS A 11 ? ? -126.81 -76.26 24 4 SER A 12 ? ? 176.12 -50.55 25 4 ALA A 19 ? ? -145.88 34.64 26 4 ALA A 26 ? ? -131.06 -40.76 27 4 MET A 33 ? ? -117.15 55.94 28 5 ALA A 26 ? ? -144.08 -42.01 29 5 ASP A 27 ? ? -96.16 35.67 30 5 LYS A 29 ? ? -58.94 -176.98 31 5 MET A 33 ? ? -142.69 55.32 32 5 ILE A 34 ? ? -51.54 170.67 33 6 CYS A 16 ? ? -85.07 45.63 34 6 ILE A 34 ? ? -52.40 172.49 35 7 LYS A 3 ? ? -65.33 -169.32 36 7 LYS A 11 ? ? -127.67 -75.97 37 7 SER A 12 ? ? 175.69 -50.83 38 7 MET A 33 ? ? -118.35 56.23 39 7 ILE A 34 ? ? -49.90 165.14 40 7 LEU A 37 ? ? -94.41 35.48 41 7 TRP A 38 ? ? -128.67 -55.13 42 8 SER A 20 ? ? -66.91 -177.96 43 8 MET A 21 ? ? -171.90 127.72 44 8 ILE A 34 ? ? -52.24 172.52 45 9 ALA A 26 ? ? -95.20 32.09 46 9 ASP A 27 ? ? -151.77 26.83 47 9 LYS A 29 ? ? -66.90 -171.16 48 10 LYS A 3 ? ? -69.10 -178.62 49 10 ALA A 26 ? ? -145.48 -43.24 50 10 ASP A 27 ? ? -95.94 36.22 51 10 LYS A 29 ? ? -62.67 -171.70 52 10 MET A 33 ? ? -147.66 56.25 53 10 LEU A 37 ? ? -103.84 -63.25 54 11 LYS A 3 ? ? -69.33 -178.57 55 11 ALA A 19 ? ? -142.21 35.55 56 11 MET A 21 ? ? -172.21 142.48 57 11 ALA A 26 ? ? -141.66 -41.77 58 11 ASP A 27 ? ? -95.50 34.42 59 11 LYS A 29 ? ? -59.30 -173.63 60 11 ILE A 34 ? ? -52.24 172.39 61 11 LYS A 36 ? ? -51.14 106.43 62 11 LEU A 37 ? ? -92.20 -76.95 63 11 TRP A 38 ? ? 179.74 36.10 64 12 LYS A 3 ? ? -61.86 -165.77 65 12 LYS A 11 ? ? -128.98 -74.66 66 12 SER A 12 ? ? 175.68 -48.95 67 12 LYS A 29 ? ? -72.46 -169.43 68 12 ILE A 34 ? ? -49.86 165.92 69 12 ASP A 35 ? ? -166.58 38.05 70 12 LEU A 37 ? ? -100.31 -65.38 71 13 LYS A 3 ? ? -64.35 -174.70 72 13 LYS A 11 ? ? -130.54 -74.91 73 13 SER A 12 ? ? 176.74 -48.74 74 13 SER A 20 ? ? -52.84 171.50 75 13 ASP A 27 ? ? 178.55 -32.88 76 13 ASP A 35 ? ? -153.94 37.38 77 13 TRP A 38 ? ? -78.07 -72.90 78 14 LYS A 3 ? ? -66.69 -176.39 79 14 LYS A 11 ? ? -130.68 -75.03 80 14 SER A 12 ? ? 171.48 -48.33 81 14 CYS A 16 ? ? -89.44 34.49 82 14 ALA A 19 ? ? -94.91 34.79 83 14 SER A 23 ? ? -124.86 -169.48 84 14 ALA A 26 ? ? -126.44 -62.32 85 14 CYS A 32 ? ? -53.77 174.79 86 14 ILE A 34 ? ? -48.78 162.16 87 15 CYS A 2 ? ? -171.27 131.35 88 15 LYS A 11 ? ? -130.36 -74.85 89 15 SER A 12 ? ? 175.69 -51.45 90 15 CYS A 16 ? ? -83.56 48.57 91 15 MET A 33 ? ? -114.99 60.65 92 15 ILE A 34 ? ? -49.68 162.97 93 15 LYS A 36 ? ? -55.50 107.12 94 15 TRP A 38 ? ? -85.82 -70.88 95 16 LYS A 3 ? ? -60.51 -178.53 96 16 LYS A 11 ? ? -130.25 -75.23 97 16 SER A 12 ? ? 176.85 -50.07 98 16 MET A 21 ? ? 179.83 163.25 99 16 SER A 23 ? ? -153.98 56.22 100 16 LYS A 24 ? ? 55.39 -178.66 101 16 MET A 33 ? ? -115.95 53.99 102 16 ASP A 35 ? ? -142.63 47.59 103 17 LYS A 11 ? ? -131.80 -73.82 104 17 SER A 12 ? ? 172.69 -50.60 105 17 CYS A 16 ? ? -89.25 38.75 106 17 GLU A 18 ? ? -52.07 -74.76 107 17 ALA A 19 ? ? -94.96 34.59 108 17 MET A 21 ? ? 179.08 147.27 109 17 SER A 23 ? ? -129.37 -169.86 110 17 ALA A 26 ? ? -132.27 -39.97 111 17 ILE A 34 ? ? -49.60 167.08 112 18 SER A 23 ? ? -123.06 -169.18 113 18 ALA A 26 ? ? -136.78 -40.99 114 18 ASP A 27 ? ? -99.58 32.81 115 18 MET A 33 ? ? -154.18 50.15 116 18 ILE A 34 ? ? -52.84 172.07 117 18 ASP A 35 ? ? -145.64 36.50 118 18 LYS A 36 ? ? -51.65 102.84 119 18 TRP A 38 ? ? 46.87 80.80 120 19 LYS A 3 ? ? -69.09 -179.96 121 19 LYS A 11 ? ? -130.38 -75.55 122 19 SER A 12 ? ? 178.59 -53.77 123 19 ALA A 19 ? ? -141.32 34.97 124 19 ALA A 26 ? ? 72.94 -67.21 125 19 MET A 33 ? ? -117.11 54.01 126 19 LEU A 37 ? ? -94.44 35.30 127 20 SER A 23 ? ? -126.09 -169.64 128 20 ALA A 26 ? ? -140.28 -41.70 129 20 ASP A 27 ? ? -98.66 33.95 130 20 MET A 33 ? ? -141.90 54.59 131 20 ILE A 34 ? ? -54.58 171.02 132 20 ASP A 35 ? ? -147.60 37.10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLU N N N N 64 GLU CA C N S 65 GLU C C N N 66 GLU O O N N 67 GLU CB C N N 68 GLU CG C N N 69 GLU CD C N N 70 GLU OE1 O N N 71 GLU OE2 O N N 72 GLU OXT O N N 73 GLU H H N N 74 GLU H2 H N N 75 GLU HA H N N 76 GLU HB2 H N N 77 GLU HB3 H N N 78 GLU HG2 H N N 79 GLU HG3 H N N 80 GLU HE2 H N N 81 GLU HXT H N N 82 GLY N N N N 83 GLY CA C N N 84 GLY C C N N 85 GLY O O N N 86 GLY OXT O N N 87 GLY H H N N 88 GLY H2 H N N 89 GLY HA2 H N N 90 GLY HA3 H N N 91 GLY HXT H N N 92 ILE N N N N 93 ILE CA C N S 94 ILE C C N N 95 ILE O O N N 96 ILE CB C N S 97 ILE CG1 C N N 98 ILE CG2 C N N 99 ILE CD1 C N N 100 ILE OXT O N N 101 ILE H H N N 102 ILE H2 H N N 103 ILE HA H N N 104 ILE HB H N N 105 ILE HG12 H N N 106 ILE HG13 H N N 107 ILE HG21 H N N 108 ILE HG22 H N N 109 ILE HG23 H N N 110 ILE HD11 H N N 111 ILE HD12 H N N 112 ILE HD13 H N N 113 ILE HXT H N N 114 LEU N N N N 115 LEU CA C N S 116 LEU C C N N 117 LEU O O N N 118 LEU CB C N N 119 LEU CG C N N 120 LEU CD1 C N N 121 LEU CD2 C N N 122 LEU OXT O N N 123 LEU H H N N 124 LEU H2 H N N 125 LEU HA H N N 126 LEU HB2 H N N 127 LEU HB3 H N N 128 LEU HG H N N 129 LEU HD11 H N N 130 LEU HD12 H N N 131 LEU HD13 H N N 132 LEU HD21 H N N 133 LEU HD22 H N N 134 LEU HD23 H N N 135 LEU HXT H N N 136 LYS N N N N 137 LYS CA C N S 138 LYS C C N N 139 LYS O O N N 140 LYS CB C N N 141 LYS CG C N N 142 LYS CD C N N 143 LYS CE C N N 144 LYS NZ N N N 145 LYS OXT O N N 146 LYS H H N N 147 LYS H2 H N N 148 LYS HA H N N 149 LYS HB2 H N N 150 LYS HB3 H N N 151 LYS HG2 H N N 152 LYS HG3 H N N 153 LYS HD2 H N N 154 LYS HD3 H N N 155 LYS HE2 H N N 156 LYS HE3 H N N 157 LYS HZ1 H N N 158 LYS HZ2 H N N 159 LYS HZ3 H N N 160 LYS HXT H N N 161 MET N N N N 162 MET CA C N S 163 MET C C N N 164 MET O O N N 165 MET CB C N N 166 MET CG C N N 167 MET SD S N N 168 MET CE C N N 169 MET OXT O N N 170 MET H H N N 171 MET H2 H N N 172 MET HA H N N 173 MET HB2 H N N 174 MET HB3 H N N 175 MET HG2 H N N 176 MET HG3 H N N 177 MET HE1 H N N 178 MET HE2 H N N 179 MET HE3 H N N 180 MET HXT H N N 181 PRO N N N N 182 PRO CA C N S 183 PRO C C N N 184 PRO O O N N 185 PRO CB C N N 186 PRO CG C N N 187 PRO CD C N N 188 PRO OXT O N N 189 PRO H H N N 190 PRO HA H N N 191 PRO HB2 H N N 192 PRO HB3 H N N 193 PRO HG2 H N N 194 PRO HG3 H N N 195 PRO HD2 H N N 196 PRO HD3 H N N 197 PRO HXT H N N 198 SER N N N N 199 SER CA C N S 200 SER C C N N 201 SER O O N N 202 SER CB C N N 203 SER OG O N N 204 SER OXT O N N 205 SER H H N N 206 SER H2 H N N 207 SER HA H N N 208 SER HB2 H N N 209 SER HB3 H N N 210 SER HG H N N 211 SER HXT H N N 212 THR N N N N 213 THR CA C N S 214 THR C C N N 215 THR O O N N 216 THR CB C N R 217 THR OG1 O N N 218 THR CG2 C N N 219 THR OXT O N N 220 THR H H N N 221 THR H2 H N N 222 THR HA H N N 223 THR HB H N N 224 THR HG1 H N N 225 THR HG21 H N N 226 THR HG22 H N N 227 THR HG23 H N N 228 THR HXT H N N 229 TRP N N N N 230 TRP CA C N S 231 TRP C C N N 232 TRP O O N N 233 TRP CB C N N 234 TRP CG C Y N 235 TRP CD1 C Y N 236 TRP CD2 C Y N 237 TRP NE1 N Y N 238 TRP CE2 C Y N 239 TRP CE3 C Y N 240 TRP CZ2 C Y N 241 TRP CZ3 C Y N 242 TRP CH2 C Y N 243 TRP OXT O N N 244 TRP H H N N 245 TRP H2 H N N 246 TRP HA H N N 247 TRP HB2 H N N 248 TRP HB3 H N N 249 TRP HD1 H N N 250 TRP HE1 H N N 251 TRP HE3 H N N 252 TRP HZ2 H N N 253 TRP HZ3 H N N 254 TRP HH2 H N N 255 TRP HXT H N N 256 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLU N CA sing N N 60 GLU N H sing N N 61 GLU N H2 sing N N 62 GLU CA C sing N N 63 GLU CA CB sing N N 64 GLU CA HA sing N N 65 GLU C O doub N N 66 GLU C OXT sing N N 67 GLU CB CG sing N N 68 GLU CB HB2 sing N N 69 GLU CB HB3 sing N N 70 GLU CG CD sing N N 71 GLU CG HG2 sing N N 72 GLU CG HG3 sing N N 73 GLU CD OE1 doub N N 74 GLU CD OE2 sing N N 75 GLU OE2 HE2 sing N N 76 GLU OXT HXT sing N N 77 GLY N CA sing N N 78 GLY N H sing N N 79 GLY N H2 sing N N 80 GLY CA C sing N N 81 GLY CA HA2 sing N N 82 GLY CA HA3 sing N N 83 GLY C O doub N N 84 GLY C OXT sing N N 85 GLY OXT HXT sing N N 86 ILE N CA sing N N 87 ILE N H sing N N 88 ILE N H2 sing N N 89 ILE CA C sing N N 90 ILE CA CB sing N N 91 ILE CA HA sing N N 92 ILE C O doub N N 93 ILE C OXT sing N N 94 ILE CB CG1 sing N N 95 ILE CB CG2 sing N N 96 ILE CB HB sing N N 97 ILE CG1 CD1 sing N N 98 ILE CG1 HG12 sing N N 99 ILE CG1 HG13 sing N N 100 ILE CG2 HG21 sing N N 101 ILE CG2 HG22 sing N N 102 ILE CG2 HG23 sing N N 103 ILE CD1 HD11 sing N N 104 ILE CD1 HD12 sing N N 105 ILE CD1 HD13 sing N N 106 ILE OXT HXT sing N N 107 LEU N CA sing N N 108 LEU N H sing N N 109 LEU N H2 sing N N 110 LEU CA C sing N N 111 LEU CA CB sing N N 112 LEU CA HA sing N N 113 LEU C O doub N N 114 LEU C OXT sing N N 115 LEU CB CG sing N N 116 LEU CB HB2 sing N N 117 LEU CB HB3 sing N N 118 LEU CG CD1 sing N N 119 LEU CG CD2 sing N N 120 LEU CG HG sing N N 121 LEU CD1 HD11 sing N N 122 LEU CD1 HD12 sing N N 123 LEU CD1 HD13 sing N N 124 LEU CD2 HD21 sing N N 125 LEU CD2 HD22 sing N N 126 LEU CD2 HD23 sing N N 127 LEU OXT HXT sing N N 128 LYS N CA sing N N 129 LYS N H sing N N 130 LYS N H2 sing N N 131 LYS CA C sing N N 132 LYS CA CB sing N N 133 LYS CA HA sing N N 134 LYS C O doub N N 135 LYS C OXT sing N N 136 LYS CB CG sing N N 137 LYS CB HB2 sing N N 138 LYS CB HB3 sing N N 139 LYS CG CD sing N N 140 LYS CG HG2 sing N N 141 LYS CG HG3 sing N N 142 LYS CD CE sing N N 143 LYS CD HD2 sing N N 144 LYS CD HD3 sing N N 145 LYS CE NZ sing N N 146 LYS CE HE2 sing N N 147 LYS CE HE3 sing N N 148 LYS NZ HZ1 sing N N 149 LYS NZ HZ2 sing N N 150 LYS NZ HZ3 sing N N 151 LYS OXT HXT sing N N 152 MET N CA sing N N 153 MET N H sing N N 154 MET N H2 sing N N 155 MET CA C sing N N 156 MET CA CB sing N N 157 MET CA HA sing N N 158 MET C O doub N N 159 MET C OXT sing N N 160 MET CB CG sing N N 161 MET CB HB2 sing N N 162 MET CB HB3 sing N N 163 MET CG SD sing N N 164 MET CG HG2 sing N N 165 MET CG HG3 sing N N 166 MET SD CE sing N N 167 MET CE HE1 sing N N 168 MET CE HE2 sing N N 169 MET CE HE3 sing N N 170 MET OXT HXT sing N N 171 PRO N CA sing N N 172 PRO N CD sing N N 173 PRO N H sing N N 174 PRO CA C sing N N 175 PRO CA CB sing N N 176 PRO CA HA sing N N 177 PRO C O doub N N 178 PRO C OXT sing N N 179 PRO CB CG sing N N 180 PRO CB HB2 sing N N 181 PRO CB HB3 sing N N 182 PRO CG CD sing N N 183 PRO CG HG2 sing N N 184 PRO CG HG3 sing N N 185 PRO CD HD2 sing N N 186 PRO CD HD3 sing N N 187 PRO OXT HXT sing N N 188 SER N CA sing N N 189 SER N H sing N N 190 SER N H2 sing N N 191 SER CA C sing N N 192 SER CA CB sing N N 193 SER CA HA sing N N 194 SER C O doub N N 195 SER C OXT sing N N 196 SER CB OG sing N N 197 SER CB HB2 sing N N 198 SER CB HB3 sing N N 199 SER OG HG sing N N 200 SER OXT HXT sing N N 201 THR N CA sing N N 202 THR N H sing N N 203 THR N H2 sing N N 204 THR CA C sing N N 205 THR CA CB sing N N 206 THR CA HA sing N N 207 THR C O doub N N 208 THR C OXT sing N N 209 THR CB OG1 sing N N 210 THR CB CG2 sing N N 211 THR CB HB sing N N 212 THR OG1 HG1 sing N N 213 THR CG2 HG21 sing N N 214 THR CG2 HG22 sing N N 215 THR CG2 HG23 sing N N 216 THR OXT HXT sing N N 217 TRP N CA sing N N 218 TRP N H sing N N 219 TRP N H2 sing N N 220 TRP CA C sing N N 221 TRP CA CB sing N N 222 TRP CA HA sing N N 223 TRP C O doub N N 224 TRP C OXT sing N N 225 TRP CB CG sing N N 226 TRP CB HB2 sing N N 227 TRP CB HB3 sing N N 228 TRP CG CD1 doub Y N 229 TRP CG CD2 sing Y N 230 TRP CD1 NE1 sing Y N 231 TRP CD1 HD1 sing N N 232 TRP CD2 CE2 doub Y N 233 TRP CD2 CE3 sing Y N 234 TRP NE1 CE2 sing Y N 235 TRP NE1 HE1 sing N N 236 TRP CE2 CZ2 sing Y N 237 TRP CE3 CZ3 doub Y N 238 TRP CE3 HE3 sing N N 239 TRP CZ2 CH2 doub Y N 240 TRP CZ2 HZ2 sing N N 241 TRP CZ3 CH2 sing Y N 242 TRP CZ3 HZ3 sing N N 243 TRP CH2 HH2 sing N N 244 TRP OXT HXT sing N N 245 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #