data_8SVB # _entry.id 8SVB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.382 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8SVB pdb_00008svb 10.2210/pdb8svb/pdb WWPDB D_1000274224 ? ? BMRB 31086 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Antimicrobial lasso peptide achromonodin-1' _pdbx_database_related.db_id 31086 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 8SVB _pdbx_database_status.recvd_initial_deposition_date 2023-05-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Carson, D.V.' 1 0000-0002-4209-2199 'Cheung-Lee, W.L.' 2 0000-0001-7938-9001 'So, L.' 3 0000-0001-8863-7601 'Link, A.J.' 4 0000-0001-5066-9691 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Nat.Prod. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-6025 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 86 _citation.language ? _citation.page_first 2448 _citation.page_last 2456 _citation.title 'Discovery, Characterization, and Bioactivity of the Achromonodins: Lasso Peptides Encoded by Achromobacter .' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jnatprod.3c00536 _citation.pdbx_database_id_PubMed 37870195 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Carson, D.V.' 1 ? primary 'Zhang, Y.' 2 ? primary 'So, L.' 3 ? primary 'Cheung-Lee, W.L.' 4 ? primary 'Cartagena, A.J.' 5 ? primary 'Darst, S.A.' 6 ? primary 'Link, A.J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Achromonodin-1 _entity.formula_weight 3220.588 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGGGPTPEYFLMPIDPAWLQANLPNTGKYN _entity_poly.pdbx_seq_one_letter_code_can GGGGPTPEYFLMPIDPAWLQANLPNTGKYN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLY n 1 4 GLY n 1 5 PRO n 1 6 THR n 1 7 PRO n 1 8 GLU n 1 9 TYR n 1 10 PHE n 1 11 LEU n 1 12 MET n 1 13 PRO n 1 14 ILE n 1 15 ASP n 1 16 PRO n 1 17 ALA n 1 18 TRP n 1 19 LEU n 1 20 GLN n 1 21 ALA n 1 22 ASN n 1 23 LEU n 1 24 PRO n 1 25 ASN n 1 26 THR n 1 27 GLY n 1 28 LYS n 1 29 TYR n 1 30 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 30 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Achromobacter xylosoxidans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85698 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 8SVB _struct_ref.pdbx_db_accession 8SVB _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8SVB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 8SVB _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic 3 1 1 '2D 1H-1H COSY' 1 isotropic 4 1 1 '2D 1H-13C HSQC' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10 mg/mL Achromonodin-1, methanol' _pdbx_nmr_sample_details.solvent_system methanol _pdbx_nmr_sample_details.label Achromonodin-1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details 'Achromonodin-1 dissolved in CD3OH at concentration of 10 mg/mL' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 8SVB _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # _pdbx_nmr_ensemble.entry_id 8SVB _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8SVB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'MestreLab (Mnova / MestReNova / MestReC)' 14.2.0-26256 'MestreLab Research' 2 'peak picking' 'MestreLab (Mnova / MestReNova / MestReC)' 14.2.0-26256 'MestreLab Research' 3 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 4 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8SVB _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8SVB _struct.title 'Antimicrobial lasso peptide achromonodin-1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8SVB _struct_keywords.text 'Antimicrobial, Lasso Peptide, ANTIBIOTIC' _struct_keywords.pdbx_keywords ANTIBIOTIC # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 7 ? LEU A 11 ? PRO A 7 LEU A 11 5 ? 5 HELX_P HELX_P2 AA2 ALA A 17 ? ALA A 21 ? ALA A 17 ALA A 21 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLY _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLU _struct_conn.ptnr2_label_seq_id 8 _struct_conn.ptnr2_label_atom_id CD _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLY _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLU _struct_conn.ptnr2_auth_seq_id 8 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.373 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 8SVB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ASN 30 30 30 ASN ASN A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email ajlink@princeton.edu _pdbx_contact_author.name_first 'A. James' _pdbx_contact_author.name_last Link _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5066-9691 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-11 2 'Structure model' 1 1 2023-11-08 3 'Structure model' 1 2 2023-11-29 4 'Structure model' 1 3 2023-12-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 4 3 'Structure model' pdbx_validate_close_contact 5 3 'Structure model' struct_conn 6 4 'Structure model' citation 7 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 4 'Structure model' '_citation.journal_volume' 10 4 'Structure model' '_citation.page_first' 11 4 'Structure model' '_citation.page_last' 12 4 'Structure model' '_citation.title' 13 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component Achromonodin-1 _pdbx_nmr_exptl_sample.concentration 10 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASN 25 ? ? HZ1 A LYS 28 ? ? 1.55 2 4 O A GLY 1 ? ? HZ1 A LYS 28 ? ? 1.54 3 4 OD1 A ASN 25 ? ? HZ2 A LYS 28 ? ? 1.58 4 5 O A TRP 18 ? ? HZ3 A LYS 28 ? ? 1.55 5 6 OD1 A ASP 15 ? ? H A ASN 30 ? ? 1.56 6 6 O A GLY 1 ? ? HZ2 A LYS 28 ? ? 1.57 7 7 O A ASN 25 ? ? HZ3 A LYS 28 ? ? 1.55 8 7 H A GLY 2 ? ? OD2 A ASP 15 ? ? 1.58 9 8 O A GLY 2 ? ? HZ1 A LYS 28 ? ? 1.57 10 8 H A GLY 2 ? ? OD2 A ASP 15 ? ? 1.57 11 9 H A GLY 2 ? ? OD2 A ASP 15 ? ? 1.55 12 10 O A THR 26 ? ? HZ2 A LYS 28 ? ? 1.56 13 11 O A THR 26 ? ? HZ2 A LYS 28 ? ? 1.56 14 12 O A THR 26 ? ? HZ3 A LYS 28 ? ? 1.54 15 12 O A PRO 24 ? ? HZ1 A LYS 28 ? ? 1.59 16 13 O A ASN 25 ? ? HZ2 A LYS 28 ? ? 1.57 17 13 H A GLY 2 ? ? OD1 A ASP 15 ? ? 1.59 18 14 O A ASN 25 ? ? HZ1 A LYS 28 ? ? 1.55 19 14 O A THR 6 ? ? H A TYR 29 ? ? 1.58 20 14 H A GLY 2 ? ? OD2 A ASP 15 ? ? 1.58 21 15 O A GLY 2 ? ? HZ2 A LYS 28 ? ? 1.58 22 16 H A GLY 2 ? ? OD1 A ASP 15 ? ? 1.55 23 16 O A THR 26 ? ? HZ3 A LYS 28 ? ? 1.59 24 17 O A GLY 2 ? ? HZ1 A LYS 28 ? ? 1.58 25 17 H A GLY 2 ? ? OD1 A ASP 15 ? ? 1.58 26 18 O A GLY 2 ? ? HZ2 A LYS 28 ? ? 1.54 27 18 OD2 A ASP 15 ? ? H A ASN 30 ? ? 1.56 28 19 H A GLY 2 ? ? OD2 A ASP 15 ? ? 1.53 29 19 O A THR 26 ? ? HZ3 A LYS 28 ? ? 1.55 30 20 OD2 A ASP 15 ? ? H A ASN 30 ? ? 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 179.64 120.10 59.54 2.10 N 2 2 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 178.98 120.10 58.88 2.10 N 3 3 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 178.42 120.10 58.32 2.10 N 4 4 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.30 120.10 57.20 2.10 N 5 5 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 176.56 120.10 56.46 2.10 N 6 6 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 178.54 120.10 58.44 2.10 N 7 7 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.86 120.10 57.76 2.10 N 8 8 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 179.58 120.10 59.48 2.10 N 9 9 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 176.46 120.10 56.36 2.10 N 10 10 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 179.28 120.10 59.18 2.10 N 11 11 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.73 120.10 57.63 2.10 N 12 12 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.79 120.10 57.69 2.10 N 13 13 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.72 120.10 57.62 2.10 N 14 14 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.18 120.10 57.08 2.10 N 15 15 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 179.34 120.10 59.24 2.10 N 16 16 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 178.31 120.10 58.21 2.10 N 17 17 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.84 120.10 57.74 2.10 N 18 18 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 178.26 120.10 58.16 2.10 N 19 19 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 177.34 120.10 57.24 2.10 N 20 20 CA A ASN 30 ? ? C A ASN 30 ? ? O A ASN 30 ? ? 178.34 120.10 58.24 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 6 ? ? 73.48 137.87 2 1 LEU A 11 ? ? -145.45 -28.63 3 1 ASN A 22 ? ? -79.59 37.61 4 1 ASN A 25 ? ? -170.34 32.59 5 2 THR A 6 ? ? 74.67 136.51 6 2 LEU A 11 ? ? -158.24 20.63 7 2 MET A 12 ? ? 61.09 60.09 8 2 ILE A 14 ? ? -101.29 64.08 9 2 ASN A 25 ? ? -170.33 32.64 10 3 THR A 6 ? ? 78.54 119.36 11 3 GLU A 8 ? ? -81.57 39.89 12 3 TYR A 9 ? ? -152.34 18.05 13 3 ASN A 22 ? ? -82.31 46.73 14 4 THR A 6 ? ? 77.32 134.99 15 4 ASN A 22 ? ? -88.48 38.50 16 4 THR A 26 ? ? -79.72 38.84 17 4 TYR A 29 ? ? -170.69 -176.47 18 5 THR A 6 ? ? 71.86 132.83 19 5 MET A 12 ? ? 73.17 48.97 20 5 THR A 26 ? ? 77.44 -63.14 21 6 THR A 6 ? ? 91.84 127.45 22 6 GLU A 8 ? ? -82.88 33.48 23 6 TYR A 9 ? ? -156.92 27.11 24 6 ILE A 14 ? ? -83.93 44.44 25 6 ASN A 25 ? ? 178.62 -27.16 26 7 THR A 6 ? ? 119.67 129.07 27 7 TYR A 9 ? ? -157.01 20.70 28 7 ALA A 17 ? ? -82.07 31.73 29 7 ALA A 21 ? ? -154.06 41.97 30 7 ASN A 22 ? ? -76.83 36.53 31 7 ASN A 25 ? ? -141.49 37.50 32 8 THR A 6 ? ? 73.58 125.82 33 8 TYR A 9 ? ? -144.58 -17.58 34 8 ILE A 14 ? ? -95.28 39.57 35 8 ASN A 22 ? ? -150.46 33.46 36 8 ASN A 25 ? ? -76.32 38.79 37 9 THR A 6 ? ? 100.46 128.13 38 9 GLU A 8 ? ? -77.61 35.06 39 9 LEU A 11 ? ? 72.59 150.36 40 9 ILE A 14 ? ? -82.08 41.93 41 9 ASN A 22 ? ? -142.82 27.96 42 10 THR A 6 ? ? 74.11 96.31 43 10 LEU A 11 ? ? 83.88 7.41 44 10 ILE A 14 ? ? -84.62 46.96 45 10 ASN A 22 ? ? -79.27 45.27 46 10 THR A 26 ? ? 75.09 -79.58 47 10 LYS A 28 ? ? -175.85 100.17 48 11 THR A 6 ? ? 69.53 125.03 49 11 PRO A 16 ? ? -93.47 38.59 50 11 GLN A 20 ? ? -154.94 28.87 51 11 ASN A 22 ? ? -83.29 40.95 52 11 ASN A 25 ? ? -78.81 37.48 53 12 LEU A 11 ? ? -131.90 -34.02 54 12 MET A 12 ? ? 74.83 57.61 55 12 ILE A 14 ? ? -107.01 40.64 56 12 GLN A 20 ? ? -150.50 22.97 57 12 ASN A 22 ? ? -81.33 39.82 58 12 ASN A 25 ? ? -90.75 34.44 59 13 THR A 6 ? ? 67.91 123.38 60 13 GLU A 8 ? ? -89.09 33.98 61 13 ILE A 14 ? ? -83.88 43.12 62 13 ASN A 22 ? ? -78.22 40.26 63 14 GLU A 8 ? ? -87.57 42.72 64 14 GLN A 20 ? ? -140.41 -67.25 65 14 ASN A 25 ? ? -153.94 24.31 66 15 THR A 6 ? ? 68.24 124.40 67 15 ASN A 25 ? ? -170.41 -39.06 68 16 THR A 6 ? ? 70.75 132.27 69 16 LEU A 11 ? ? -149.48 -46.47 70 16 MET A 12 ? ? 70.72 58.63 71 16 ILE A 14 ? ? -101.54 47.17 72 16 ASN A 22 ? ? -77.99 47.14 73 16 PRO A 24 ? ? -68.86 87.56 74 17 ILE A 14 ? ? -91.14 52.43 75 17 ASN A 22 ? ? -82.37 44.75 76 17 ASN A 25 ? ? -82.23 35.87 77 18 THR A 6 ? ? 71.01 133.70 78 18 LEU A 11 ? ? -128.04 -87.63 79 18 ASP A 15 ? ? -142.20 55.08 80 18 ALA A 21 ? ? -149.34 -32.83 81 18 LEU A 23 ? ? 64.97 167.76 82 19 THR A 6 ? ? 96.17 126.51 83 19 GLN A 20 ? ? -90.91 -65.01 84 19 ASN A 22 ? ? -78.48 40.66 85 19 ASN A 25 ? ? -149.92 51.08 86 20 THR A 6 ? ? 74.47 132.54 87 20 GLU A 8 ? ? -84.05 33.70 88 20 TYR A 9 ? ? -153.47 24.49 89 20 ASP A 15 ? ? -157.12 81.87 90 20 ALA A 17 ? ? 68.25 -45.91 91 20 GLN A 20 ? ? -158.18 23.67 92 20 ASN A 22 ? ? -87.04 43.76 93 20 ASN A 25 ? ? -80.26 33.21 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 PRO A 7 ? ? GLU A 8 ? ? -148.77 2 4 PRO A 24 ? ? ASN A 25 ? ? 147.37 3 5 ALA A 21 ? ? ASN A 22 ? ? 128.50 4 6 GLY A 1 ? ? GLY A 2 ? ? 147.15 5 12 PRO A 24 ? ? ASN A 25 ? ? -148.46 6 17 PRO A 16 ? ? ALA A 17 ? ? -140.75 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 PRO N N N N 208 PRO CA C N S 209 PRO C C N N 210 PRO O O N N 211 PRO CB C N N 212 PRO CG C N N 213 PRO CD C N N 214 PRO OXT O N N 215 PRO H H N N 216 PRO HA H N N 217 PRO HB2 H N N 218 PRO HB3 H N N 219 PRO HG2 H N N 220 PRO HG3 H N N 221 PRO HD2 H N N 222 PRO HD3 H N N 223 PRO HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TRP N N N N 242 TRP CA C N S 243 TRP C C N N 244 TRP O O N N 245 TRP CB C N N 246 TRP CG C Y N 247 TRP CD1 C Y N 248 TRP CD2 C Y N 249 TRP NE1 N Y N 250 TRP CE2 C Y N 251 TRP CE3 C Y N 252 TRP CZ2 C Y N 253 TRP CZ3 C Y N 254 TRP CH2 C Y N 255 TRP OXT O N N 256 TRP H H N N 257 TRP H2 H N N 258 TRP HA H N N 259 TRP HB2 H N N 260 TRP HB3 H N N 261 TRP HD1 H N N 262 TRP HE1 H N N 263 TRP HE3 H N N 264 TRP HZ2 H N N 265 TRP HZ3 H N N 266 TRP HH2 H N N 267 TRP HXT H N N 268 TYR N N N N 269 TYR CA C N S 270 TYR C C N N 271 TYR O O N N 272 TYR CB C N N 273 TYR CG C Y N 274 TYR CD1 C Y N 275 TYR CD2 C Y N 276 TYR CE1 C Y N 277 TYR CE2 C Y N 278 TYR CZ C Y N 279 TYR OH O N N 280 TYR OXT O N N 281 TYR H H N N 282 TYR H2 H N N 283 TYR HA H N N 284 TYR HB2 H N N 285 TYR HB3 H N N 286 TYR HD1 H N N 287 TYR HD2 H N N 288 TYR HE1 H N N 289 TYR HE2 H N N 290 TYR HH H N N 291 TYR HXT H N N 292 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 THR N CA sing N N 215 THR N H sing N N 216 THR N H2 sing N N 217 THR CA C sing N N 218 THR CA CB sing N N 219 THR CA HA sing N N 220 THR C O doub N N 221 THR C OXT sing N N 222 THR CB OG1 sing N N 223 THR CB CG2 sing N N 224 THR CB HB sing N N 225 THR OG1 HG1 sing N N 226 THR CG2 HG21 sing N N 227 THR CG2 HG22 sing N N 228 THR CG2 HG23 sing N N 229 THR OXT HXT sing N N 230 TRP N CA sing N N 231 TRP N H sing N N 232 TRP N H2 sing N N 233 TRP CA C sing N N 234 TRP CA CB sing N N 235 TRP CA HA sing N N 236 TRP C O doub N N 237 TRP C OXT sing N N 238 TRP CB CG sing N N 239 TRP CB HB2 sing N N 240 TRP CB HB3 sing N N 241 TRP CG CD1 doub Y N 242 TRP CG CD2 sing Y N 243 TRP CD1 NE1 sing Y N 244 TRP CD1 HD1 sing N N 245 TRP CD2 CE2 doub Y N 246 TRP CD2 CE3 sing Y N 247 TRP NE1 CE2 sing Y N 248 TRP NE1 HE1 sing N N 249 TRP CE2 CZ2 sing Y N 250 TRP CE3 CZ3 doub Y N 251 TRP CE3 HE3 sing N N 252 TRP CZ2 CH2 doub Y N 253 TRP CZ2 HZ2 sing N N 254 TRP CZ3 CH2 sing Y N 255 TRP CZ3 HZ3 sing N N 256 TRP CH2 HH2 sing N N 257 TRP OXT HXT sing N N 258 TYR N CA sing N N 259 TYR N H sing N N 260 TYR N H2 sing N N 261 TYR CA C sing N N 262 TYR CA CB sing N N 263 TYR CA HA sing N N 264 TYR C O doub N N 265 TYR C OXT sing N N 266 TYR CB CG sing N N 267 TYR CB HB2 sing N N 268 TYR CB HB3 sing N N 269 TYR CG CD1 doub Y N 270 TYR CG CD2 sing Y N 271 TYR CD1 CE1 sing Y N 272 TYR CD1 HD1 sing N N 273 TYR CD2 CE2 doub Y N 274 TYR CD2 HD2 sing N N 275 TYR CE1 CZ doub Y N 276 TYR CE1 HE1 sing N N 277 TYR CE2 CZ sing Y N 278 TYR CE2 HE2 sing N N 279 TYR CZ OH sing N N 280 TYR OH HH sing N N 281 TYR OXT HXT sing N N 282 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM107036 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #