data_8SWM # _entry.id 8SWM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.390 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8SWM pdb_00008swm 10.2210/pdb8swm/pdb WWPDB D_1000274590 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-04-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8SWM _pdbx_database_status.recvd_initial_deposition_date 2023-05-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email luke.guddat@uq.edu.au _pdbx_contact_author.name_first Luke _pdbx_contact_author.name_last Guddat _pdbx_contact_author.name_mi W _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8204-8408 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lin, X.' 1 0000-0003-1112-5151 'Lonhienne, T.' 2 0000-0001-8788-2840 'Guddat, L.W.' 3 0000-0002-8204-8408 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Catalysis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2155-5435 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mapping of the Reaction Trajectory catalyzed by Class I Ketol-Acid Reductoisomerase' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acscatal.4c00958 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lin, X.' 1 ? primary 'Lonhienne, T.' 2 ? primary 'Lv, Y.' 3 ? primary 'Kurz, J.' 4 ? primary 'McGeary, R.' 5 ? primary 'Schenk, G.' 6 ? primary 'Guddat, L.W.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ketol-acid reductoisomerase (NADP(+))' 35868.223 1 1.1.1.86 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 3 non-polymer syn '(2S)-2-hydroxy-2-methyl-3-oxobutanoic acid' 132.115 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;KARI,Acetohydroxy-acid isomeroreductase,AHIR,Alpha-keto-beta-hydroxylacyl reductoisomerase,Ketol-acid reductoisomerase type 1,Ketol-acid reductoisomerase type I ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGSVSAVKAKNAGFEVMSVSEASKIADVIMI LAPDEIQADIFNVEIKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAIHQDESK NAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLSALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLI YQGGIADMRYSISNTAEYGDYITGPKIITEETKKAMKGVLKDIQNGVFAKDFILERRAGFARMHAERKNMNDSLIEKTGR NLRAMMPWIS ; _entity_poly.pdbx_seq_one_letter_code_can ;MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGSVSAVKAKNAGFEVMSVSEASKIADVIMI LAPDEIQADIFNVEIKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAIHQDESK NAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLSALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLI YQGGIADMRYSISNTAEYGDYITGPKIITEETKKAMKGVLKDIQNGVFAKDFILERRAGFARMHAERKNMNDSLIEKTGR NLRAMMPWIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 '(2S)-2-hydroxy-2-methyl-3-oxobutanoic acid' X2X 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ILE n 1 4 THR n 1 5 VAL n 1 6 TYR n 1 7 TYR n 1 8 ASP n 1 9 LYS n 1 10 ASP n 1 11 CYS n 1 12 ASP n 1 13 LEU n 1 14 ASN n 1 15 LEU n 1 16 ILE n 1 17 LYS n 1 18 SER n 1 19 LYS n 1 20 LYS n 1 21 VAL n 1 22 ALA n 1 23 ILE n 1 24 ILE n 1 25 GLY n 1 26 PHE n 1 27 GLY n 1 28 SER n 1 29 GLN n 1 30 GLY n 1 31 HIS n 1 32 ALA n 1 33 HIS n 1 34 ALA n 1 35 MET n 1 36 ASN n 1 37 LEU n 1 38 ARG n 1 39 ASP n 1 40 ASN n 1 41 GLY n 1 42 VAL n 1 43 ASN n 1 44 VAL n 1 45 THR n 1 46 ILE n 1 47 GLY n 1 48 LEU n 1 49 ARG n 1 50 GLU n 1 51 GLY n 1 52 SER n 1 53 VAL n 1 54 SER n 1 55 ALA n 1 56 VAL n 1 57 LYS n 1 58 ALA n 1 59 LYS n 1 60 ASN n 1 61 ALA n 1 62 GLY n 1 63 PHE n 1 64 GLU n 1 65 VAL n 1 66 MET n 1 67 SER n 1 68 VAL n 1 69 SER n 1 70 GLU n 1 71 ALA n 1 72 SER n 1 73 LYS n 1 74 ILE n 1 75 ALA n 1 76 ASP n 1 77 VAL n 1 78 ILE n 1 79 MET n 1 80 ILE n 1 81 LEU n 1 82 ALA n 1 83 PRO n 1 84 ASP n 1 85 GLU n 1 86 ILE n 1 87 GLN n 1 88 ALA n 1 89 ASP n 1 90 ILE n 1 91 PHE n 1 92 ASN n 1 93 VAL n 1 94 GLU n 1 95 ILE n 1 96 LYS n 1 97 PRO n 1 98 ASN n 1 99 LEU n 1 100 SER n 1 101 GLU n 1 102 GLY n 1 103 LYS n 1 104 ALA n 1 105 ILE n 1 106 ALA n 1 107 PHE n 1 108 ALA n 1 109 HIS n 1 110 GLY n 1 111 PHE n 1 112 ASN n 1 113 ILE n 1 114 HIS n 1 115 TYR n 1 116 GLY n 1 117 GLN n 1 118 ILE n 1 119 VAL n 1 120 VAL n 1 121 PRO n 1 122 LYS n 1 123 GLY n 1 124 VAL n 1 125 ASP n 1 126 VAL n 1 127 ILE n 1 128 MET n 1 129 ILE n 1 130 ALA n 1 131 PRO n 1 132 LYS n 1 133 ALA n 1 134 PRO n 1 135 GLY n 1 136 HIS n 1 137 THR n 1 138 VAL n 1 139 ARG n 1 140 ASN n 1 141 GLU n 1 142 PHE n 1 143 THR n 1 144 LEU n 1 145 GLY n 1 146 GLY n 1 147 GLY n 1 148 THR n 1 149 PRO n 1 150 CYS n 1 151 LEU n 1 152 ILE n 1 153 ALA n 1 154 ILE n 1 155 HIS n 1 156 GLN n 1 157 ASP n 1 158 GLU n 1 159 SER n 1 160 LYS n 1 161 ASN n 1 162 ALA n 1 163 LYS n 1 164 ASN n 1 165 LEU n 1 166 ALA n 1 167 LEU n 1 168 SER n 1 169 TYR n 1 170 ALA n 1 171 SER n 1 172 ALA n 1 173 ILE n 1 174 GLY n 1 175 GLY n 1 176 GLY n 1 177 ARG n 1 178 THR n 1 179 GLY n 1 180 ILE n 1 181 ILE n 1 182 GLU n 1 183 THR n 1 184 THR n 1 185 PHE n 1 186 LYS n 1 187 ALA n 1 188 GLU n 1 189 THR n 1 190 GLU n 1 191 THR n 1 192 ASP n 1 193 LEU n 1 194 PHE n 1 195 GLY n 1 196 GLU n 1 197 GLN n 1 198 ALA n 1 199 VAL n 1 200 LEU n 1 201 CYS n 1 202 GLY n 1 203 GLY n 1 204 LEU n 1 205 SER n 1 206 ALA n 1 207 LEU n 1 208 ILE n 1 209 GLN n 1 210 ALA n 1 211 GLY n 1 212 PHE n 1 213 GLU n 1 214 THR n 1 215 LEU n 1 216 VAL n 1 217 GLU n 1 218 ALA n 1 219 GLY n 1 220 TYR n 1 221 GLU n 1 222 PRO n 1 223 GLU n 1 224 MET n 1 225 ALA n 1 226 TYR n 1 227 PHE n 1 228 GLU n 1 229 CYS n 1 230 LEU n 1 231 HIS n 1 232 GLU n 1 233 MET n 1 234 LYS n 1 235 LEU n 1 236 ILE n 1 237 VAL n 1 238 ASP n 1 239 LEU n 1 240 ILE n 1 241 TYR n 1 242 GLN n 1 243 GLY n 1 244 GLY n 1 245 ILE n 1 246 ALA n 1 247 ASP n 1 248 MET n 1 249 ARG n 1 250 TYR n 1 251 SER n 1 252 ILE n 1 253 SER n 1 254 ASN n 1 255 THR n 1 256 ALA n 1 257 GLU n 1 258 TYR n 1 259 GLY n 1 260 ASP n 1 261 TYR n 1 262 ILE n 1 263 THR n 1 264 GLY n 1 265 PRO n 1 266 LYS n 1 267 ILE n 1 268 ILE n 1 269 THR n 1 270 GLU n 1 271 GLU n 1 272 THR n 1 273 LYS n 1 274 LYS n 1 275 ALA n 1 276 MET n 1 277 LYS n 1 278 GLY n 1 279 VAL n 1 280 LEU n 1 281 LYS n 1 282 ASP n 1 283 ILE n 1 284 GLN n 1 285 ASN n 1 286 GLY n 1 287 VAL n 1 288 PHE n 1 289 ALA n 1 290 LYS n 1 291 ASP n 1 292 PHE n 1 293 ILE n 1 294 LEU n 1 295 GLU n 1 296 ARG n 1 297 ARG n 1 298 ALA n 1 299 GLY n 1 300 PHE n 1 301 ALA n 1 302 ARG n 1 303 MET n 1 304 HIS n 1 305 ALA n 1 306 GLU n 1 307 ARG n 1 308 LYS n 1 309 ASN n 1 310 MET n 1 311 ASN n 1 312 ASP n 1 313 SER n 1 314 LEU n 1 315 ILE n 1 316 GLU n 1 317 LYS n 1 318 THR n 1 319 GLY n 1 320 ARG n 1 321 ASN n 1 322 LEU n 1 323 ARG n 1 324 ALA n 1 325 MET n 1 326 MET n 1 327 PRO n 1 328 TRP n 1 329 ILE n 1 330 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 330 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ilvC, CJE0735' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Campylobacter jejuni subsp. jejuni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32022 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 X2X non-polymer . '(2S)-2-hydroxy-2-methyl-3-oxobutanoic acid' ? 'C5 H8 O4' 132.115 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ILE 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 GLN 197 197 197 GLN GLN A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 TYR 220 220 220 TYR TYR A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 MET 224 224 224 MET MET A . n A 1 225 ALA 225 225 225 ALA ALA A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 CYS 229 229 229 CYS CYS A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 HIS 231 231 231 HIS HIS A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 MET 233 233 233 MET MET A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 TYR 241 241 241 TYR TYR A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 ILE 245 245 245 ILE ILE A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 MET 248 248 248 MET MET A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 TYR 250 250 250 TYR TYR A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 SER 253 253 253 SER SER A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 TYR 258 258 258 TYR TYR A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 ASP 260 260 260 ASP ASP A . n A 1 261 TYR 261 261 261 TYR TYR A . n A 1 262 ILE 262 262 262 ILE ILE A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 PRO 265 265 265 PRO PRO A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 ILE 267 267 267 ILE ILE A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 THR 269 269 269 THR THR A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 THR 272 272 272 THR THR A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 MET 276 276 276 MET MET A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 GLY 278 278 278 GLY GLY A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 LEU 280 280 280 LEU LEU A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 ASP 282 282 282 ASP ASP A . n A 1 283 ILE 283 283 283 ILE ILE A . n A 1 284 GLN 284 284 284 GLN GLN A . n A 1 285 ASN 285 285 285 ASN ASN A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 PHE 292 292 292 PHE PHE A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 GLU 295 295 295 GLU GLU A . n A 1 296 ARG 296 296 296 ARG ARG A . n A 1 297 ARG 297 297 297 ARG ARG A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 GLY 299 299 299 GLY GLY A . n A 1 300 PHE 300 300 300 PHE PHE A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 ARG 302 302 302 ARG ARG A . n A 1 303 MET 303 303 303 MET MET A . n A 1 304 HIS 304 304 304 HIS HIS A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 LYS 308 308 308 LYS LYS A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 MET 310 310 310 MET MET A . n A 1 311 ASN 311 311 311 ASN ASN A . n A 1 312 ASP 312 312 312 ASP ASP A . n A 1 313 SER 313 313 313 SER SER A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 GLU 316 316 316 GLU GLU A . n A 1 317 LYS 317 317 317 LYS LYS A . n A 1 318 THR 318 318 318 THR THR A . n A 1 319 GLY 319 319 319 GLY GLY A . n A 1 320 ARG 320 320 320 ARG ARG A . n A 1 321 ASN 321 321 321 ASN ASN A . n A 1 322 LEU 322 322 322 LEU LEU A . n A 1 323 ARG 323 323 323 ARG ARG A . n A 1 324 ALA 324 324 324 ALA ALA A . n A 1 325 MET 325 325 325 MET MET A . n A 1 326 MET 326 326 326 MET MET A . n A 1 327 PRO 327 327 327 PRO PRO A . n A 1 328 TRP 328 328 328 TRP TRP A . n A 1 329 ILE 329 329 ? ? ? A . n A 1 330 SER 330 330 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 401 MG MG A . C 2 MG 1 402 501 MG MG A . D 2 MG 1 403 502 MG MG A . E 3 X2X 1 404 1 X2X DRG A . F 4 CL 1 405 1 CL CL A . G 5 HOH 1 501 6 HOH HOH A . G 5 HOH 2 502 9 HOH HOH A . G 5 HOH 3 503 11 HOH HOH A . G 5 HOH 4 504 1 HOH HOH A . G 5 HOH 5 505 3 HOH HOH A . G 5 HOH 6 506 10 HOH HOH A . G 5 HOH 7 507 2 HOH HOH A . G 5 HOH 8 508 7 HOH HOH A . G 5 HOH 9 509 13 HOH HOH A . G 5 HOH 10 510 12 HOH HOH A . G 5 HOH 11 511 14 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 9 ? CG ? A LYS 9 CG 2 1 Y 1 A LYS 9 ? CD ? A LYS 9 CD 3 1 Y 1 A LYS 9 ? CE ? A LYS 9 CE 4 1 Y 1 A LYS 9 ? NZ ? A LYS 9 NZ 5 1 Y 1 A LYS 17 ? CG ? A LYS 17 CG 6 1 Y 1 A LYS 17 ? CD ? A LYS 17 CD 7 1 Y 1 A LYS 17 ? CE ? A LYS 17 CE 8 1 Y 1 A LYS 17 ? NZ ? A LYS 17 NZ 9 1 Y 1 A LYS 20 ? CG ? A LYS 20 CG 10 1 Y 1 A LYS 20 ? CD ? A LYS 20 CD 11 1 Y 1 A LYS 20 ? CE ? A LYS 20 CE 12 1 Y 1 A LYS 20 ? NZ ? A LYS 20 NZ 13 1 Y 1 A GLN 29 ? CG ? A GLN 29 CG 14 1 Y 1 A GLN 29 ? CD ? A GLN 29 CD 15 1 Y 1 A GLN 29 ? OE1 ? A GLN 29 OE1 16 1 Y 1 A GLN 29 ? NE2 ? A GLN 29 NE2 17 1 Y 1 A ARG 49 ? CG ? A ARG 49 CG 18 1 Y 1 A ARG 49 ? CD ? A ARG 49 CD 19 1 Y 1 A ARG 49 ? NE ? A ARG 49 NE 20 1 Y 1 A ARG 49 ? CZ ? A ARG 49 CZ 21 1 Y 1 A ARG 49 ? NH1 ? A ARG 49 NH1 22 1 Y 1 A ARG 49 ? NH2 ? A ARG 49 NH2 23 1 Y 1 A GLU 50 ? CG ? A GLU 50 CG 24 1 Y 1 A GLU 50 ? CD ? A GLU 50 CD 25 1 Y 1 A GLU 50 ? OE1 ? A GLU 50 OE1 26 1 Y 1 A GLU 50 ? OE2 ? A GLU 50 OE2 27 1 Y 1 A LYS 57 ? CG ? A LYS 57 CG 28 1 Y 1 A LYS 57 ? CD ? A LYS 57 CD 29 1 Y 1 A LYS 57 ? CE ? A LYS 57 CE 30 1 Y 1 A LYS 57 ? NZ ? A LYS 57 NZ 31 1 Y 1 A LYS 59 ? CG ? A LYS 59 CG 32 1 Y 1 A LYS 59 ? CD ? A LYS 59 CD 33 1 Y 1 A LYS 59 ? CE ? A LYS 59 CE 34 1 Y 1 A LYS 59 ? NZ ? A LYS 59 NZ 35 1 Y 1 A LYS 73 ? CG ? A LYS 73 CG 36 1 Y 1 A LYS 73 ? CD ? A LYS 73 CD 37 1 Y 1 A LYS 73 ? CE ? A LYS 73 CE 38 1 Y 1 A LYS 73 ? NZ ? A LYS 73 NZ 39 1 Y 1 A LYS 96 ? CG ? A LYS 96 CG 40 1 Y 1 A LYS 96 ? CD ? A LYS 96 CD 41 1 Y 1 A LYS 96 ? CE ? A LYS 96 CE 42 1 Y 1 A LYS 96 ? NZ ? A LYS 96 NZ 43 1 Y 1 A LEU 99 ? CG ? A LEU 99 CG 44 1 Y 1 A LEU 99 ? CD1 ? A LEU 99 CD1 45 1 Y 1 A LEU 99 ? CD2 ? A LEU 99 CD2 46 1 Y 1 A LYS 103 ? CG ? A LYS 103 CG 47 1 Y 1 A LYS 103 ? CD ? A LYS 103 CD 48 1 Y 1 A LYS 103 ? CE ? A LYS 103 CE 49 1 Y 1 A LYS 103 ? NZ ? A LYS 103 NZ 50 1 Y 1 A VAL 120 ? CG1 ? A VAL 120 CG1 51 1 Y 1 A VAL 120 ? CG2 ? A VAL 120 CG2 52 1 Y 1 A LYS 122 ? CG ? A LYS 122 CG 53 1 Y 1 A LYS 122 ? CD ? A LYS 122 CD 54 1 Y 1 A LYS 122 ? CE ? A LYS 122 CE 55 1 Y 1 A LYS 122 ? NZ ? A LYS 122 NZ 56 1 Y 1 A LYS 163 ? CG ? A LYS 163 CG 57 1 Y 1 A LYS 163 ? CD ? A LYS 163 CD 58 1 Y 1 A LYS 163 ? CE ? A LYS 163 CE 59 1 Y 1 A LYS 163 ? NZ ? A LYS 163 NZ 60 1 Y 1 A ARG 177 ? CG ? A ARG 177 CG 61 1 Y 1 A ARG 177 ? CD ? A ARG 177 CD 62 1 Y 1 A ARG 177 ? NE ? A ARG 177 NE 63 1 Y 1 A ARG 177 ? CZ ? A ARG 177 CZ 64 1 Y 1 A ARG 177 ? NH1 ? A ARG 177 NH1 65 1 Y 1 A ARG 177 ? NH2 ? A ARG 177 NH2 66 1 Y 1 A TRP 328 ? CG ? A TRP 328 CG 67 1 Y 1 A TRP 328 ? CD1 ? A TRP 328 CD1 68 1 Y 1 A TRP 328 ? CD2 ? A TRP 328 CD2 69 1 Y 1 A TRP 328 ? NE1 ? A TRP 328 NE1 70 1 Y 1 A TRP 328 ? CE2 ? A TRP 328 CE2 71 1 Y 1 A TRP 328 ? CE3 ? A TRP 328 CE3 72 1 Y 1 A TRP 328 ? CZ2 ? A TRP 328 CZ2 73 1 Y 1 A TRP 328 ? CZ3 ? A TRP 328 CZ3 74 1 Y 1 A TRP 328 ? CH2 ? A TRP 328 CH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8SWM _cell.details ? _cell.formula_units_Z ? _cell.length_a 130.715 _cell.length_a_esd ? _cell.length_b 130.715 _cell.length_b_esd ? _cell.length_c 130.715 _cell.length_c_esd ? _cell.volume 2233450.243 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8SWM _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall 'I 2 2 3' _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8SWM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M ammonium acetate, 0.1 M BIS-TRIS pH=5.5 and 17 % w/v PEG10000 ; _exptl_crystal_grow.pdbx_pH_range 5.5-7.9 _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 81.64 _reflns.entry_id 8SWM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3 _reflns.d_resolution_low 46.21 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7593 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.078 _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3286 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.542 _reflns_shell.pdbx_Rpim_I_all 0.263 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.918 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.472 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 94.45 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8SWM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 41.34 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7591 _refine.ls_number_reflns_R_free 755 _refine.ls_number_reflns_R_work 6836 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.76 _refine.ls_percent_reflns_R_free 9.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2277 _refine.ls_R_factor_R_free 0.2492 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2253 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.8657 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4325 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 41.34 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2412 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2388 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0078 ? 2435 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8486 ? 3297 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0487 ? 377 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0054 ? 435 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.5329 ? 864 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.00 3.23 . . 148 1346 98.87 . . . . 0.3214 . . . . . . . . . . . 0.3884 'X-RAY DIFFRACTION' 3.23 3.55 . . 153 1342 100.00 . . . . 0.2741 . . . . . . . . . . . 0.3082 'X-RAY DIFFRACTION' 3.56 4.07 . . 150 1359 100.00 . . . . 0.2388 . . . . . . . . . . . 0.2884 'X-RAY DIFFRACTION' 4.07 5.13 . . 153 1374 100.00 . . . . 0.2095 . . . . . . . . . . . 0.2158 'X-RAY DIFFRACTION' 5.13 41.34 . . 151 1415 99.94 . . . . 0.1954 . . . . . . . . . . . 0.2091 # _struct.entry_id 8SWM _struct.title 'Crystal structure of Campylobacter jejuni ketol-acid reductoisomerase in complex with 2-acetolactate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8SWM _struct_keywords.text 'Inhibitor, Biofuel, Enzyme, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ILVC_CAMJR _struct_ref.pdbx_db_accession Q5HVD9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGSVSAVKAKNAGFEVMSVSEASKIADVIMI LAPDEIQADIFNVEIKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAIHQDESK NAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLSALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLI YQGGIADMRYSISNTAEYGDYITGPKIITEETKKAMKGVLKDIQNGVFAKDFILERRAGFARMHAERKNMNDSLIEKTGR NLRAMMPWIS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8SWM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 330 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5HVD9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 330 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 330 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 79960 ? 1 MORE -963 ? 1 'SSA (A^2)' 136600 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 7 ? CYS A 11 ? TYR A 7 CYS A 11 5 ? 5 HELX_P HELX_P2 AA2 ASP A 12 ? SER A 18 ? ASP A 12 SER A 18 1 ? 7 HELX_P HELX_P3 AA3 GLY A 27 ? ASN A 40 ? GLY A 27 ASN A 40 1 ? 14 HELX_P HELX_P4 AA4 VAL A 53 ? GLY A 62 ? VAL A 53 GLY A 62 1 ? 10 HELX_P HELX_P5 AA5 SER A 67 ? ALA A 75 ? SER A 67 ALA A 75 1 ? 9 HELX_P HELX_P6 AA6 ILE A 86 ? ILE A 95 ? ILE A 86 ILE A 95 1 ? 10 HELX_P HELX_P7 AA7 GLY A 110 ? TYR A 115 ? GLY A 110 TYR A 115 1 ? 6 HELX_P HELX_P8 AA8 PRO A 134 ? LEU A 144 ? PRO A 134 LEU A 144 1 ? 11 HELX_P HELX_P9 AA9 ASN A 161 ? ALA A 172 ? ASN A 161 ALA A 172 1 ? 12 HELX_P HELX_P10 AB1 THR A 184 ? VAL A 199 ? THR A 184 VAL A 199 1 ? 16 HELX_P HELX_P11 AB2 CYS A 201 ? ALA A 218 ? CYS A 201 ALA A 218 1 ? 18 HELX_P HELX_P12 AB3 GLU A 221 ? LEU A 230 ? GLU A 221 LEU A 230 1 ? 10 HELX_P HELX_P13 AB4 GLU A 232 ? GLY A 243 ? GLU A 232 GLY A 243 1 ? 12 HELX_P HELX_P14 AB5 GLY A 243 ? ILE A 252 ? GLY A 243 ILE A 252 1 ? 10 HELX_P HELX_P15 AB6 SER A 253 ? ILE A 268 ? SER A 253 ILE A 268 1 ? 16 HELX_P HELX_P16 AB7 THR A 269 ? ASN A 285 ? THR A 269 ASN A 285 1 ? 17 HELX_P HELX_P17 AB8 GLY A 286 ? ALA A 298 ? GLY A 286 ALA A 298 1 ? 13 HELX_P HELX_P18 AB9 PHE A 300 ? ASP A 312 ? PHE A 300 ASP A 312 1 ? 13 HELX_P HELX_P19 AC1 SER A 313 ? MET A 325 ? SER A 313 MET A 325 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 192 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 192 A MG 401 1_555 ? ? ? ? ? ? ? 2.855 ? ? metalc2 metalc ? ? A ASP 192 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 192 A MG 402 1_555 ? ? ? ? ? ? ? 1.902 ? ? metalc3 metalc ? ? A GLU 196 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 196 A MG 401 1_555 ? ? ? ? ? ? ? 2.503 ? ? metalc4 metalc ? ? A GLU 228 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 228 A MG 402 4_555 ? ? ? ? ? ? ? 2.663 ? ? metalc5 metalc ? ? A GLU 232 OE1 ? ? ? 1_555 C MG . MG ? ? A GLU 232 A MG 402 4_555 ? ? ? ? ? ? ? 2.801 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 E X2X . OAD ? ? A MG 401 A X2X 404 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 E X2X . OAE ? ? A MG 401 A X2X 404 1_555 ? ? ? ? ? ? ? 2.621 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 E X2X . OAC ? ? A MG 402 A X2X 404 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 402 A HOH 501 4_555 ? ? ? ? ? ? ? 2.646 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OE2 ? A GLU 196 ? A GLU 196 ? 1_555 66.7 ? 2 OD2 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OAD ? E X2X . ? A X2X 404 ? 1_555 107.3 ? 3 OE2 ? A GLU 196 ? A GLU 196 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OAD ? E X2X . ? A X2X 404 ? 1_555 71.2 ? 4 OD2 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OAE ? E X2X . ? A X2X 404 ? 1_555 57.9 ? 5 OE2 ? A GLU 196 ? A GLU 196 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OAE ? E X2X . ? A X2X 404 ? 1_555 66.3 ? 6 OAD ? E X2X . ? A X2X 404 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 OAE ? E X2X . ? A X2X 404 ? 1_555 51.7 ? 7 OD1 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE1 ? A GLU 228 ? A GLU 228 ? 1_555 146.8 ? 8 OD1 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 147.8 ? 9 OE1 ? A GLU 228 ? A GLU 228 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 5.5 ? 10 OD1 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OAC ? E X2X . ? A X2X 404 ? 1_555 129.4 ? 11 OE1 ? A GLU 228 ? A GLU 228 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OAC ? E X2X . ? A X2X 404 ? 1_555 78.6 ? 12 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 OAC ? E X2X . ? A X2X 404 ? 1_555 74.8 ? 13 OD1 ? A ASP 192 ? A ASP 192 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 501 ? 4_555 85.4 ? 14 OE1 ? A GLU 228 ? A GLU 228 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 501 ? 4_555 62.9 ? 15 OE1 ? A GLU 232 ? A GLU 232 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 501 ? 4_555 66.0 ? 16 OAC ? E X2X . ? A X2X 404 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? G HOH . ? A HOH 501 ? 4_555 140.3 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 65 ? MET A 66 ? VAL A 65 MET A 66 AA1 2 VAL A 44 ? GLY A 47 ? VAL A 44 GLY A 47 AA1 3 VAL A 21 ? ILE A 24 ? VAL A 21 ILE A 24 AA1 4 VAL A 77 ? ILE A 80 ? VAL A 77 ILE A 80 AA1 5 ALA A 104 ? PHE A 107 ? ALA A 104 PHE A 107 AA1 6 ASP A 125 ? PRO A 131 ? ASP A 125 PRO A 131 AA1 7 CYS A 150 ? GLN A 156 ? CYS A 150 GLN A 156 AA1 8 ILE A 180 ? THR A 183 ? ILE A 180 THR A 183 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O MET A 66 ? O MET A 66 N ILE A 46 ? N ILE A 46 AA1 2 3 O THR A 45 ? O THR A 45 N VAL A 21 ? N VAL A 21 AA1 3 4 N ALA A 22 ? N ALA A 22 O VAL A 77 ? O VAL A 77 AA1 4 5 N ILE A 78 ? N ILE A 78 O ALA A 106 ? O ALA A 106 AA1 5 6 N ILE A 105 ? N ILE A 105 O ASP A 125 ? O ASP A 125 AA1 6 7 N ALA A 130 ? N ALA A 130 O LEU A 151 ? O LEU A 151 AA1 7 8 N ILE A 152 ? N ILE A 152 O THR A 183 ? O THR A 183 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 26 ? ? -154.29 49.78 2 1 VAL A 53 ? ? -57.36 -2.60 3 1 VAL A 93 ? ? -142.98 -0.68 4 1 GLU A 94 ? ? -152.93 4.24 5 1 PRO A 97 ? ? -58.92 -74.72 6 1 ASN A 98 ? ? -67.66 57.06 7 1 LEU A 99 ? ? -106.44 -152.10 8 1 SER A 100 ? ? -168.30 -129.42 9 1 HIS A 109 ? ? -121.37 -112.82 10 1 LYS A 122 ? ? -65.70 2.01 11 1 LYS A 132 ? ? -112.18 69.38 12 1 HIS A 155 ? ? -103.75 -66.54 13 1 LYS A 160 ? ? 58.86 9.19 14 1 VAL A 199 ? ? -127.44 -69.13 15 1 LEU A 230 ? ? -121.16 -61.55 16 1 GLN A 242 ? ? -97.29 -61.07 17 1 MET A 325 ? ? -89.72 40.31 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 405 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 z,x,y 3 y,z,x 4 -y,-z,x 5 z,-x,-y 6 -y,z,-x 7 -z,-x,y 8 -z,x,-y 9 y,-z,-x 10 x,-y,-z 11 -x,y,-z 12 -x,-y,z 13 x+1/2,y+1/2,z+1/2 14 z+1/2,x+1/2,y+1/2 15 y+1/2,z+1/2,x+1/2 16 -y+1/2,-z+1/2,x+1/2 17 z+1/2,-x+1/2,-y+1/2 18 -y+1/2,z+1/2,-x+1/2 19 -z+1/2,-x+1/2,y+1/2 20 -z+1/2,x+1/2,-y+1/2 21 y+1/2,-z+1/2,-x+1/2 22 x+1/2,-y+1/2,-z+1/2 23 -x+1/2,y+1/2,-z+1/2 24 -x+1/2,-y+1/2,z+1/2 # _pdbx_entry_details.entry_id 8SWM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ILE 3 ? A ILE 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A ILE 329 ? A ILE 329 7 1 Y 1 A SER 330 ? A SER 330 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 X2X OAD O N N 393 X2X CAH C N N 394 X2X OAE O N N 395 X2X CAI C N S 396 X2X CAB C N N 397 X2X OAF O N N 398 X2X CAG C N N 399 X2X OAC O N N 400 X2X CAA C N N 401 X2X H1 H N N 402 X2X H2 H N N 403 X2X H3 H N N 404 X2X H4 H N N 405 X2X H5 H N N 406 X2X H6 H N N 407 X2X H7 H N N 408 X2X H8 H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 X2X OAF CAI sing N N 376 X2X CAB CAI sing N N 377 X2X CAI CAH sing N N 378 X2X CAI CAG sing N N 379 X2X OAD CAH doub N N 380 X2X CAH OAE sing N N 381 X2X CAG CAA sing N N 382 X2X CAG OAC doub N N 383 X2X OAE H1 sing N N 384 X2X CAB H2 sing N N 385 X2X CAB H3 sing N N 386 X2X CAB H4 sing N N 387 X2X OAF H5 sing N N 388 X2X CAA H6 sing N N 389 X2X CAA H7 sing N N 390 X2X CAA H8 sing N N 391 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number DP210101802 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id X2X _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id X2X _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7LAT _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 2 3' _space_group.name_Hall 'I 2 2 3' _space_group.IT_number 197 _space_group.crystal_system cubic _space_group.id 1 # _atom_sites.entry_id 8SWM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007650 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007650 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007650 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_