data_8T0J # _entry.id 8T0J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8T0J pdb_00008t0j 10.2210/pdb8t0j/pdb WWPDB D_1000274849 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8T0J _pdbx_database_status.recvd_initial_deposition_date 2023-06-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sousa, M.C.' 1 0000-0002-0242-3619 'Munoz-Escudero, D.' 2 0000-0002-3884-7093 'Lee, M.' 3 0000-0002-2303-3441 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 2970 _citation.page_last 2981 _citation.title ;Structure and Function of ArnD. A Deformylase Essential for Lipid A Modification with 4-Amino-4-deoxy-l-arabinose and Polymyxin Resistance. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.3c00293 _citation.pdbx_database_id_PubMed 37782650 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Munoz-Escudero, D.' 1 ? primary 'Breazeale, S.D.' 2 ? primary 'Lee, M.' 3 ? primary 'Guan, Z.' 4 ? primary 'Raetz, C.R.H.' 5 ? primary 'Sousa, M.C.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8T0J _cell.details ? _cell.formula_units_Z ? _cell.length_a 82.551 _cell.length_a_esd ? _cell.length_b 85.646 _cell.length_b_esd ? _cell.length_c 111.910 _cell.length_c_esd ? _cell.volume 791221.935 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8T0J _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD' 32951.656 1 3.5.1.- ? ? ? 2 water nat water 18.015 10 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTKVGLRIDVDTLRGTREGVPRLLATLHRHGVQASFFFSVGPDNMGRHLWRLIKPRFLWKMLRSNAASLYGWAALLAGTA WPGKNIGNANAGIIRETATYHETGLHAWDHHAWQTHSGHWSIRQLEEDIARGITALEAIIGKPVTCSAAAGWRADGRVVR AKESFNLRYNSDCRGTTLFRPLLMPGQTGTPQIPVTLPTWDEVAGPAVQAQSFNTWIISRMLQDKGTPVYTIHAEVEGIV HQPLFEDLLVRARDAGITFCPLGELLPASPESLPLGQIVRGHIPGREGWLGCQQAVSAS ; _entity_poly.pdbx_seq_one_letter_code_can ;MTKVGLRIDVDTLRGTREGVPRLLATLHRHGVQASFFFSVGPDNMGRHLWRLIKPRFLWKMLRSNAASLYGWAALLAGTA WPGKNIGNANAGIIRETATYHETGLHAWDHHAWQTHSGHWSIRQLEEDIARGITALEAIIGKPVTCSAAAGWRADGRVVR AKESFNLRYNSDCRGTTLFRPLLMPGQTGTPQIPVTLPTWDEVAGPAVQAQSFNTWIISRMLQDKGTPVYTIHAEVEGIV HQPLFEDLLVRARDAGITFCPLGELLPASPESLPLGQIVRGHIPGREGWLGCQQAVSAS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LYS n 1 4 VAL n 1 5 GLY n 1 6 LEU n 1 7 ARG n 1 8 ILE n 1 9 ASP n 1 10 VAL n 1 11 ASP n 1 12 THR n 1 13 LEU n 1 14 ARG n 1 15 GLY n 1 16 THR n 1 17 ARG n 1 18 GLU n 1 19 GLY n 1 20 VAL n 1 21 PRO n 1 22 ARG n 1 23 LEU n 1 24 LEU n 1 25 ALA n 1 26 THR n 1 27 LEU n 1 28 HIS n 1 29 ARG n 1 30 HIS n 1 31 GLY n 1 32 VAL n 1 33 GLN n 1 34 ALA n 1 35 SER n 1 36 PHE n 1 37 PHE n 1 38 PHE n 1 39 SER n 1 40 VAL n 1 41 GLY n 1 42 PRO n 1 43 ASP n 1 44 ASN n 1 45 MET n 1 46 GLY n 1 47 ARG n 1 48 HIS n 1 49 LEU n 1 50 TRP n 1 51 ARG n 1 52 LEU n 1 53 ILE n 1 54 LYS n 1 55 PRO n 1 56 ARG n 1 57 PHE n 1 58 LEU n 1 59 TRP n 1 60 LYS n 1 61 MET n 1 62 LEU n 1 63 ARG n 1 64 SER n 1 65 ASN n 1 66 ALA n 1 67 ALA n 1 68 SER n 1 69 LEU n 1 70 TYR n 1 71 GLY n 1 72 TRP n 1 73 ALA n 1 74 ALA n 1 75 LEU n 1 76 LEU n 1 77 ALA n 1 78 GLY n 1 79 THR n 1 80 ALA n 1 81 TRP n 1 82 PRO n 1 83 GLY n 1 84 LYS n 1 85 ASN n 1 86 ILE n 1 87 GLY n 1 88 ASN n 1 89 ALA n 1 90 ASN n 1 91 ALA n 1 92 GLY n 1 93 ILE n 1 94 ILE n 1 95 ARG n 1 96 GLU n 1 97 THR n 1 98 ALA n 1 99 THR n 1 100 TYR n 1 101 HIS n 1 102 GLU n 1 103 THR n 1 104 GLY n 1 105 LEU n 1 106 HIS n 1 107 ALA n 1 108 TRP n 1 109 ASP n 1 110 HIS n 1 111 HIS n 1 112 ALA n 1 113 TRP n 1 114 GLN n 1 115 THR n 1 116 HIS n 1 117 SER n 1 118 GLY n 1 119 HIS n 1 120 TRP n 1 121 SER n 1 122 ILE n 1 123 ARG n 1 124 GLN n 1 125 LEU n 1 126 GLU n 1 127 GLU n 1 128 ASP n 1 129 ILE n 1 130 ALA n 1 131 ARG n 1 132 GLY n 1 133 ILE n 1 134 THR n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 ALA n 1 139 ILE n 1 140 ILE n 1 141 GLY n 1 142 LYS n 1 143 PRO n 1 144 VAL n 1 145 THR n 1 146 CYS n 1 147 SER n 1 148 ALA n 1 149 ALA n 1 150 ALA n 1 151 GLY n 1 152 TRP n 1 153 ARG n 1 154 ALA n 1 155 ASP n 1 156 GLY n 1 157 ARG n 1 158 VAL n 1 159 VAL n 1 160 ARG n 1 161 ALA n 1 162 LYS n 1 163 GLU n 1 164 SER n 1 165 PHE n 1 166 ASN n 1 167 LEU n 1 168 ARG n 1 169 TYR n 1 170 ASN n 1 171 SER n 1 172 ASP n 1 173 CYS n 1 174 ARG n 1 175 GLY n 1 176 THR n 1 177 THR n 1 178 LEU n 1 179 PHE n 1 180 ARG n 1 181 PRO n 1 182 LEU n 1 183 LEU n 1 184 MET n 1 185 PRO n 1 186 GLY n 1 187 GLN n 1 188 THR n 1 189 GLY n 1 190 THR n 1 191 PRO n 1 192 GLN n 1 193 ILE n 1 194 PRO n 1 195 VAL n 1 196 THR n 1 197 LEU n 1 198 PRO n 1 199 THR n 1 200 TRP n 1 201 ASP n 1 202 GLU n 1 203 VAL n 1 204 ALA n 1 205 GLY n 1 206 PRO n 1 207 ALA n 1 208 VAL n 1 209 GLN n 1 210 ALA n 1 211 GLN n 1 212 SER n 1 213 PHE n 1 214 ASN n 1 215 THR n 1 216 TRP n 1 217 ILE n 1 218 ILE n 1 219 SER n 1 220 ARG n 1 221 MET n 1 222 LEU n 1 223 GLN n 1 224 ASP n 1 225 LYS n 1 226 GLY n 1 227 THR n 1 228 PRO n 1 229 VAL n 1 230 TYR n 1 231 THR n 1 232 ILE n 1 233 HIS n 1 234 ALA n 1 235 GLU n 1 236 VAL n 1 237 GLU n 1 238 GLY n 1 239 ILE n 1 240 VAL n 1 241 HIS n 1 242 GLN n 1 243 PRO n 1 244 LEU n 1 245 PHE n 1 246 GLU n 1 247 ASP n 1 248 LEU n 1 249 LEU n 1 250 VAL n 1 251 ARG n 1 252 ALA n 1 253 ARG n 1 254 ASP n 1 255 ALA n 1 256 GLY n 1 257 ILE n 1 258 THR n 1 259 PHE n 1 260 CYS n 1 261 PRO n 1 262 LEU n 1 263 GLY n 1 264 GLU n 1 265 LEU n 1 266 LEU n 1 267 PRO n 1 268 ALA n 1 269 SER n 1 270 PRO n 1 271 GLU n 1 272 SER n 1 273 LEU n 1 274 PRO n 1 275 LEU n 1 276 GLY n 1 277 GLN n 1 278 ILE n 1 279 VAL n 1 280 ARG n 1 281 GLY n 1 282 HIS n 1 283 ILE n 1 284 PRO n 1 285 GLY n 1 286 ARG n 1 287 GLU n 1 288 GLY n 1 289 TRP n 1 290 LEU n 1 291 GLY n 1 292 CYS n 1 293 GLN n 1 294 GLN n 1 295 ALA n 1 296 VAL n 1 297 SER n 1 298 ALA n 1 299 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 299 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'arnD, pbgP4, pmrJ, STM2300' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica subsp. enterica serovar Typhimurium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 90371 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARND_SALTY _struct_ref.pdbx_db_accession O52326 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTKVGLRIDVDTLRGTREGVPRLLATLHRHGVQASFFFSVGPDNMGRHLWRLIKPRFLWKMLRSNAASLYGWDILLAGTA WPGKNIGNANAGIIRETATYHETGLHAWDHHAWQTHSGHWSIRQLEEDIARGITALEAIIGKPVTCSAAAGWRADGRVVR AKESFNLRYNSDCRGTTLFRPLLMPGQTGTPQIPVTLPTWDEVIGPAVQAQSFNTWIISRMLQDKGTPVYTIHAEVEGIV HQPLFEDLLVRARDAGITFCPLGELLPASPESLPLGQIVRGHIPGREGWLGCQQAASAS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8T0J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O52326 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 299 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 299 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8T0J ALA A 73 ? UNP O52326 ASP 73 conflict 73 1 1 8T0J ALA A 74 ? UNP O52326 ILE 74 conflict 74 2 1 8T0J ALA A 204 ? UNP O52326 ILE 204 conflict 204 3 1 8T0J VAL A 296 ? UNP O52326 ALA 296 conflict 296 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8T0J _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.00 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Crystals of ArnD were obtained by mixing 2 uL of a stock solution of ArnD (6 mg/mL) in 25mM Tris-HCl, pH8.0, 150mM NaCl, 10% glycerol, 5mM BME, 0.0174% DDM, with 2 uL of a precipitant solution containing 0.1M Na citrate pH 6.2, 10% isopropanol and 17% PEG4000 and allowing vapor diffusion between the protein droplet and a 1mL reservoir of precipitant in a hanging drop set up incubated at 16 degrees Celsius. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2008-10-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 36.33 _reflns.entry_id 8T0J _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.59 _reflns.d_resolution_low 40.74 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11633 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.44 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.82 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1012 _reflns.pdbx_Rpim_I_all 0.05888 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.0816 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.59 _reflns_shell.d_res_low 2.683 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.99 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 861 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.2924 _reflns_shell.pdbx_Rpim_I_all 0.1725 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.939 _reflns_shell.pdbx_CC_star 0.984 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 70.43 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.2342 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.01 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8T0J _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.59 _refine.ls_d_res_low 40.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11587 _refine.ls_number_reflns_R_free 578 _refine.ls_number_reflns_R_work 11009 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.32 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2284 _refine.ls_R_factor_R_free 0.2873 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2254 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.7539 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3021 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.59 _refine_hist.d_res_low 40.74 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 2094 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2084 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0074 ? 2136 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9703 ? 2907 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0502 ? 322 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0088 ? 378 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.4098 ? 765 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.59 2.85 . . 121 2223 75.39 . . . . 0.2606 . . . . . . . . . . . 0.3145 'X-RAY DIFFRACTION' 2.85 3.26 . . 159 2817 94.93 . . . . 0.2673 . . . . . . . . . . . 0.3396 'X-RAY DIFFRACTION' 3.26 4.11 . . 157 2969 98.89 . . . . 0.2104 . . . . . . . . . . . 0.2860 'X-RAY DIFFRACTION' 4.11 40.74 . . 141 3000 95.65 . . . . 0.2108 . . . . . . . . . . . 0.2540 # _struct.entry_id 8T0J _struct.title 'Salmonella Typhimurium ArnD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8T0J _struct_keywords.text 'polymyxin resistance, undecaprenyl-phospho-4-deoxy-4-formamido-arabinose deformylase, carbohydrate esterase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? GLU A 18 ? THR A 12 GLU A 18 1 ? 7 HELX_P HELX_P2 AA2 GLU A 18 ? HIS A 30 ? GLU A 18 HIS A 30 1 ? 13 HELX_P HELX_P3 AA3 ASN A 44 ? LEU A 49 ? ASN A 44 LEU A 49 5 ? 6 HELX_P HELX_P4 AA4 ALA A 73 ? ALA A 77 ? ALA A 73 ALA A 77 5 ? 5 HELX_P HELX_P5 AA5 ASN A 90 ? HIS A 101 ? ASN A 90 HIS A 101 1 ? 12 HELX_P HELX_P6 AA6 ASP A 109 ? SER A 117 ? ASP A 109 SER A 117 1 ? 9 HELX_P HELX_P7 AA7 GLY A 118 ? TRP A 120 ? GLY A 118 TRP A 120 5 ? 3 HELX_P HELX_P8 AA8 SER A 121 ? GLY A 141 ? SER A 121 GLY A 141 1 ? 21 HELX_P HELX_P9 AA9 ALA A 149 ? ARG A 153 ? ALA A 149 ARG A 153 5 ? 5 HELX_P HELX_P10 AB1 ASP A 155 ? SER A 164 ? ASP A 155 SER A 164 1 ? 10 HELX_P HELX_P11 AB2 THR A 199 ? ALA A 204 ? THR A 199 ALA A 204 1 ? 6 HELX_P HELX_P12 AB3 ALA A 210 ? GLN A 223 ? ALA A 210 GLN A 223 1 ? 14 HELX_P HELX_P13 AB4 HIS A 241 ? ALA A 255 ? HIS A 241 ALA A 255 1 ? 15 HELX_P HELX_P14 AB5 PRO A 261 ? LEU A 266 ? PRO A 261 LEU A 266 5 ? 6 HELX_P HELX_P15 AB6 SER A 269 ? LEU A 273 ? SER A 269 LEU A 273 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA3 1 2 ? parallel AA4 1 2 ? anti-parallel AA4 2 3 ? parallel AA4 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 102 ? ALA A 107 ? GLU A 102 ALA A 107 AA1 2 SER A 35 ? SER A 39 ? SER A 35 SER A 39 AA1 3 THR A 2 ? VAL A 10 ? THR A 2 VAL A 10 AA1 4 VAL A 229 ? HIS A 233 ? VAL A 229 HIS A 233 AA2 1 GLU A 102 ? ALA A 107 ? GLU A 102 ALA A 107 AA2 2 SER A 35 ? SER A 39 ? SER A 35 SER A 39 AA2 3 THR A 2 ? VAL A 10 ? THR A 2 VAL A 10 AA2 4 ILE A 257 ? CYS A 260 ? ILE A 257 CYS A 260 AA3 1 CYS A 146 ? SER A 147 ? CYS A 146 SER A 147 AA3 2 TYR A 169 ? ASN A 170 ? TYR A 169 ASN A 170 AA4 1 GLN A 187 ? THR A 188 ? GLN A 187 THR A 188 AA4 2 ARG A 180 ? MET A 184 ? ARG A 180 MET A 184 AA4 3 LEU A 275 ? GLY A 281 ? LEU A 275 GLY A 281 AA4 4 LEU A 290 ? GLN A 294 ? LEU A 290 GLN A 294 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 106 ? O HIS A 106 N PHE A 38 ? N PHE A 38 AA1 2 3 O PHE A 37 ? O PHE A 37 N ILE A 8 ? N ILE A 8 AA1 3 4 N ARG A 7 ? N ARG A 7 O TYR A 230 ? O TYR A 230 AA2 1 2 O HIS A 106 ? O HIS A 106 N PHE A 38 ? N PHE A 38 AA2 2 3 O PHE A 37 ? O PHE A 37 N ILE A 8 ? N ILE A 8 AA2 3 4 N THR A 2 ? N THR A 2 O THR A 258 ? O THR A 258 AA3 1 2 N SER A 147 ? N SER A 147 O TYR A 169 ? O TYR A 169 AA4 1 2 O GLN A 187 ? O GLN A 187 N MET A 184 ? N MET A 184 AA4 2 3 N LEU A 182 ? N LEU A 182 O GLY A 276 ? O GLY A 276 AA4 3 4 N GLY A 281 ? N GLY A 281 O LEU A 290 ? O LEU A 290 # _atom_sites.entry_id 8T0J _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012114 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011676 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008936 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TRP 50 50 ? ? ? A . n A 1 51 ARG 51 51 ? ? ? A . n A 1 52 LEU 52 52 ? ? ? A . n A 1 53 ILE 53 53 ? ? ? A . n A 1 54 LYS 54 54 ? ? ? A . n A 1 55 PRO 55 55 ? ? ? A . n A 1 56 ARG 56 56 ? ? ? A . n A 1 57 PHE 57 57 ? ? ? A . n A 1 58 LEU 58 58 ? ? ? A . n A 1 59 TRP 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 MET 61 61 ? ? ? A . n A 1 62 LEU 62 62 ? ? ? A . n A 1 63 ARG 63 63 ? ? ? A . n A 1 64 SER 64 64 ? ? ? A . n A 1 65 ASN 65 65 ? ? ? A . n A 1 66 ALA 66 66 ? ? ? A . n A 1 67 ALA 67 67 ? ? ? A . n A 1 68 SER 68 68 ? ? ? A . n A 1 69 LEU 69 69 ? ? ? A . n A 1 70 TYR 70 70 ? ? ? A . n A 1 71 GLY 71 71 ? ? ? A . n A 1 72 TRP 72 72 ? ? ? A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 CYS 146 146 146 CYS CYS A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 CYS 173 173 173 CYS CYS A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 PRO 181 181 181 PRO PRO A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 MET 184 184 184 MET MET A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 GLY 205 205 ? ? ? A . n A 1 206 PRO 206 206 ? ? ? A . n A 1 207 ALA 207 207 ? ? ? A . n A 1 208 VAL 208 208 ? ? ? A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ASN 214 214 214 ASN ASN A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 TRP 216 216 216 TRP TRP A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 MET 221 221 221 MET MET A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 HIS 233 233 233 HIS HIS A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 HIS 241 241 241 HIS HIS A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 PHE 245 245 245 PHE PHE A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 LEU 248 248 248 LEU LEU A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 ARG 251 251 251 ARG ARG A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ARG 253 253 253 ARG ARG A . n A 1 254 ASP 254 254 254 ASP ASP A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 THR 258 258 258 THR THR A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 CYS 260 260 260 CYS CYS A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 PRO 267 267 267 PRO PRO A . n A 1 268 ALA 268 268 268 ALA ALA A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 PRO 274 274 274 PRO PRO A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 GLN 277 277 277 GLN GLN A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 VAL 279 279 279 VAL VAL A . n A 1 280 ARG 280 280 280 ARG ARG A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 HIS 282 282 282 HIS HIS A . n A 1 283 ILE 283 283 283 ILE ILE A . n A 1 284 PRO 284 284 284 PRO PRO A . n A 1 285 GLY 285 285 285 GLY GLY A . n A 1 286 ARG 286 286 286 ARG ARG A . n A 1 287 GLU 287 287 287 GLU GLU A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 TRP 289 289 289 TRP TRP A . n A 1 290 LEU 290 290 290 LEU LEU A . n A 1 291 GLY 291 291 291 GLY GLY A . n A 1 292 CYS 292 292 292 CYS CYS A . n A 1 293 GLN 293 293 293 GLN GLN A . n A 1 294 GLN 294 294 294 GLN GLN A . n A 1 295 ALA 295 295 295 ALA ALA A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 SER 297 297 297 SER SER A . n A 1 298 ALA 298 298 ? ? ? A . n A 1 299 SER 299 299 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email marcelo.sousa@colorado.edu _pdbx_contact_author.name_first Marcelo _pdbx_contact_author.name_last Sousa _pdbx_contact_author.name_mi C _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0242-3619 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 9 HOH HOH A . B 2 HOH 2 302 1 HOH HOH A . B 2 HOH 3 303 5 HOH HOH A . B 2 HOH 4 304 4 HOH HOH A . B 2 HOH 5 305 11 HOH HOH A . B 2 HOH 6 306 7 HOH HOH A . B 2 HOH 7 307 8 HOH HOH A . B 2 HOH 8 308 2 HOH HOH A . B 2 HOH 9 309 12 HOH HOH A . B 2 HOH 10 310 14 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-18 2 'Structure model' 1 1 2023-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 126 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 164 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 77 ? ? -103.97 70.95 2 1 ALA A 80 ? ? -152.61 34.76 3 1 ASN A 90 ? ? -141.95 26.85 4 1 TRP A 108 ? ? -92.28 -69.09 5 1 ASP A 155 ? ? -157.75 -147.61 6 1 ASN A 166 ? ? 39.55 67.29 7 1 PHE A 179 ? ? -170.32 148.08 8 1 MET A 184 ? ? 173.70 156.00 9 1 VAL A 236 ? ? -112.00 -70.22 10 1 ILE A 239 ? ? -117.67 -95.48 11 1 PRO A 270 ? ? -58.38 -7.95 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TRP 50 ? A TRP 50 2 1 Y 1 A ARG 51 ? A ARG 51 3 1 Y 1 A LEU 52 ? A LEU 52 4 1 Y 1 A ILE 53 ? A ILE 53 5 1 Y 1 A LYS 54 ? A LYS 54 6 1 Y 1 A PRO 55 ? A PRO 55 7 1 Y 1 A ARG 56 ? A ARG 56 8 1 Y 1 A PHE 57 ? A PHE 57 9 1 Y 1 A LEU 58 ? A LEU 58 10 1 Y 1 A TRP 59 ? A TRP 59 11 1 Y 1 A LYS 60 ? A LYS 60 12 1 Y 1 A MET 61 ? A MET 61 13 1 Y 1 A LEU 62 ? A LEU 62 14 1 Y 1 A ARG 63 ? A ARG 63 15 1 Y 1 A SER 64 ? A SER 64 16 1 Y 1 A ASN 65 ? A ASN 65 17 1 Y 1 A ALA 66 ? A ALA 66 18 1 Y 1 A ALA 67 ? A ALA 67 19 1 Y 1 A SER 68 ? A SER 68 20 1 Y 1 A LEU 69 ? A LEU 69 21 1 Y 1 A TYR 70 ? A TYR 70 22 1 Y 1 A GLY 71 ? A GLY 71 23 1 Y 1 A TRP 72 ? A TRP 72 24 1 Y 1 A GLY 205 ? A GLY 205 25 1 Y 1 A PRO 206 ? A PRO 206 26 1 Y 1 A ALA 207 ? A ALA 207 27 1 Y 1 A VAL 208 ? A VAL 208 28 1 Y 1 A ALA 298 ? A ALA 298 29 1 Y 1 A SER 299 ? A SER 299 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 2R56AI060841 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 #