data_8T2N # _entry.id 8T2N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8T2N pdb_00008t2n 10.2210/pdb8t2n/pdb WWPDB D_1000272373 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8T2N _pdbx_database_status.recvd_initial_deposition_date 2023-06-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email jg.omichinski@umontreal.ca _pdbx_contact_author.name_first James _pdbx_contact_author.name_last Omichinski _pdbx_contact_author.name_mi G. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3543-1914 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ali, M.G.H.' 1 ? 'Wahba, H.M.' 2 ? 'Cyr, N.' 3 ? 'Omichinski, J.G.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first e1012093 _citation.page_last e1012093 _citation.title ;An LIR motif in the Rift Valley fever virus NSs protein is critical for the interaction with LC3 family members and inhibition of autophagy. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1012093 _citation.pdbx_database_id_PubMed 38512999 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petraccione, K.' 1 ? primary 'Ali, M.G.H.' 2 ? primary 'Cyr, N.' 3 ? primary 'Wahba, H.M.' 4 ? primary 'Stocker, T.' 5 ? primary 'Akhrymuk, M.' 6 ? primary 'Akhrymuk, I.' 7 ? primary 'Panny, L.' 8 ? primary 'Bracci, N.' 9 ? primary 'Cafaro, R.' 10 ? primary 'Sastre, D.' 11 ? primary 'Silberfarb, A.' 12 ? primary ;O'Maille, P. ; 13 ? primary 'Omichinski, J.' 14 ? primary 'Kehn-Hall, K.' 15 0000-0001-8036-7213 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gamma-aminobutyric acid receptor-associated protein' 14086.176 2 ? ? ? ? 2 polymer man 'Non-structural protein S' 2695.930 2 ? ? ? ? 3 water nat water 18.015 44 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'GABA(A) receptor-associated protein,MM46' 2 NSs # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFF FVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; ;GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFF FVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; A,C ? 2 'polypeptide(L)' no no GSGRNNWIPVIPPIPDVEMESEEE GSGRNNWIPVIPPIPDVEMESEEE B,D ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 PHE n 1 6 VAL n 1 7 TYR n 1 8 LYS n 1 9 GLU n 1 10 GLU n 1 11 HIS n 1 12 PRO n 1 13 PHE n 1 14 GLU n 1 15 LYS n 1 16 ARG n 1 17 ARG n 1 18 SER n 1 19 GLU n 1 20 GLY n 1 21 GLU n 1 22 LYS n 1 23 ILE n 1 24 ARG n 1 25 LYS n 1 26 LYS n 1 27 TYR n 1 28 PRO n 1 29 ASP n 1 30 ARG n 1 31 VAL n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 ALA n 1 39 PRO n 1 40 LYS n 1 41 ALA n 1 42 ARG n 1 43 ILE n 1 44 GLY n 1 45 ASP n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 LYS n 1 50 LYS n 1 51 TYR n 1 52 LEU n 1 53 VAL n 1 54 PRO n 1 55 SER n 1 56 ASP n 1 57 LEU n 1 58 THR n 1 59 VAL n 1 60 GLY n 1 61 GLN n 1 62 PHE n 1 63 TYR n 1 64 PHE n 1 65 LEU n 1 66 ILE n 1 67 ARG n 1 68 LYS n 1 69 ARG n 1 70 ILE n 1 71 HIS n 1 72 LEU n 1 73 ARG n 1 74 ALA n 1 75 GLU n 1 76 ASP n 1 77 ALA n 1 78 LEU n 1 79 PHE n 1 80 PHE n 1 81 PHE n 1 82 VAL n 1 83 ASN n 1 84 ASN n 1 85 VAL n 1 86 ILE n 1 87 PRO n 1 88 PRO n 1 89 THR n 1 90 SER n 1 91 ALA n 1 92 THR n 1 93 MET n 1 94 GLY n 1 95 GLN n 1 96 LEU n 1 97 TYR n 1 98 GLN n 1 99 GLU n 1 100 HIS n 1 101 HIS n 1 102 GLU n 1 103 GLU n 1 104 ASP n 1 105 PHE n 1 106 PHE n 1 107 LEU n 1 108 TYR n 1 109 ILE n 1 110 ALA n 1 111 TYR n 1 112 SER n 1 113 ASP n 1 114 GLU n 1 115 SER n 1 116 VAL n 1 117 TYR n 1 118 GLY n 1 119 LEU n 2 1 GLY n 2 2 SER n 2 3 GLY n 2 4 ARG n 2 5 ASN n 2 6 ASN n 2 7 TRP n 2 8 ILE n 2 9 PRO n 2 10 VAL n 2 11 ILE n 2 12 PRO n 2 13 PRO n 2 14 ILE n 2 15 PRO n 2 16 ASP n 2 17 VAL n 2 18 GLU n 2 19 MET n 2 20 GLU n 2 21 SER n 2 22 GLU n 2 23 GLU n 2 24 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 119 human ? 'GABARAP, FLC3B, HT004' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 24 ? ? NSS ? ? ? ? ? ? 'Rift Valley fever virus' 11588 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 LYS 4 2 2 LYS LYS A . n A 1 5 PHE 5 3 3 PHE PHE A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 TYR 7 5 5 TYR TYR A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 GLU 10 8 8 GLU GLU A . n A 1 11 HIS 11 9 9 HIS HIS A . n A 1 12 PRO 12 10 10 PRO PRO A . n A 1 13 PHE 13 11 11 PHE PHE A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 SER 18 16 16 SER SER A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 GLU 21 19 19 GLU GLU A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ILE 23 21 21 ILE ILE A . n A 1 24 ARG 24 22 22 ARG ARG A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 LYS 26 24 24 LYS LYS A . n A 1 27 TYR 27 25 25 TYR TYR A . n A 1 28 PRO 28 26 26 PRO PRO A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 PRO 39 37 37 PRO PRO A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 ALA 41 39 39 ALA ALA A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 ILE 43 41 41 ILE ILE A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 ASP 45 43 43 ASP ASP A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 ASP 47 45 45 ASP ASP A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 LYS 50 48 48 LYS LYS A . n A 1 51 TYR 51 49 49 TYR TYR A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 PRO 54 52 52 PRO PRO A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 ASP 56 54 54 ASP ASP A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 THR 58 56 56 THR THR A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 PHE 62 60 60 PHE PHE A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 PHE 64 62 62 PHE PHE A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 ILE 70 68 68 ILE ILE A . n A 1 71 HIS 71 69 69 HIS HIS A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 ARG 73 71 71 ARG ARG A . n A 1 74 ALA 74 72 72 ALA ALA A . n A 1 75 GLU 75 73 73 GLU GLU A . n A 1 76 ASP 76 74 74 ASP ASP A . n A 1 77 ALA 77 75 75 ALA ALA A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 PHE 80 78 78 PHE PHE A . n A 1 81 PHE 81 79 79 PHE PHE A . n A 1 82 VAL 82 80 80 VAL VAL A . n A 1 83 ASN 83 81 81 ASN ASN A . n A 1 84 ASN 84 82 82 ASN ASN A . n A 1 85 VAL 85 83 83 VAL VAL A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 PRO 87 85 85 PRO PRO A . n A 1 88 PRO 88 86 86 PRO PRO A . n A 1 89 THR 89 87 87 THR THR A . n A 1 90 SER 90 88 88 SER SER A . n A 1 91 ALA 91 89 89 ALA ALA A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 MET 93 91 91 MET MET A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 GLN 95 93 93 GLN GLN A . n A 1 96 LEU 96 94 94 LEU LEU A . n A 1 97 TYR 97 95 95 TYR TYR A . n A 1 98 GLN 98 96 96 GLN GLN A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 HIS 100 98 98 HIS HIS A . n A 1 101 HIS 101 99 99 HIS HIS A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 GLU 103 101 101 GLU GLU A . n A 1 104 ASP 104 102 102 ASP ASP A . n A 1 105 PHE 105 103 103 PHE PHE A . n A 1 106 PHE 106 104 104 PHE PHE A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 TYR 108 106 106 TYR TYR A . n A 1 109 ILE 109 107 107 ILE ILE A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 TYR 111 109 109 TYR TYR A . n A 1 112 SER 112 110 110 SER SER A . n A 1 113 ASP 113 111 111 ASP ASP A . n A 1 114 GLU 114 112 112 GLU GLU A . n A 1 115 SER 115 113 113 SER SER A . n A 1 116 VAL 116 114 114 VAL VAL A . n A 1 117 TYR 117 115 115 TYR TYR A . n A 1 118 GLY 118 116 116 GLY GLY A . n A 1 119 LEU 119 117 ? ? ? A . n B 2 1 GLY 1 29 ? ? ? B . n B 2 2 SER 2 30 ? ? ? B . n B 2 3 GLY 3 31 ? ? ? B . n B 2 4 ARG 4 32 ? ? ? B . n B 2 5 ASN 5 33 33 ASN ASN B . n B 2 6 ASN 6 34 34 ASN ASN B . n B 2 7 TRP 7 35 35 TRP TRP B . n B 2 8 ILE 8 36 36 ILE ILE B . n B 2 9 PRO 9 37 37 PRO PRO B . n B 2 10 VAL 10 38 38 VAL VAL B . n B 2 11 ILE 11 39 39 ILE ILE B . n B 2 12 PRO 12 40 40 PRO PRO B . n B 2 13 PRO 13 41 41 PRO PRO B . n B 2 14 ILE 14 42 42 ILE ILE B . n B 2 15 PRO 15 43 43 PRO PRO B . n B 2 16 ASP 16 44 ? ? ? B . n B 2 17 VAL 17 45 ? ? ? B . n B 2 18 GLU 18 46 ? ? ? B . n B 2 19 MET 19 47 ? ? ? B . n B 2 20 GLU 20 48 ? ? ? B . n B 2 21 SER 21 49 ? ? ? B . n B 2 22 GLU 22 50 ? ? ? B . n B 2 23 GLU 23 51 ? ? ? B . n B 2 24 GLU 24 52 ? ? ? B . n C 1 1 GLY 1 -1 ? ? ? C . n C 1 2 SER 2 0 ? ? ? C . n C 1 3 MET 3 1 1 MET MET C . n C 1 4 LYS 4 2 2 LYS LYS C . n C 1 5 PHE 5 3 3 PHE PHE C . n C 1 6 VAL 6 4 4 VAL VAL C . n C 1 7 TYR 7 5 5 TYR TYR C . n C 1 8 LYS 8 6 6 LYS LYS C . n C 1 9 GLU 9 7 7 GLU GLU C . n C 1 10 GLU 10 8 8 GLU GLU C . n C 1 11 HIS 11 9 9 HIS HIS C . n C 1 12 PRO 12 10 10 PRO PRO C . n C 1 13 PHE 13 11 11 PHE PHE C . n C 1 14 GLU 14 12 12 GLU GLU C . n C 1 15 LYS 15 13 13 LYS LYS C . n C 1 16 ARG 16 14 14 ARG ARG C . n C 1 17 ARG 17 15 15 ARG ARG C . n C 1 18 SER 18 16 16 SER SER C . n C 1 19 GLU 19 17 17 GLU GLU C . n C 1 20 GLY 20 18 18 GLY GLY C . n C 1 21 GLU 21 19 19 GLU GLU C . n C 1 22 LYS 22 20 20 LYS LYS C . n C 1 23 ILE 23 21 21 ILE ILE C . n C 1 24 ARG 24 22 22 ARG ARG C . n C 1 25 LYS 25 23 23 LYS LYS C . n C 1 26 LYS 26 24 24 LYS LYS C . n C 1 27 TYR 27 25 25 TYR TYR C . n C 1 28 PRO 28 26 26 PRO PRO C . n C 1 29 ASP 29 27 27 ASP ASP C . n C 1 30 ARG 30 28 28 ARG ARG C . n C 1 31 VAL 31 29 29 VAL VAL C . n C 1 32 PRO 32 30 30 PRO PRO C . n C 1 33 VAL 33 31 31 VAL VAL C . n C 1 34 ILE 34 32 32 ILE ILE C . n C 1 35 VAL 35 33 33 VAL VAL C . n C 1 36 GLU 36 34 34 GLU GLU C . n C 1 37 LYS 37 35 35 LYS LYS C . n C 1 38 ALA 38 36 36 ALA ALA C . n C 1 39 PRO 39 37 37 PRO PRO C . n C 1 40 LYS 40 38 38 LYS LYS C . n C 1 41 ALA 41 39 39 ALA ALA C . n C 1 42 ARG 42 40 40 ARG ARG C . n C 1 43 ILE 43 41 41 ILE ILE C . n C 1 44 GLY 44 42 42 GLY GLY C . n C 1 45 ASP 45 43 43 ASP ASP C . n C 1 46 LEU 46 44 44 LEU LEU C . n C 1 47 ASP 47 45 45 ASP ASP C . n C 1 48 LYS 48 46 46 LYS LYS C . n C 1 49 LYS 49 47 47 LYS LYS C . n C 1 50 LYS 50 48 48 LYS LYS C . n C 1 51 TYR 51 49 49 TYR TYR C . n C 1 52 LEU 52 50 50 LEU LEU C . n C 1 53 VAL 53 51 51 VAL VAL C . n C 1 54 PRO 54 52 52 PRO PRO C . n C 1 55 SER 55 53 53 SER SER C . n C 1 56 ASP 56 54 54 ASP ASP C . n C 1 57 LEU 57 55 55 LEU LEU C . n C 1 58 THR 58 56 56 THR THR C . n C 1 59 VAL 59 57 57 VAL VAL C . n C 1 60 GLY 60 58 58 GLY GLY C . n C 1 61 GLN 61 59 59 GLN GLN C . n C 1 62 PHE 62 60 60 PHE PHE C . n C 1 63 TYR 63 61 61 TYR TYR C . n C 1 64 PHE 64 62 62 PHE PHE C . n C 1 65 LEU 65 63 63 LEU LEU C . n C 1 66 ILE 66 64 64 ILE ILE C . n C 1 67 ARG 67 65 65 ARG ARG C . n C 1 68 LYS 68 66 66 LYS LYS C . n C 1 69 ARG 69 67 67 ARG ARG C . n C 1 70 ILE 70 68 68 ILE ILE C . n C 1 71 HIS 71 69 69 HIS HIS C . n C 1 72 LEU 72 70 70 LEU LEU C . n C 1 73 ARG 73 71 71 ARG ARG C . n C 1 74 ALA 74 72 72 ALA ALA C . n C 1 75 GLU 75 73 73 GLU GLU C . n C 1 76 ASP 76 74 74 ASP ASP C . n C 1 77 ALA 77 75 75 ALA ALA C . n C 1 78 LEU 78 76 76 LEU LEU C . n C 1 79 PHE 79 77 77 PHE PHE C . n C 1 80 PHE 80 78 78 PHE PHE C . n C 1 81 PHE 81 79 79 PHE PHE C . n C 1 82 VAL 82 80 80 VAL VAL C . n C 1 83 ASN 83 81 81 ASN ASN C . n C 1 84 ASN 84 82 82 ASN ASN C . n C 1 85 VAL 85 83 83 VAL VAL C . n C 1 86 ILE 86 84 84 ILE ILE C . n C 1 87 PRO 87 85 85 PRO PRO C . n C 1 88 PRO 88 86 86 PRO PRO C . n C 1 89 THR 89 87 87 THR THR C . n C 1 90 SER 90 88 88 SER SER C . n C 1 91 ALA 91 89 89 ALA ALA C . n C 1 92 THR 92 90 90 THR THR C . n C 1 93 MET 93 91 91 MET MET C . n C 1 94 GLY 94 92 92 GLY GLY C . n C 1 95 GLN 95 93 93 GLN GLN C . n C 1 96 LEU 96 94 94 LEU LEU C . n C 1 97 TYR 97 95 95 TYR TYR C . n C 1 98 GLN 98 96 96 GLN GLN C . n C 1 99 GLU 99 97 97 GLU GLU C . n C 1 100 HIS 100 98 98 HIS HIS C . n C 1 101 HIS 101 99 99 HIS HIS C . n C 1 102 GLU 102 100 100 GLU GLU C . n C 1 103 GLU 103 101 101 GLU GLU C . n C 1 104 ASP 104 102 102 ASP ASP C . n C 1 105 PHE 105 103 103 PHE PHE C . n C 1 106 PHE 106 104 104 PHE PHE C . n C 1 107 LEU 107 105 105 LEU LEU C . n C 1 108 TYR 108 106 106 TYR TYR C . n C 1 109 ILE 109 107 107 ILE ILE C . n C 1 110 ALA 110 108 108 ALA ALA C . n C 1 111 TYR 111 109 109 TYR TYR C . n C 1 112 SER 112 110 110 SER SER C . n C 1 113 ASP 113 111 111 ASP ASP C . n C 1 114 GLU 114 112 112 GLU GLU C . n C 1 115 SER 115 113 113 SER SER C . n C 1 116 VAL 116 114 114 VAL VAL C . n C 1 117 TYR 117 115 115 TYR TYR C . n C 1 118 GLY 118 116 116 GLY GLY C . n C 1 119 LEU 119 117 117 LEU LEU C . n D 2 1 GLY 1 29 ? ? ? D . n D 2 2 SER 2 30 ? ? ? D . n D 2 3 GLY 3 31 ? ? ? D . n D 2 4 ARG 4 32 ? ? ? D . n D 2 5 ASN 5 33 33 ASN ASN D . n D 2 6 ASN 6 34 34 ASN ASN D . n D 2 7 TRP 7 35 35 TRP TRP D . n D 2 8 ILE 8 36 36 ILE ILE D . n D 2 9 PRO 9 37 37 PRO PRO D . n D 2 10 VAL 10 38 38 VAL VAL D . n D 2 11 ILE 11 39 39 ILE ILE D . n D 2 12 PRO 12 40 40 PRO PRO D . n D 2 13 PRO 13 41 41 PRO PRO D . n D 2 14 ILE 14 42 42 ILE ILE D . n D 2 15 PRO 15 43 43 PRO PRO D . n D 2 16 ASP 16 44 44 ASP ASP D . n D 2 17 VAL 17 45 45 VAL VAL D . n D 2 18 GLU 18 46 46 GLU GLU D . n D 2 19 MET 19 47 47 MET MET D . n D 2 20 GLU 20 48 48 GLU GLU D . n D 2 21 SER 21 49 49 SER SER D . n D 2 22 GLU 22 50 ? ? ? D . n D 2 23 GLU 23 51 ? ? ? D . n D 2 24 GLU 24 52 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 201 32 HOH HOH A . E 3 HOH 2 202 1 HOH HOH A . E 3 HOH 3 203 37 HOH HOH A . E 3 HOH 4 204 28 HOH HOH A . E 3 HOH 5 205 2 HOH HOH A . E 3 HOH 6 206 10 HOH HOH A . E 3 HOH 7 207 39 HOH HOH A . E 3 HOH 8 208 19 HOH HOH A . E 3 HOH 9 209 9 HOH HOH A . E 3 HOH 10 210 27 HOH HOH A . E 3 HOH 11 211 15 HOH HOH A . E 3 HOH 12 212 14 HOH HOH A . E 3 HOH 13 213 18 HOH HOH A . E 3 HOH 14 214 13 HOH HOH A . E 3 HOH 15 215 34 HOH HOH A . E 3 HOH 16 216 22 HOH HOH A . E 3 HOH 17 217 4 HOH HOH A . E 3 HOH 18 218 35 HOH HOH A . E 3 HOH 19 219 38 HOH HOH A . E 3 HOH 20 220 42 HOH HOH A . E 3 HOH 21 221 25 HOH HOH A . F 3 HOH 1 201 7 HOH HOH C . F 3 HOH 2 202 6 HOH HOH C . F 3 HOH 3 203 29 HOH HOH C . F 3 HOH 4 204 11 HOH HOH C . F 3 HOH 5 205 24 HOH HOH C . F 3 HOH 6 206 17 HOH HOH C . F 3 HOH 7 207 20 HOH HOH C . F 3 HOH 8 208 23 HOH HOH C . F 3 HOH 9 209 5 HOH HOH C . F 3 HOH 10 210 44 HOH HOH C . F 3 HOH 11 211 8 HOH HOH C . F 3 HOH 12 212 36 HOH HOH C . F 3 HOH 13 213 43 HOH HOH C . F 3 HOH 14 214 33 HOH HOH C . F 3 HOH 15 215 3 HOH HOH C . F 3 HOH 16 216 16 HOH HOH C . F 3 HOH 17 217 30 HOH HOH C . F 3 HOH 18 218 12 HOH HOH C . F 3 HOH 19 219 40 HOH HOH C . F 3 HOH 20 220 21 HOH HOH C . F 3 HOH 21 221 26 HOH HOH C . G 3 HOH 1 101 31 HOH HOH D . G 3 HOH 2 102 41 HOH HOH D . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 115.81 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8T2N _cell.details ? _cell.formula_units_Z ? _cell.length_a 138.725 _cell.length_a_esd ? _cell.length_b 31.485 _cell.length_b_esd ? _cell.length_c 68.917 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8T2N _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8T2N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Potassium acetate, 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96860 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE 7B2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96860 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 7B2 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8T2N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.88 _reflns.d_resolution_low 36.74 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20163 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 88.41 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.13 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.9999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.88 _reflns_shell.d_res_low 1.947 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 833 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.105 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8T2N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.88 _refine.ls_d_res_low 36.74 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19739 _refine.ls_number_reflns_R_free 1958 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 88.19 _refine.ls_percent_reflns_R_free 9.92 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2248 _refine.ls_R_factor_R_free 0.2635 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2205 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.75 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.88 _refine_hist.d_res_low 36.74 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 2233 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2189 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2253 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.557 ? 3044 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.169 ? 866 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.049 ? 315 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 392 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.88 1.92 . . 64 469 34.00 . . . . 0.4452 . . . . . . . . . . . 0.4867 'X-RAY DIFFRACTION' 1.93 1.98 . . 77 702 49.00 . . . . 0.4202 . . . . . . . . . . . 0.4270 'X-RAY DIFFRACTION' 1.98 2.04 . . 103 928 66.00 . . . . 0.4021 . . . . . . . . . . . 0.4298 'X-RAY DIFFRACTION' 2.04 2.10 . . 126 1286 88.00 . . . . 0.3609 . . . . . . . . . . . 0.4163 'X-RAY DIFFRACTION' 2.10 2.18 . . 148 1361 97.00 . . . . 0.3356 . . . . . . . . . . . 0.3750 'X-RAY DIFFRACTION' 2.18 2.26 . . 170 1421 100.00 . . . . 0.2981 . . . . . . . . . . . 0.3295 'X-RAY DIFFRACTION' 2.26 2.37 . . 146 1434 100.00 . . . . 0.2787 . . . . . . . . . . . 0.3231 'X-RAY DIFFRACTION' 2.37 2.49 . . 161 1412 100.00 . . . . 0.2639 . . . . . . . . . . . 0.3102 'X-RAY DIFFRACTION' 2.49 2.65 . . 159 1450 100.00 . . . . 0.2520 . . . . . . . . . . . 0.2933 'X-RAY DIFFRACTION' 2.65 2.85 . . 147 1449 100.00 . . . . 0.2704 . . . . . . . . . . . 0.3173 'X-RAY DIFFRACTION' 2.85 3.14 . . 165 1447 100.00 . . . . 0.2620 . . . . . . . . . . . 0.2918 'X-RAY DIFFRACTION' 3.14 3.59 . . 158 1440 100.00 . . . . 0.2193 . . . . . . . . . . . 0.2870 'X-RAY DIFFRACTION' 3.59 4.52 . . 165 1457 100.00 . . . . 0.1823 . . . . . . . . . . . 0.2195 'X-RAY DIFFRACTION' 4.52 36.74 . . 169 1525 100.00 . . . . 0.1793 . . . . . . . . . . . 0.2203 # _struct.entry_id 8T2N _struct.title 'Crystal structure of GABARAP in complex with the LIR of NSs3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8T2N _struct_keywords.text 'Rift Valley fever virus, autophagy, LC3, GABARAP, LIR, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GBRAP_HUMAN O95166 ? 1 ;MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; 1 2 UNP NSS_RVFVZ P21698 ? 2 GRNNWIPVIPPIPDVEMESEEE 234 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8T2N A 3 ? 119 ? O95166 1 ? 117 ? 1 117 2 2 8T2N B 3 ? 24 ? P21698 234 ? 255 ? 31 52 3 1 8T2N C 3 ? 119 ? O95166 1 ? 117 ? 1 117 4 2 8T2N D 3 ? 24 ? P21698 234 ? 255 ? 31 52 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8T2N GLY A 1 ? UNP O95166 ? ? 'expression tag' -1 1 1 8T2N SER A 2 ? UNP O95166 ? ? 'expression tag' 0 2 2 8T2N GLY B 1 ? UNP P21698 ? ? 'expression tag' 29 3 2 8T2N SER B 2 ? UNP P21698 ? ? 'expression tag' 30 4 3 8T2N GLY C 1 ? UNP O95166 ? ? 'expression tag' -1 5 3 8T2N SER C 2 ? UNP O95166 ? ? 'expression tag' 0 6 4 8T2N GLY D 1 ? UNP P21698 ? ? 'expression tag' 29 7 4 8T2N SER D 2 ? UNP P21698 ? ? 'expression tag' 30 8 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1070 ? 1 MORE -7 ? 1 'SSA (A^2)' 7590 ? 2 'ABSA (A^2)' 1110 ? 2 MORE -9 ? 2 'SSA (A^2)' 8420 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E 2 1 C,D,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'isothermal titration calorimetry' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 5 ? HIS A 11 ? PHE A 3 HIS A 9 1 ? 7 HELX_P HELX_P2 AA2 PRO A 12 ? TYR A 27 ? PRO A 10 TYR A 25 1 ? 16 HELX_P HELX_P3 AA3 THR A 58 ? HIS A 71 ? THR A 56 HIS A 69 1 ? 14 HELX_P HELX_P4 AA4 THR A 92 ? HIS A 101 ? THR A 90 HIS A 99 1 ? 10 HELX_P HELX_P5 AA5 PHE C 5 ? HIS C 11 ? PHE C 3 HIS C 9 1 ? 7 HELX_P HELX_P6 AA6 PRO C 12 ? TYR C 27 ? PRO C 10 TYR C 25 1 ? 16 HELX_P HELX_P7 AA7 THR C 58 ? HIS C 71 ? THR C 56 HIS C 69 1 ? 14 HELX_P HELX_P8 AA8 THR C 92 ? HIS C 101 ? THR C 90 HIS C 99 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 117 A . ? TYR 115 A GLY 118 A ? GLY 116 A 1 -12.60 2 GLU 20 D . ? GLU 48 D SER 21 D ? SER 49 D 1 -1.36 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 79 ? PHE A 81 ? PHE A 77 PHE A 79 AA1 2 LEU A 107 ? SER A 112 ? LEU A 105 SER A 110 AA1 3 ARG A 30 ? LYS A 37 ? ARG A 28 LYS A 35 AA1 4 LYS A 50 ? PRO A 54 ? LYS A 48 PRO A 52 AA1 5 ILE B 8 ? PRO B 9 ? ILE B 36 PRO B 37 AA2 1 PHE C 79 ? PHE C 81 ? PHE C 77 PHE C 79 AA2 2 LEU C 107 ? SER C 112 ? LEU C 105 SER C 110 AA2 3 ARG C 30 ? LYS C 37 ? ARG C 28 LYS C 35 AA2 4 LYS C 50 ? PRO C 54 ? LYS C 48 PRO C 52 AA2 5 ILE D 8 ? PRO D 9 ? ILE D 36 PRO D 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 81 ? N PHE A 79 O ALA A 110 ? O ALA A 108 AA1 2 3 O LEU A 107 ? O LEU A 105 N ILE A 34 ? N ILE A 32 AA1 3 4 N VAL A 33 ? N VAL A 31 O TYR A 51 ? O TYR A 49 AA1 4 5 N LYS A 50 ? N LYS A 48 O ILE B 8 ? O ILE B 36 AA2 1 2 N PHE C 81 ? N PHE C 79 O ALA C 110 ? O ALA C 108 AA2 2 3 O LEU C 107 ? O LEU C 105 N ILE C 34 ? N ILE C 32 AA2 3 4 N VAL C 33 ? N VAL C 31 O TYR C 51 ? O TYR C 49 AA2 4 5 N LEU C 52 ? N LEU C 50 O ILE D 8 ? O ILE D 36 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 43 ? ? O A HOH 201 ? ? 2.03 2 1 N D ASN 33 ? ? O D HOH 101 ? ? 2.06 3 1 O A HOH 217 ? ? O A HOH 220 ? ? 2.09 4 1 O C HOH 215 ? ? O C HOH 221 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP D 44 ? ? 77.25 134.41 2 1 MET D 47 ? ? -73.09 -165.35 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -12.7920 -11.8904 6.1885 0.5988 ? 0.0026 ? -0.0018 ? 0.4918 ? 0.0187 ? 0.4558 ? 4.6805 ? -0.2053 ? 0.3868 ? 1.3635 ? -0.3117 ? 3.5685 ? -0.2517 ? 0.9854 ? 0.1817 ? -0.4468 ? 0.0293 ? 0.3431 ? -0.5124 ? -0.4859 ? -0.0108 ? 2 'X-RAY DIFFRACTION' ? refined -3.1464 -12.7744 18.1649 0.4808 ? -0.0008 ? 0.0460 ? 0.4346 ? 0.0571 ? 0.5448 ? 0.9213 ? -1.2290 ? 0.5429 ? 2.0034 ? 0.1336 ? 2.6323 ? 0.1105 ? -0.0013 ? 0.4072 ? -0.1637 ? -0.0673 ? -0.6405 ? -0.4643 ? 0.3790 ? -0.0009 ? 3 'X-RAY DIFFRACTION' ? refined -15.3280 -17.5569 11.5026 0.6602 ? 0.0171 ? 0.0824 ? 0.5335 ? -0.0364 ? 0.6673 ? 1.0056 ? -0.9222 ? 0.0642 ? 1.2262 ? 0.4719 ? 1.2358 ? 0.1148 ? 0.3764 ? -0.3735 ? 0.1135 ? -0.2579 ? 0.7984 ? 0.5515 ? -0.7979 ? 0.0229 ? 4 'X-RAY DIFFRACTION' ? refined -11.2878 -6.3235 26.1485 1.0193 ? -0.1653 ? 0.1206 ? 0.9486 ? -0.2468 ? 0.9956 ? 0.3427 ? -0.3682 ? 0.0982 ? 0.4000 ? -0.1361 ? 0.2345 ? -0.4699 ? -0.0967 ? 1.0343 ? 0.2940 ? 0.3819 ? 1.3767 ? -0.8518 ? -1.0639 ? 0.0075 ? 5 'X-RAY DIFFRACTION' ? refined -0.8366 -16.5440 3.4049 0.8802 ? -0.0253 ? 0.1994 ? 1.1712 ? 0.1781 ? 0.8848 ? 0.5327 ? 0.6137 ? 1.1050 ? 0.7083 ? 1.2758 ? 2.2961 ? -0.2239 ? -0.1834 ? -0.6467 ? 0.3489 ? 0.2389 ? -0.7674 ? 0.9832 ? 0.9457 ? 0.0348 ? 6 'X-RAY DIFFRACTION' ? refined -35.0356 -16.3088 9.9902 0.7154 ? -0.0626 ? -0.1575 ? 1.0039 ? -0.0897 ? 0.6927 ? 1.5398 ? 0.5979 ? -0.5608 ? 0.2775 ? -0.4104 ? 2.0033 ? 0.1313 ? 1.5382 ? -0.2088 ? -0.9835 ? -0.3916 ? 0.3353 ? 0.5228 ? -0.2122 ? -0.0083 ? 7 'X-RAY DIFFRACTION' ? refined -34.1802 -13.2461 25.6767 0.3927 ? -0.0149 ? -0.0061 ? 0.4021 ? -0.0152 ? 0.4929 ? 2.5078 ? -0.9284 ? 1.8037 ? 1.6611 ? -0.4916 ? 6.1434 ? 0.0313 ? -0.0612 ? -0.0147 ? 0.0887 ? 0.1932 ? 0.4410 ? 0.0245 ? -0.6325 ? 0.0001 ? 8 'X-RAY DIFFRACTION' ? refined -45.8674 -15.0062 16.7484 0.7201 ? 0.0217 ? -0.1731 ? 1.3971 ? -0.0288 ? 1.1066 ? 0.0616 ? 0.0165 ? 0.0016 ? 0.1122 ? -0.1603 ? 0.2393 ? -0.4112 ? 0.0911 ? -0.1201 ? -0.8478 ? 0.6210 ? 0.5830 ? 0.2518 ? -0.5790 ? -0.0001 ? 9 'X-RAY DIFFRACTION' ? refined -47.9604 -0.5744 39.3798 1.1641 ? 0.1929 ? -0.0763 ? 1.8010 ? -0.0962 ? 1.3288 ? 0.2103 ? -0.2487 ? -0.1432 ? 0.2881 ? 0.1692 ? 0.0969 ? 0.0427 ? -1.1769 ? 0.0851 ? 1.0947 ? 0.1046 ? -0.7201 ? -0.1485 ? 0.1721 ? -0.0022 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 56 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 57 through 90 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 91 through 110 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 111 through 116 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 33 through 43 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 1 through 24 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'C' and (resid 25 through 117 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 33 through 37 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ? ? ;chain 'D' and (resid 38 through 49 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A LEU 117 ? A LEU 119 4 1 Y 1 B GLY 29 ? B GLY 1 5 1 Y 1 B SER 30 ? B SER 2 6 1 Y 1 B GLY 31 ? B GLY 3 7 1 Y 1 B ARG 32 ? B ARG 4 8 1 Y 1 B ASP 44 ? B ASP 16 9 1 Y 1 B VAL 45 ? B VAL 17 10 1 Y 1 B GLU 46 ? B GLU 18 11 1 Y 1 B MET 47 ? B MET 19 12 1 Y 1 B GLU 48 ? B GLU 20 13 1 Y 1 B SER 49 ? B SER 21 14 1 Y 1 B GLU 50 ? B GLU 22 15 1 Y 1 B GLU 51 ? B GLU 23 16 1 Y 1 B GLU 52 ? B GLU 24 17 1 Y 1 C GLY -1 ? C GLY 1 18 1 Y 1 C SER 0 ? C SER 2 19 1 Y 1 D GLY 29 ? D GLY 1 20 1 Y 1 D SER 30 ? D SER 2 21 1 Y 1 D GLY 31 ? D GLY 3 22 1 Y 1 D ARG 32 ? D ARG 4 23 1 Y 1 D GLU 50 ? D GLU 22 24 1 Y 1 D GLU 51 ? D GLU 23 25 1 Y 1 D GLU 52 ? D GLU 24 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Defense Threat Reduction Agency (DTRA)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1GNU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8T2N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.007209 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003486 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.031761 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016118 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_