data_8T32 # _entry.id 8T32 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.393 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8T32 pdb_00008t32 10.2210/pdb8t32/pdb WWPDB D_1000274891 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-22 2 'Structure model' 1 1 2024-06-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.page_first' 2 2 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8T32 _pdbx_database_status.recvd_initial_deposition_date 2023-06-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 8T2L unspecified PDB . 8T2M unspecified PDB . 8T2N unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email jg.omichinski@umontreal.ca _pdbx_contact_author.name_first James _pdbx_contact_author.name_last Omichinski _pdbx_contact_author.name_mi G. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3543-1914 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ali, M.G.H.' 1 ? 'Wahba, H.M.' 2 ? 'Cyr, N.' 3 ? 'Omichinski, J.G.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Autophagy _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1554-8635 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first 1 _citation.page_last 20 _citation.title ;Structural and functional characterization of the role of acetylation on the interactions of the human Atg8-family proteins with the autophagy receptor TP53INP2/DOR. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1080/15548627.2024.2353443 _citation.pdbx_database_id_PubMed 38726830 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ali, M.G.' 1 ? primary 'Wahba, H.M.' 2 ? primary 'Igelmann, S.' 3 ? primary 'Cyr, N.' 4 ? primary 'Ferbeyre, G.' 5 ? primary 'Omichinski, J.G.' 6 0000-0002-3543-1914 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Gamma-aminobutyric acid receptor-associated protein' 14127.205 1 ? ? ? ? 2 polymer man 'LIR of DOR' 1528.660 1 ? ? ? ? 3 non-polymer syn 'TRIETHYLENE GLYCOL' 150.173 1 ? ? ? ? 4 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GABA(A) receptor-associated protein,MM46' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKK(ALY)YLVPSDLTVGQFYFLIRKRIHLRAED ALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; ;GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFF FVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; A ? 2 'polypeptide(L)' no no GSEVDGWLIIDLPD GSEVDGWLIIDLPD B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'TRIETHYLENE GLYCOL' PGE 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 PHE n 1 6 VAL n 1 7 TYR n 1 8 LYS n 1 9 GLU n 1 10 GLU n 1 11 HIS n 1 12 PRO n 1 13 PHE n 1 14 GLU n 1 15 LYS n 1 16 ARG n 1 17 ARG n 1 18 SER n 1 19 GLU n 1 20 GLY n 1 21 GLU n 1 22 LYS n 1 23 ILE n 1 24 ARG n 1 25 LYS n 1 26 LYS n 1 27 TYR n 1 28 PRO n 1 29 ASP n 1 30 ARG n 1 31 VAL n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 ALA n 1 39 PRO n 1 40 LYS n 1 41 ALA n 1 42 ARG n 1 43 ILE n 1 44 GLY n 1 45 ASP n 1 46 LEU n 1 47 ASP n 1 48 LYS n 1 49 LYS n 1 50 ALY n 1 51 TYR n 1 52 LEU n 1 53 VAL n 1 54 PRO n 1 55 SER n 1 56 ASP n 1 57 LEU n 1 58 THR n 1 59 VAL n 1 60 GLY n 1 61 GLN n 1 62 PHE n 1 63 TYR n 1 64 PHE n 1 65 LEU n 1 66 ILE n 1 67 ARG n 1 68 LYS n 1 69 ARG n 1 70 ILE n 1 71 HIS n 1 72 LEU n 1 73 ARG n 1 74 ALA n 1 75 GLU n 1 76 ASP n 1 77 ALA n 1 78 LEU n 1 79 PHE n 1 80 PHE n 1 81 PHE n 1 82 VAL n 1 83 ASN n 1 84 ASN n 1 85 VAL n 1 86 ILE n 1 87 PRO n 1 88 PRO n 1 89 THR n 1 90 SER n 1 91 ALA n 1 92 THR n 1 93 MET n 1 94 GLY n 1 95 GLN n 1 96 LEU n 1 97 TYR n 1 98 GLN n 1 99 GLU n 1 100 HIS n 1 101 HIS n 1 102 GLU n 1 103 GLU n 1 104 ASP n 1 105 PHE n 1 106 PHE n 1 107 LEU n 1 108 TYR n 1 109 ILE n 1 110 ALA n 1 111 TYR n 1 112 SER n 1 113 ASP n 1 114 GLU n 1 115 SER n 1 116 VAL n 1 117 TYR n 1 118 GLY n 1 119 LEU n 2 1 GLY n 2 2 SER n 2 3 GLU n 2 4 VAL n 2 5 ASP n 2 6 GLY n 2 7 TRP n 2 8 LEU n 2 9 ILE n 2 10 ILE n 2 11 ASP n 2 12 LEU n 2 13 PRO n 2 14 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 119 human ? 'GABARAP, FLC3B, HT004' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 14 ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PGE non-polymer . 'TRIETHYLENE GLYCOL' ? 'C6 H14 O4' 150.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 LYS 4 2 2 LYS LYS A . n A 1 5 PHE 5 3 3 PHE PHE A . n A 1 6 VAL 6 4 4 VAL VAL A . n A 1 7 TYR 7 5 5 TYR TYR A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 GLU 10 8 8 GLU GLU A . n A 1 11 HIS 11 9 9 HIS HIS A . n A 1 12 PRO 12 10 10 PRO PRO A . n A 1 13 PHE 13 11 11 PHE PHE A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 SER 18 16 16 SER SER A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 GLY 20 18 18 GLY GLY A . n A 1 21 GLU 21 19 19 GLU GLU A . n A 1 22 LYS 22 20 20 LYS LYS A . n A 1 23 ILE 23 21 21 ILE ILE A . n A 1 24 ARG 24 22 22 ARG ARG A . n A 1 25 LYS 25 23 23 LYS LYS A . n A 1 26 LYS 26 24 24 LYS LYS A . n A 1 27 TYR 27 25 25 TYR TYR A . n A 1 28 PRO 28 26 26 PRO PRO A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 ARG 30 28 28 ARG ARG A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 LYS 37 35 35 LYS LYS A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 PRO 39 37 37 PRO PRO A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 ALA 41 39 39 ALA ALA A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 ILE 43 41 41 ILE ILE A . n A 1 44 GLY 44 42 42 GLY GLY A . n A 1 45 ASP 45 43 43 ASP ASP A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 ASP 47 45 45 ASP ASP A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 LYS 49 47 47 LYS LYS A . n A 1 50 ALY 50 48 48 ALY ALY A . n A 1 51 TYR 51 49 49 TYR TYR A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 PRO 54 52 52 PRO PRO A . n A 1 55 SER 55 53 53 SER SER A . n A 1 56 ASP 56 54 54 ASP ASP A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 THR 58 56 56 THR THR A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 GLY 60 58 58 GLY GLY A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 PHE 62 60 60 PHE PHE A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 PHE 64 62 62 PHE PHE A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 LYS 68 66 66 LYS LYS A . n A 1 69 ARG 69 67 67 ARG ARG A . n A 1 70 ILE 70 68 68 ILE ILE A . n A 1 71 HIS 71 69 69 HIS HIS A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 ARG 73 71 71 ARG ARG A . n A 1 74 ALA 74 72 72 ALA ALA A . n A 1 75 GLU 75 73 73 GLU GLU A . n A 1 76 ASP 76 74 74 ASP ASP A . n A 1 77 ALA 77 75 75 ALA ALA A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 PHE 80 78 78 PHE PHE A . n A 1 81 PHE 81 79 79 PHE PHE A . n A 1 82 VAL 82 80 80 VAL VAL A . n A 1 83 ASN 83 81 81 ASN ASN A . n A 1 84 ASN 84 82 82 ASN ASN A . n A 1 85 VAL 85 83 83 VAL VAL A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 PRO 87 85 85 PRO PRO A . n A 1 88 PRO 88 86 86 PRO PRO A . n A 1 89 THR 89 87 87 THR THR A . n A 1 90 SER 90 88 88 SER SER A . n A 1 91 ALA 91 89 89 ALA ALA A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 MET 93 91 91 MET MET A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 GLN 95 93 93 GLN GLN A . n A 1 96 LEU 96 94 94 LEU LEU A . n A 1 97 TYR 97 95 95 TYR TYR A . n A 1 98 GLN 98 96 96 GLN GLN A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 HIS 100 98 98 HIS HIS A . n A 1 101 HIS 101 99 99 HIS HIS A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 GLU 103 101 101 GLU GLU A . n A 1 104 ASP 104 102 102 ASP ASP A . n A 1 105 PHE 105 103 103 PHE PHE A . n A 1 106 PHE 106 104 104 PHE PHE A . n A 1 107 LEU 107 105 105 LEU LEU A . n A 1 108 TYR 108 106 106 TYR TYR A . n A 1 109 ILE 109 107 107 ILE ILE A . n A 1 110 ALA 110 108 108 ALA ALA A . n A 1 111 TYR 111 109 109 TYR TYR A . n A 1 112 SER 112 110 110 SER SER A . n A 1 113 ASP 113 111 111 ASP ASP A . n A 1 114 GLU 114 112 112 GLU GLU A . n A 1 115 SER 115 113 113 SER SER A . n A 1 116 VAL 116 114 114 VAL VAL A . n A 1 117 TYR 117 115 115 TYR TYR A . n A 1 118 GLY 118 116 ? ? ? A . n A 1 119 LEU 119 117 ? ? ? A . n B 2 1 GLY 1 29 ? ? ? B . n B 2 2 SER 2 30 30 SER SER B . n B 2 3 GLU 3 31 31 GLU GLU B . n B 2 4 VAL 4 32 32 VAL VAL B . n B 2 5 ASP 5 33 33 ASP ASP B . n B 2 6 GLY 6 34 34 GLY GLY B . n B 2 7 TRP 7 35 35 TRP TRP B . n B 2 8 LEU 8 36 36 LEU LEU B . n B 2 9 ILE 9 37 37 ILE ILE B . n B 2 10 ILE 10 38 38 ILE ILE B . n B 2 11 ASP 11 39 39 ASP ASP B . n B 2 12 LEU 12 40 40 LEU LEU B . n B 2 13 PRO 13 41 41 PRO PRO B . n B 2 14 ASP 14 42 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 PGE 1 201 201 PGE PGE A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 5 HOH HOH A . D 4 HOH 3 303 13 HOH HOH A . D 4 HOH 4 304 2 HOH HOH A . D 4 HOH 5 305 11 HOH HOH A . D 4 HOH 6 306 12 HOH HOH A . D 4 HOH 7 307 10 HOH HOH A . D 4 HOH 8 308 9 HOH HOH A . D 4 HOH 9 309 4 HOH HOH A . D 4 HOH 10 310 8 HOH HOH A . D 4 HOH 11 311 7 HOH HOH A . D 4 HOH 12 312 3 HOH HOH A . D 4 HOH 13 313 6 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8T32 _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.179 _cell.length_a_esd ? _cell.length_b 44.179 _cell.length_b_esd ? _cell.length_c 128.859 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8T32 _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8T32 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 38.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '28 % (w/v) PEG 2000 MME, 0.1 M Bis-Tris: HCl, pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-06 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96870 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CHESS BEAMLINE 7B2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96870 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 7B2 _diffrn_source.pdbx_synchrotron_site CHESS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8T32 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.051 _reflns.d_resolution_low 30.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8486 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.31 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.91 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.051 _reflns_shell.d_res_low 2.124 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 648 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.408 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8T32 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.051 _refine.ls_d_res_low 30.8 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8401 _refine.ls_number_reflns_R_free 842 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.32 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2566 _refine.ls_R_factor_R_free 0.2709 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2549 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.97 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1064 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1087 _refine_hist.d_res_high 2.051 _refine_hist.d_res_low 30.8 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1102 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.463 ? 1482 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.940 ? 663 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 153 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 189 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.051 2.1791 . . 121 1058 85.00 . . . . 0.3930 . . . . . . . . . . . 0.4253 'X-RAY DIFFRACTION' 2.1791 2.3472 . . 138 1260 99.00 . . . . 0.3190 . . . . . . . . . . . 0.3190 'X-RAY DIFFRACTION' 2.3472 2.5834 . . 139 1253 100.00 . . . . 0.3153 . . . . . . . . . . . 0.3718 'X-RAY DIFFRACTION' 2.5834 2.9569 . . 142 1283 100.00 . . . . 0.3060 . . . . . . . . . . . 0.3322 'X-RAY DIFFRACTION' 2.9569 3.7244 . . 145 1300 100.00 . . . . 0.2786 . . . . . . . . . . . 0.2786 # _struct.entry_id 8T32 _struct.title 'Crystal structure of K48 acetylated GABARAP in complex with the LIR of TP53INP2/DOR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8T32 _struct_keywords.text 'Autophagy, GABARAP acetylation, DOR LIR, TP53INP2 LIR, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GBRAP_HUMAN O95166 ? 1 ;MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFV NNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL ; 1 2 PDB 8T32 8T32 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 8T32 A 3 ? 119 ? O95166 1 ? 117 ? 1 117 2 2 8T32 B 1 ? 14 ? 8T32 29 ? 42 ? 29 42 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8T32 GLY A 1 ? UNP O95166 ? ? 'expression tag' -1 1 1 8T32 SER A 2 ? UNP O95166 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 5 ? HIS A 11 ? PHE A 3 HIS A 9 1 ? 7 HELX_P HELX_P2 AA2 PRO A 12 ? TYR A 27 ? PRO A 10 TYR A 25 1 ? 16 HELX_P HELX_P3 AA3 THR A 58 ? HIS A 71 ? THR A 56 HIS A 69 1 ? 14 HELX_P HELX_P4 AA4 THR A 92 ? HIS A 101 ? THR A 90 HIS A 99 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LYS 49 C ? ? ? 1_555 A ALY 50 N ? ? A LYS 47 A ALY 48 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A ALY 50 C ? ? ? 1_555 A TYR 51 N ? ? A ALY 48 A TYR 49 1_555 ? ? ? ? ? ? ? 1.331 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 79 ? PHE A 81 ? PHE A 77 PHE A 79 AA1 2 LEU A 107 ? SER A 112 ? LEU A 105 SER A 110 AA1 3 ARG A 30 ? LYS A 37 ? ARG A 28 LYS A 35 AA1 4 ALY A 50 ? PRO A 54 ? ALY A 48 PRO A 52 AA1 5 TRP B 7 ? ILE B 9 ? TRP B 35 ILE B 37 AA1 6 GLU B 3 ? VAL B 4 ? GLU B 31 VAL B 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 81 ? N PHE A 79 O ALA A 110 ? O ALA A 108 AA1 2 3 O LEU A 107 ? O LEU A 105 N ILE A 34 ? N ILE A 32 AA1 3 4 N VAL A 33 ? N VAL A 31 O TYR A 51 ? O TYR A 49 AA1 4 5 N LEU A 52 ? N LEU A 50 O LEU B 8 ? O LEU B 36 AA1 5 6 O TRP B 7 ? O TRP B 35 N VAL B 4 ? N VAL B 32 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PRO _pdbx_validate_close_contact.auth_seq_id_1 85 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.02 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 33 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 35.08 _pdbx_validate_torsion.psi 44.47 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ALY _pdbx_struct_mod_residue.label_seq_id 50 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ALY _pdbx_struct_mod_residue.auth_seq_id 48 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -1.1172 -11.8861 23.1586 0.8176 ? 0.0399 ? 0.2733 ? 0.9075 ? 0.2000 ? 1.0818 ? 4.0522 ? 2.3099 ? 0.1656 ? 3.2897 ? 2.8834 ? 7.6252 ? -0.6672 ? -1.4114 ? -1.1642 ? -0.0273 ? -0.3267 ? 0.6065 ? 2.1993 ? -1.3409 ? 0.0970 ? 2 'X-RAY DIFFRACTION' ? refined 10.7041 -7.0993 26.6588 1.0661 ? 0.1445 ? -0.0636 ? 1.0296 ? -0.0198 ? 0.5863 ? 3.2931 ? -0.9342 ? -2.7411 ? 6.0763 ? -0.5175 ? 7.1886 ? -0.4596 ? -1.4566 ? 0.1961 ? 1.9994 ? 0.7535 ? -0.1909 ? -0.4276 ? 0.7226 ? -0.0078 ? 3 'X-RAY DIFFRACTION' ? refined 11.4101 -15.0223 12.2670 0.6610 ? 0.2050 ? 0.0041 ? 0.6603 ? 0.1035 ? 0.4903 ? 7.2233 ? 0.0912 ? -4.2966 ? 6.9524 ? -0.9004 ? 9.3649 ? -0.6579 ? -0.5375 ? -0.4432 ? 0.3375 ? 0.1985 ? -0.1710 ? 1.3091 ? 0.4904 ? -0.1238 ? 4 'X-RAY DIFFRACTION' ? refined 10.2941 -7.5460 8.4596 0.3768 ? 0.0034 ? 0.0389 ? 0.5212 ? 0.0147 ? 0.5254 ? 2.3523 ? 3.1675 ? 1.0840 ? 6.4077 ? -2.6736 ? 9.6705 ? -0.2223 ? -0.5258 ? -0.0797 ? -0.1128 ? 0.4194 ? -0.6022 ? 0.0437 ? 0.8552 ? 0.0251 ? 5 'X-RAY DIFFRACTION' ? refined 5.8630 -5.6455 19.1834 0.6161 ? 0.0884 ? 0.0230 ? 0.4916 ? 0.1071 ? 0.5078 ? 3.3773 ? 0.0170 ? -2.8044 ? 2.3995 ? -2.4735 ? 4.5448 ? -0.2226 ? -0.4420 ? 0.2079 ? 0.7131 ? 0.2950 ? 0.2208 ? -0.3331 ? 0.3047 ? -0.0004 ? 6 'X-RAY DIFFRACTION' ? refined -0.2679 -10.9110 2.2761 0.6914 ? -0.1292 ? 0.0413 ? 1.0541 ? 0.3179 ? 0.8277 ? 8.0248 ? 1.2277 ? -5.4366 ? 2.0009 ? -8.8925 ? 9.3550 ? -0.0210 ? 0.8291 ? 0.1970 ? -2.0666 ? 1.2048 ? 3.9260 ? 2.0288 ? -4.5241 ? 2.1779 ? 7 'X-RAY DIFFRACTION' ? refined 17.8994 -15.9660 22.5889 1.1099 ? 0.2667 ? -0.1959 ? 1.3570 ? 0.1730 ? 1.0034 ? 2.6763 ? -1.5949 ? 0.9010 ? 2.5338 ? -0.7622 ? 2.4303 ? -0.3336 ? -1.0349 ? -0.8793 ? 1.0152 ? -0.0888 ? -0.8668 ? -0.1309 ? 1.6881 ? 0.0221 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 2 through 10 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 11 through 35 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 36 through 68 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 69 through 98 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 99 through 110 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 111 through 115 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'B' and (resid 30 through 41 ) ; # _pdbx_entry_details.entry_id 8T32 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A GLY 116 ? A GLY 118 5 1 Y 1 A LEU 117 ? A LEU 119 6 1 Y 1 B GLY 29 ? B GLY 1 7 1 Y 1 B ASP 42 ? B ASP 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 GLN N N N N 103 GLN CA C N S 104 GLN C C N N 105 GLN O O N N 106 GLN CB C N N 107 GLN CG C N N 108 GLN CD C N N 109 GLN OE1 O N N 110 GLN NE2 N N N 111 GLN OXT O N N 112 GLN H H N N 113 GLN H2 H N N 114 GLN HA H N N 115 GLN HB2 H N N 116 GLN HB3 H N N 117 GLN HG2 H N N 118 GLN HG3 H N N 119 GLN HE21 H N N 120 GLN HE22 H N N 121 GLN HXT H N N 122 GLU N N N N 123 GLU CA C N S 124 GLU C C N N 125 GLU O O N N 126 GLU CB C N N 127 GLU CG C N N 128 GLU CD C N N 129 GLU OE1 O N N 130 GLU OE2 O N N 131 GLU OXT O N N 132 GLU H H N N 133 GLU H2 H N N 134 GLU HA H N N 135 GLU HB2 H N N 136 GLU HB3 H N N 137 GLU HG2 H N N 138 GLU HG3 H N N 139 GLU HE2 H N N 140 GLU HXT H N N 141 GLY N N N N 142 GLY CA C N N 143 GLY C C N N 144 GLY O O N N 145 GLY OXT O N N 146 GLY H H N N 147 GLY H2 H N N 148 GLY HA2 H N N 149 GLY HA3 H N N 150 GLY HXT H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PGE C1 C N N 265 PGE O1 O N N 266 PGE C2 C N N 267 PGE O2 O N N 268 PGE C3 C N N 269 PGE C4 C N N 270 PGE O4 O N N 271 PGE C6 C N N 272 PGE C5 C N N 273 PGE O3 O N N 274 PGE H1 H N N 275 PGE H12 H N N 276 PGE HO1 H N N 277 PGE H2 H N N 278 PGE H22 H N N 279 PGE H3 H N N 280 PGE H32 H N N 281 PGE H4 H N N 282 PGE H42 H N N 283 PGE HO4 H N N 284 PGE H6 H N N 285 PGE H62 H N N 286 PGE H5 H N N 287 PGE H52 H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 GLN N CA sing N N 98 GLN N H sing N N 99 GLN N H2 sing N N 100 GLN CA C sing N N 101 GLN CA CB sing N N 102 GLN CA HA sing N N 103 GLN C O doub N N 104 GLN C OXT sing N N 105 GLN CB CG sing N N 106 GLN CB HB2 sing N N 107 GLN CB HB3 sing N N 108 GLN CG CD sing N N 109 GLN CG HG2 sing N N 110 GLN CG HG3 sing N N 111 GLN CD OE1 doub N N 112 GLN CD NE2 sing N N 113 GLN NE2 HE21 sing N N 114 GLN NE2 HE22 sing N N 115 GLN OXT HXT sing N N 116 GLU N CA sing N N 117 GLU N H sing N N 118 GLU N H2 sing N N 119 GLU CA C sing N N 120 GLU CA CB sing N N 121 GLU CA HA sing N N 122 GLU C O doub N N 123 GLU C OXT sing N N 124 GLU CB CG sing N N 125 GLU CB HB2 sing N N 126 GLU CB HB3 sing N N 127 GLU CG CD sing N N 128 GLU CG HG2 sing N N 129 GLU CG HG3 sing N N 130 GLU CD OE1 doub N N 131 GLU CD OE2 sing N N 132 GLU OE2 HE2 sing N N 133 GLU OXT HXT sing N N 134 GLY N CA sing N N 135 GLY N H sing N N 136 GLY N H2 sing N N 137 GLY CA C sing N N 138 GLY CA HA2 sing N N 139 GLY CA HA3 sing N N 140 GLY C O doub N N 141 GLY C OXT sing N N 142 GLY OXT HXT sing N N 143 HIS N CA sing N N 144 HIS N H sing N N 145 HIS N H2 sing N N 146 HIS CA C sing N N 147 HIS CA CB sing N N 148 HIS CA HA sing N N 149 HIS C O doub N N 150 HIS C OXT sing N N 151 HIS CB CG sing N N 152 HIS CB HB2 sing N N 153 HIS CB HB3 sing N N 154 HIS CG ND1 sing Y N 155 HIS CG CD2 doub Y N 156 HIS ND1 CE1 doub Y N 157 HIS ND1 HD1 sing N N 158 HIS CD2 NE2 sing Y N 159 HIS CD2 HD2 sing N N 160 HIS CE1 NE2 sing Y N 161 HIS CE1 HE1 sing N N 162 HIS NE2 HE2 sing N N 163 HIS OXT HXT sing N N 164 HOH O H1 sing N N 165 HOH O H2 sing N N 166 ILE N CA sing N N 167 ILE N H sing N N 168 ILE N H2 sing N N 169 ILE CA C sing N N 170 ILE CA CB sing N N 171 ILE CA HA sing N N 172 ILE C O doub N N 173 ILE C OXT sing N N 174 ILE CB CG1 sing N N 175 ILE CB CG2 sing N N 176 ILE CB HB sing N N 177 ILE CG1 CD1 sing N N 178 ILE CG1 HG12 sing N N 179 ILE CG1 HG13 sing N N 180 ILE CG2 HG21 sing N N 181 ILE CG2 HG22 sing N N 182 ILE CG2 HG23 sing N N 183 ILE CD1 HD11 sing N N 184 ILE CD1 HD12 sing N N 185 ILE CD1 HD13 sing N N 186 ILE OXT HXT sing N N 187 LEU N CA sing N N 188 LEU N H sing N N 189 LEU N H2 sing N N 190 LEU CA C sing N N 191 LEU CA CB sing N N 192 LEU CA HA sing N N 193 LEU C O doub N N 194 LEU C OXT sing N N 195 LEU CB CG sing N N 196 LEU CB HB2 sing N N 197 LEU CB HB3 sing N N 198 LEU CG CD1 sing N N 199 LEU CG CD2 sing N N 200 LEU CG HG sing N N 201 LEU CD1 HD11 sing N N 202 LEU CD1 HD12 sing N N 203 LEU CD1 HD13 sing N N 204 LEU CD2 HD21 sing N N 205 LEU CD2 HD22 sing N N 206 LEU CD2 HD23 sing N N 207 LEU OXT HXT sing N N 208 LYS N CA sing N N 209 LYS N H sing N N 210 LYS N H2 sing N N 211 LYS CA C sing N N 212 LYS CA CB sing N N 213 LYS CA HA sing N N 214 LYS C O doub N N 215 LYS C OXT sing N N 216 LYS CB CG sing N N 217 LYS CB HB2 sing N N 218 LYS CB HB3 sing N N 219 LYS CG CD sing N N 220 LYS CG HG2 sing N N 221 LYS CG HG3 sing N N 222 LYS CD CE sing N N 223 LYS CD HD2 sing N N 224 LYS CD HD3 sing N N 225 LYS CE NZ sing N N 226 LYS CE HE2 sing N N 227 LYS CE HE3 sing N N 228 LYS NZ HZ1 sing N N 229 LYS NZ HZ2 sing N N 230 LYS NZ HZ3 sing N N 231 LYS OXT HXT sing N N 232 MET N CA sing N N 233 MET N H sing N N 234 MET N H2 sing N N 235 MET CA C sing N N 236 MET CA CB sing N N 237 MET CA HA sing N N 238 MET C O doub N N 239 MET C OXT sing N N 240 MET CB CG sing N N 241 MET CB HB2 sing N N 242 MET CB HB3 sing N N 243 MET CG SD sing N N 244 MET CG HG2 sing N N 245 MET CG HG3 sing N N 246 MET SD CE sing N N 247 MET CE HE1 sing N N 248 MET CE HE2 sing N N 249 MET CE HE3 sing N N 250 MET OXT HXT sing N N 251 PGE C1 O1 sing N N 252 PGE C1 C2 sing N N 253 PGE C1 H1 sing N N 254 PGE C1 H12 sing N N 255 PGE O1 HO1 sing N N 256 PGE C2 O2 sing N N 257 PGE C2 H2 sing N N 258 PGE C2 H22 sing N N 259 PGE O2 C3 sing N N 260 PGE C3 C4 sing N N 261 PGE C3 H3 sing N N 262 PGE C3 H32 sing N N 263 PGE C4 O3 sing N N 264 PGE C4 H4 sing N N 265 PGE C4 H42 sing N N 266 PGE O4 C6 sing N N 267 PGE O4 HO4 sing N N 268 PGE C6 C5 sing N N 269 PGE C6 H6 sing N N 270 PGE C6 H62 sing N N 271 PGE C5 O3 sing N N 272 PGE C5 H5 sing N N 273 PGE C5 H52 sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 SER N CA sing N N 315 SER N H sing N N 316 SER N H2 sing N N 317 SER CA C sing N N 318 SER CA CB sing N N 319 SER CA HA sing N N 320 SER C O doub N N 321 SER C OXT sing N N 322 SER CB OG sing N N 323 SER CB HB2 sing N N 324 SER CB HB3 sing N N 325 SER OG HG sing N N 326 SER OXT HXT sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TRP N CA sing N N 344 TRP N H sing N N 345 TRP N H2 sing N N 346 TRP CA C sing N N 347 TRP CA CB sing N N 348 TRP CA HA sing N N 349 TRP C O doub N N 350 TRP C OXT sing N N 351 TRP CB CG sing N N 352 TRP CB HB2 sing N N 353 TRP CB HB3 sing N N 354 TRP CG CD1 doub Y N 355 TRP CG CD2 sing Y N 356 TRP CD1 NE1 sing Y N 357 TRP CD1 HD1 sing N N 358 TRP CD2 CE2 doub Y N 359 TRP CD2 CE3 sing Y N 360 TRP NE1 CE2 sing Y N 361 TRP NE1 HE1 sing N N 362 TRP CE2 CZ2 sing Y N 363 TRP CE3 CZ3 doub Y N 364 TRP CE3 HE3 sing N N 365 TRP CZ2 CH2 doub Y N 366 TRP CZ2 HZ2 sing N N 367 TRP CZ3 CH2 sing Y N 368 TRP CZ3 HZ3 sing N N 369 TRP CH2 HH2 sing N N 370 TRP OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # _pdbx_audit_support.funding_organization 'Canadian Institutes of Health Research (CIHR)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ALY ? ? ALY ? ? 'SUBJECT OF INVESTIGATION' ? 2 PGE ? ? PGE ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1GNU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8T32 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022635 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022635 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007760 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_