data_8T8K # _entry.id 8T8K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.378 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8T8K pdb_00008t8k 10.2210/pdb8t8k/pdb WWPDB D_1000275272 ? ? # _pdbx_database_related.db_name SASBDB _pdbx_database_related.details . _pdbx_database_related.db_id SASDSX6 _pdbx_database_related.content_type 'associated SAS data' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8T8K _pdbx_database_status.recvd_initial_deposition_date 2023-06-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tanner, J.J.' 1 ? 'McKay, C.E.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 13496 _citation.page_last 13496 _citation.title 'Crystal structure of domain of unknown function 507 (DUF507) reveals a new protein fold.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-023-40558-y _citation.pdbx_database_id_PubMed 37596303 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McKay, C.E.' 1 0000-0001-5535-9529 primary 'Cheng, J.' 2 0000-0003-0305-2853 primary 'Tanner, J.J.' 3 0000-0001-8314-113X # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8T8K _cell.details ? _cell.formula_units_Z ? _cell.length_a 72.714 _cell.length_a_esd ? _cell.length_b 86.534 _cell.length_b_esd ? _cell.length_c 79.139 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8T8K _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DUF507 family protein' 21939.553 1 ? ? ? ? 2 non-polymer syn HEXANE-1,6-DIOL 118.174 1 ? ? ? ? 3 water nat water 18.015 91 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMRLPERLVEAIAESIIQKLGKEEGILELEDPATFKKKIISLFKEADREEKELEEKAKAVLRENLEVLERENIDYRTAFL AVKRKLAEEMNINVDRRERLNQIINRIMDLIMKDESVEIYEDPPVIRKKIREIVLGALKIEEEIEKTVRQRIKKYSRDLL EGSPEWQILWKRIYEDELKKRGLA ; _entity_poly.pdbx_seq_one_letter_code_can ;SMRLPERLVEAIAESIIQKLGKEEGILELEDPATFKKKIISLFKEADREEKELEEKAKAVLRENLEVLERENIDYRTAFL AVKRKLAEEMNINVDRRERLNQIINRIMDLIMKDESVEIYEDPPVIRKKIREIVLGALKIEEEIEKTVRQRIKKYSRDLL EGSPEWQILWKRIYEDELKKRGLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ARG n 1 4 LEU n 1 5 PRO n 1 6 GLU n 1 7 ARG n 1 8 LEU n 1 9 VAL n 1 10 GLU n 1 11 ALA n 1 12 ILE n 1 13 ALA n 1 14 GLU n 1 15 SER n 1 16 ILE n 1 17 ILE n 1 18 GLN n 1 19 LYS n 1 20 LEU n 1 21 GLY n 1 22 LYS n 1 23 GLU n 1 24 GLU n 1 25 GLY n 1 26 ILE n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 GLU n 1 31 ASP n 1 32 PRO n 1 33 ALA n 1 34 THR n 1 35 PHE n 1 36 LYS n 1 37 LYS n 1 38 LYS n 1 39 ILE n 1 40 ILE n 1 41 SER n 1 42 LEU n 1 43 PHE n 1 44 LYS n 1 45 GLU n 1 46 ALA n 1 47 ASP n 1 48 ARG n 1 49 GLU n 1 50 GLU n 1 51 LYS n 1 52 GLU n 1 53 LEU n 1 54 GLU n 1 55 GLU n 1 56 LYS n 1 57 ALA n 1 58 LYS n 1 59 ALA n 1 60 VAL n 1 61 LEU n 1 62 ARG n 1 63 GLU n 1 64 ASN n 1 65 LEU n 1 66 GLU n 1 67 VAL n 1 68 LEU n 1 69 GLU n 1 70 ARG n 1 71 GLU n 1 72 ASN n 1 73 ILE n 1 74 ASP n 1 75 TYR n 1 76 ARG n 1 77 THR n 1 78 ALA n 1 79 PHE n 1 80 LEU n 1 81 ALA n 1 82 VAL n 1 83 LYS n 1 84 ARG n 1 85 LYS n 1 86 LEU n 1 87 ALA n 1 88 GLU n 1 89 GLU n 1 90 MET n 1 91 ASN n 1 92 ILE n 1 93 ASN n 1 94 VAL n 1 95 ASP n 1 96 ARG n 1 97 ARG n 1 98 GLU n 1 99 ARG n 1 100 LEU n 1 101 ASN n 1 102 GLN n 1 103 ILE n 1 104 ILE n 1 105 ASN n 1 106 ARG n 1 107 ILE n 1 108 MET n 1 109 ASP n 1 110 LEU n 1 111 ILE n 1 112 MET n 1 113 LYS n 1 114 ASP n 1 115 GLU n 1 116 SER n 1 117 VAL n 1 118 GLU n 1 119 ILE n 1 120 TYR n 1 121 GLU n 1 122 ASP n 1 123 PRO n 1 124 PRO n 1 125 VAL n 1 126 ILE n 1 127 ARG n 1 128 LYS n 1 129 LYS n 1 130 ILE n 1 131 ARG n 1 132 GLU n 1 133 ILE n 1 134 VAL n 1 135 LEU n 1 136 GLY n 1 137 ALA n 1 138 LEU n 1 139 LYS n 1 140 ILE n 1 141 GLU n 1 142 GLU n 1 143 GLU n 1 144 ILE n 1 145 GLU n 1 146 LYS n 1 147 THR n 1 148 VAL n 1 149 ARG n 1 150 GLN n 1 151 ARG n 1 152 ILE n 1 153 LYS n 1 154 LYS n 1 155 TYR n 1 156 SER n 1 157 ARG n 1 158 ASP n 1 159 LEU n 1 160 LEU n 1 161 GLU n 1 162 GLY n 1 163 SER n 1 164 PRO n 1 165 GLU n 1 166 TRP n 1 167 GLN n 1 168 ILE n 1 169 LEU n 1 170 TRP n 1 171 LYS n 1 172 ARG n 1 173 ILE n 1 174 TYR n 1 175 GLU n 1 176 ASP n 1 177 GLU n 1 178 LEU n 1 179 LYS n 1 180 LYS n 1 181 ARG n 1 182 GLY n 1 183 LEU n 1 184 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 184 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene aq_1752 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aquifex aeolicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 63363 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O67633_AQUAE _struct_ref.pdbx_db_accession O67633 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRLPERLVEAIAESIIQKLGKEEGILELEDPATFKKKIISLFKEADREEKELEEKAKAVLRENLEVLERENIDYRTAFLA VKRKLAEEMNINVDRRERLNQIINRIMDLIMKDESVEIYEDPPVIRKKIREIVLGALKIEEEIEKTVRQRIKKYSRDLLE GSPEWQILWKRIYEDELKKRGLA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8T8K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 184 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O67633 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8T8K _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O67633 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEZ non-polymer . HEXANE-1,6-DIOL ? 'C6 H14 O2' 118.174 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8T8K _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.65 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.01 M Co(II)Cl2 hexahydrate, 0.1 M sodium acetate pH 4.6, and 1.0 M 1,6-hexanediol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 286 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CMOS _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RDI CMOS_8M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-05-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0722 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0722 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8T8K _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.87 _reflns.d_resolution_low 45.53 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20928 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.04 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 144119 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.87 _reflns_shell.d_res_low 1.91 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 8975 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1311 _reflns_shell.percent_possible_obs 99.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.8 _reflns_shell.pdbx_chi_squared 0.85 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 3.2 _reflns_shell.pdbx_Rrim_I_all 0.668 _reflns_shell.pdbx_Rpim_I_all 0.253 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.879 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.618 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8T8K _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.88 _refine.ls_d_res_low 45.53 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20563 _refine.ls_number_reflns_R_free 987 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.87 _refine.ls_percent_reflns_R_free 4.80 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2187 _refine.ls_R_factor_R_free 0.2528 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2171 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.88 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.26 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.88 _refine_hist.d_res_low 45.53 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1609 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1510 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1532 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.468 ? 2049 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.843 ? 629 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.037 ? 232 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 263 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.88 1.98 . . 151 2691 97.00 . . . . 0.3853 . . . . . . . . . . . 0.4129 'X-RAY DIFFRACTION' 1.98 2.10 . . 145 2780 99.00 . . . . 0.2753 . . . . . . . . . . . 0.3090 'X-RAY DIFFRACTION' 2.10 2.26 . . 156 2744 99.00 . . . . 0.2709 . . . . . . . . . . . 0.3387 'X-RAY DIFFRACTION' 2.26 2.49 . . 122 2747 98.00 . . . . 0.2335 . . . . . . . . . . . 0.2828 'X-RAY DIFFRACTION' 2.49 2.85 . . 137 2824 100.00 . . . . 0.2143 . . . . . . . . . . . 0.2514 'X-RAY DIFFRACTION' 2.85 3.59 . . 152 2824 100.00 . . . . 0.2048 . . . . . . . . . . . 0.2348 'X-RAY DIFFRACTION' 3.59 45.53 . . 124 2966 100.00 . . . . 0.1755 . . . . . . . . . . . 0.1883 # _struct.entry_id 8T8K _struct.title 'Structure of Domain of Unknown Function 507 (DUF507) in Space Group C222(1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8T8K _struct_keywords.text 'DUF507, 4-helix bundle, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 5 ? GLY A 21 ? PRO A 4 GLY A 20 1 ? 17 HELX_P HELX_P2 AA2 ASP A 31 ? ASN A 64 ? ASP A 30 ASN A 63 1 ? 34 HELX_P HELX_P3 AA3 ASN A 64 ? ASN A 72 ? ASN A 63 ASN A 71 1 ? 9 HELX_P HELX_P4 AA4 ASP A 74 ? MET A 90 ? ASP A 73 MET A 89 1 ? 17 HELX_P HELX_P5 AA5 ASP A 95 ? ASP A 114 ? ASP A 94 ASP A 113 1 ? 20 HELX_P HELX_P6 AA6 ASP A 122 ? LYS A 153 ? ASP A 121 LYS A 152 1 ? 32 HELX_P HELX_P7 AA7 LYS A 154 ? SER A 156 ? LYS A 153 SER A 155 5 ? 3 HELX_P HELX_P8 AA8 SER A 163 ? ARG A 181 ? SER A 162 ARG A 180 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 27 ? LEU A 29 ? LEU A 26 LEU A 28 AA1 2 VAL A 117 ? ILE A 119 ? VAL A 116 ILE A 118 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 28 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 118 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 117 # _atom_sites.entry_id 8T8K _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013753 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011556 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012636 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 ARG 3 2 2 ARG ARG A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 PRO 5 4 4 PRO PRO A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 GLU 10 9 9 GLU GLU A . n A 1 11 ALA 11 10 10 ALA ALA A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 ILE 16 15 15 ILE ILE A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 ILE 26 25 25 ILE ILE A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 GLU 30 29 29 GLU GLU A . n A 1 31 ASP 31 30 30 ASP ASP A . n A 1 32 PRO 32 31 31 PRO PRO A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 PHE 35 34 34 PHE PHE A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 LYS 37 36 36 LYS LYS A . n A 1 38 LYS 38 37 37 LYS LYS A . n A 1 39 ILE 39 38 38 ILE ILE A . n A 1 40 ILE 40 39 39 ILE ILE A . n A 1 41 SER 41 40 40 SER SER A . n A 1 42 LEU 42 41 41 LEU LEU A . n A 1 43 PHE 43 42 42 PHE PHE A . n A 1 44 LYS 44 43 43 LYS LYS A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 ALA 46 45 45 ALA ALA A . n A 1 47 ASP 47 46 46 ASP ASP A . n A 1 48 ARG 48 47 47 ARG ARG A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 LYS 58 57 57 LYS LYS A . n A 1 59 ALA 59 58 58 ALA ALA A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ARG 62 61 61 ARG ARG A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 LEU 65 64 64 LEU LEU A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 LEU 68 67 67 LEU LEU A . n A 1 69 GLU 69 68 68 GLU GLU A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 ASN 72 71 71 ASN ASN A . n A 1 73 ILE 73 72 72 ILE ILE A . n A 1 74 ASP 74 73 73 ASP ASP A . n A 1 75 TYR 75 74 74 TYR TYR A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 THR 77 76 76 THR THR A . n A 1 78 ALA 78 77 77 ALA ALA A . n A 1 79 PHE 79 78 78 PHE PHE A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 ARG 84 83 83 ARG ARG A . n A 1 85 LYS 85 84 84 LYS LYS A . n A 1 86 LEU 86 85 85 LEU LEU A . n A 1 87 ALA 87 86 86 ALA ALA A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 MET 90 89 89 MET MET A . n A 1 91 ASN 91 90 90 ASN ASN A . n A 1 92 ILE 92 91 91 ILE ILE A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 VAL 94 93 93 VAL VAL A . n A 1 95 ASP 95 94 94 ASP ASP A . n A 1 96 ARG 96 95 95 ARG ARG A . n A 1 97 ARG 97 96 96 ARG ARG A . n A 1 98 GLU 98 97 97 GLU GLU A . n A 1 99 ARG 99 98 98 ARG ARG A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 ASN 101 100 100 ASN ASN A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 ILE 103 102 102 ILE ILE A . n A 1 104 ILE 104 103 103 ILE ILE A . n A 1 105 ASN 105 104 104 ASN ASN A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 ILE 107 106 106 ILE ILE A . n A 1 108 MET 108 107 107 MET MET A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 LEU 110 109 109 LEU LEU A . n A 1 111 ILE 111 110 110 ILE ILE A . n A 1 112 MET 112 111 111 MET MET A . n A 1 113 LYS 113 112 112 LYS LYS A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 GLU 115 114 114 GLU GLU A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 VAL 117 116 116 VAL VAL A . n A 1 118 GLU 118 117 117 GLU GLU A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 TYR 120 119 119 TYR TYR A . n A 1 121 GLU 121 120 120 GLU GLU A . n A 1 122 ASP 122 121 121 ASP ASP A . n A 1 123 PRO 123 122 122 PRO PRO A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 VAL 125 124 124 VAL VAL A . n A 1 126 ILE 126 125 125 ILE ILE A . n A 1 127 ARG 127 126 126 ARG ARG A . n A 1 128 LYS 128 127 127 LYS LYS A . n A 1 129 LYS 129 128 128 LYS LYS A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 ARG 131 130 130 ARG ARG A . n A 1 132 GLU 132 131 131 GLU GLU A . n A 1 133 ILE 133 132 132 ILE ILE A . n A 1 134 VAL 134 133 133 VAL VAL A . n A 1 135 LEU 135 134 134 LEU LEU A . n A 1 136 GLY 136 135 135 GLY GLY A . n A 1 137 ALA 137 136 136 ALA ALA A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 LYS 139 138 138 LYS LYS A . n A 1 140 ILE 140 139 139 ILE ILE A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 ILE 144 143 143 ILE ILE A . n A 1 145 GLU 145 144 144 GLU GLU A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 THR 147 146 146 THR THR A . n A 1 148 VAL 148 147 147 VAL VAL A . n A 1 149 ARG 149 148 148 ARG ARG A . n A 1 150 GLN 150 149 149 GLN GLN A . n A 1 151 ARG 151 150 150 ARG ARG A . n A 1 152 ILE 152 151 151 ILE ILE A . n A 1 153 LYS 153 152 152 LYS LYS A . n A 1 154 LYS 154 153 153 LYS LYS A . n A 1 155 TYR 155 154 154 TYR TYR A . n A 1 156 SER 156 155 155 SER SER A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 ASP 158 157 157 ASP ASP A . n A 1 159 LEU 159 158 158 LEU LEU A . n A 1 160 LEU 160 159 159 LEU LEU A . n A 1 161 GLU 161 160 160 GLU GLU A . n A 1 162 GLY 162 161 161 GLY GLY A . n A 1 163 SER 163 162 162 SER SER A . n A 1 164 PRO 164 163 163 PRO PRO A . n A 1 165 GLU 165 164 164 GLU GLU A . n A 1 166 TRP 166 165 165 TRP TRP A . n A 1 167 GLN 167 166 166 GLN GLN A . n A 1 168 ILE 168 167 167 ILE ILE A . n A 1 169 LEU 169 168 168 LEU LEU A . n A 1 170 TRP 170 169 169 TRP TRP A . n A 1 171 LYS 171 170 170 LYS LYS A . n A 1 172 ARG 172 171 171 ARG ARG A . n A 1 173 ILE 173 172 172 ILE ILE A . n A 1 174 TYR 174 173 173 TYR TYR A . n A 1 175 GLU 175 174 174 GLU GLU A . n A 1 176 ASP 176 175 175 ASP ASP A . n A 1 177 GLU 177 176 176 GLU GLU A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 LYS 179 178 178 LYS LYS A . n A 1 180 LYS 180 179 179 LYS LYS A . n A 1 181 ARG 181 180 180 ARG ARG A . n A 1 182 GLY 182 181 181 GLY GLY A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 ALA 184 183 183 ALA ALA A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email tannerjj@missouri.edu _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Tanner _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8314-113X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEZ 1 201 201 HEZ HEZ A . C 3 HOH 1 301 301 HOH HOH A . C 3 HOH 2 302 302 HOH HOH A . C 3 HOH 3 303 303 HOH HOH A . C 3 HOH 4 304 307 HOH HOH A . C 3 HOH 5 305 304 HOH HOH A . C 3 HOH 6 306 305 HOH HOH A . C 3 HOH 7 307 308 HOH HOH A . C 3 HOH 8 308 306 HOH HOH A . C 3 HOH 9 309 311 HOH HOH A . C 3 HOH 10 310 312 HOH HOH A . C 3 HOH 11 311 309 HOH HOH A . C 3 HOH 12 312 313 HOH HOH A . C 3 HOH 13 313 315 HOH HOH A . C 3 HOH 14 314 310 HOH HOH A . C 3 HOH 15 315 319 HOH HOH A . C 3 HOH 16 316 314 HOH HOH A . C 3 HOH 17 317 324 HOH HOH A . C 3 HOH 18 318 317 HOH HOH A . C 3 HOH 19 319 318 HOH HOH A . C 3 HOH 20 320 320 HOH HOH A . C 3 HOH 21 321 321 HOH HOH A . C 3 HOH 22 322 316 HOH HOH A . C 3 HOH 23 323 325 HOH HOH A . C 3 HOH 24 324 322 HOH HOH A . C 3 HOH 25 325 326 HOH HOH A . C 3 HOH 26 326 323 HOH HOH A . C 3 HOH 27 327 328 HOH HOH A . C 3 HOH 28 328 329 HOH HOH A . C 3 HOH 29 329 330 HOH HOH A . C 3 HOH 30 330 331 HOH HOH A . C 3 HOH 31 331 332 HOH HOH A . C 3 HOH 32 332 327 HOH HOH A . C 3 HOH 33 333 333 HOH HOH A . C 3 HOH 34 334 335 HOH HOH A . C 3 HOH 35 335 340 HOH HOH A . C 3 HOH 36 336 339 HOH HOH A . C 3 HOH 37 337 336 HOH HOH A . C 3 HOH 38 338 338 HOH HOH A . C 3 HOH 39 339 337 HOH HOH A . C 3 HOH 40 340 341 HOH HOH A . C 3 HOH 41 341 334 HOH HOH A . C 3 HOH 42 342 342 HOH HOH A . C 3 HOH 43 343 343 HOH HOH A . C 3 HOH 44 344 344 HOH HOH A . C 3 HOH 45 345 347 HOH HOH A . C 3 HOH 46 346 350 HOH HOH A . C 3 HOH 47 347 345 HOH HOH A . C 3 HOH 48 348 348 HOH HOH A . C 3 HOH 49 349 346 HOH HOH A . C 3 HOH 50 350 351 HOH HOH A . C 3 HOH 51 351 349 HOH HOH A . C 3 HOH 52 352 355 HOH HOH A . C 3 HOH 53 353 352 HOH HOH A . C 3 HOH 54 354 356 HOH HOH A . C 3 HOH 55 355 359 HOH HOH A . C 3 HOH 56 356 357 HOH HOH A . C 3 HOH 57 357 361 HOH HOH A . C 3 HOH 58 358 360 HOH HOH A . C 3 HOH 59 359 354 HOH HOH A . C 3 HOH 60 360 353 HOH HOH A . C 3 HOH 61 361 358 HOH HOH A . C 3 HOH 62 362 362 HOH HOH A . C 3 HOH 63 363 364 HOH HOH A . C 3 HOH 64 364 363 HOH HOH A . C 3 HOH 65 365 368 HOH HOH A . C 3 HOH 66 366 369 HOH HOH A . C 3 HOH 67 367 365 HOH HOH A . C 3 HOH 68 368 366 HOH HOH A . C 3 HOH 69 369 367 HOH HOH A . C 3 HOH 70 370 371 HOH HOH A . C 3 HOH 71 371 372 HOH HOH A . C 3 HOH 72 372 370 HOH HOH A . C 3 HOH 73 373 374 HOH HOH A . C 3 HOH 74 374 375 HOH HOH A . C 3 HOH 75 375 376 HOH HOH A . C 3 HOH 76 376 377 HOH HOH A . C 3 HOH 77 377 378 HOH HOH A . C 3 HOH 78 378 379 HOH HOH A . C 3 HOH 79 379 373 HOH HOH A . C 3 HOH 80 380 380 HOH HOH A . C 3 HOH 81 381 381 HOH HOH A . C 3 HOH 82 382 382 HOH HOH A . C 3 HOH 83 383 383 HOH HOH A . C 3 HOH 84 384 385 HOH HOH A . C 3 HOH 85 385 384 HOH HOH A . C 3 HOH 86 386 386 HOH HOH A . C 3 HOH 87 387 387 HOH HOH A . C 3 HOH 88 388 388 HOH HOH A . C 3 HOH 89 389 389 HOH HOH A . C 3 HOH 90 390 390 HOH HOH A . C 3 HOH 91 391 391 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 309 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 46.6427 29.2450 41.1780 0.3823 ? 0.0458 ? 0.0044 ? 0.1731 ? -0.0041 ? 0.2122 ? 1.1646 ? 0.1119 ? -0.5497 ? 1.1188 ? 0.6878 ? 6.4448 ? -0.0267 ? 0.2474 ? -0.0394 ? -0.1090 ? -0.0023 ? -0.0940 ? 0.3074 ? -0.0309 ? 0.0404 ? 2 'X-RAY DIFFRACTION' ? refined 46.0616 36.8772 51.3868 0.5972 ? 0.0872 ? -0.0377 ? 0.2704 ? 0.0106 ? 0.2050 ? 2.6193 ? -1.1550 ? -2.3201 ? 1.8961 ? 3.4540 ? 7.1453 ? 0.2329 ? 0.4601 ? 0.0531 ? -0.7092 ? -0.3745 ? 0.2930 ? -0.5962 ? -0.2828 ? 0.0651 ? 3 'X-RAY DIFFRACTION' ? refined 61.3149 23.3010 45.7796 0.5234 ? 0.0010 ? 0.0096 ? 0.2232 ? 0.0208 ? 0.1763 ? 2.3112 ? -3.7057 ? -2.2842 ? 7.4502 ? 4.6898 ? 3.2928 ? 0.1305 ? -0.1327 ? 0.2407 ? -0.4544 ? 0.1934 ? -0.3818 ? -0.2628 ? 0.2355 ? -0.2933 ? 4 'X-RAY DIFFRACTION' ? refined 56.0922 17.5658 49.6590 0.5517 ? 0.0630 ? 0.0065 ? 0.2059 ? 0.0055 ? 0.2060 ? 0.3386 ? -2.3356 ? -2.2747 ? 7.2010 ? 7.1583 ? 6.6600 ? -0.1680 ? -0.0089 ? -0.0504 ? 0.2691 ? 0.0838 ? 0.2448 ? 0.0564 ? -0.1811 ? 0.0652 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 113 through 183 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 25 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 26 through 70 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 71 through 112 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_entry_details.entry_id 8T8K _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 2 CG 2 1 Y 1 A MET 1 ? SD ? A MET 2 SD 3 1 Y 1 A MET 1 ? CE ? A MET 2 CE 4 1 Y 1 A GLU 5 ? CG ? A GLU 6 CG 5 1 Y 1 A GLU 5 ? CD ? A GLU 6 CD 6 1 Y 1 A GLU 5 ? OE1 ? A GLU 6 OE1 7 1 Y 1 A GLU 5 ? OE2 ? A GLU 6 OE2 8 1 Y 1 A LYS 36 ? CE ? A LYS 37 CE 9 1 Y 1 A LYS 36 ? NZ ? A LYS 37 NZ 10 1 Y 1 A LYS 127 ? CD ? A LYS 128 CD 11 1 Y 1 A LYS 127 ? CE ? A LYS 128 CE 12 1 Y 1 A LYS 127 ? NZ ? A LYS 128 NZ 13 1 Y 1 A GLU 131 ? CG ? A GLU 132 CG 14 1 Y 1 A GLU 131 ? CD ? A GLU 132 CD 15 1 Y 1 A GLU 131 ? OE1 ? A GLU 132 OE1 16 1 Y 1 A GLU 131 ? OE2 ? A GLU 132 OE2 17 1 Y 1 A LYS 138 ? CE ? A LYS 139 CE 18 1 Y 1 A LYS 138 ? NZ ? A LYS 139 NZ 19 1 Y 1 A LYS 152 ? CG ? A LYS 153 CG 20 1 Y 1 A LYS 152 ? CD ? A LYS 153 CD 21 1 Y 1 A LYS 152 ? CE ? A LYS 153 CE 22 1 Y 1 A LYS 152 ? NZ ? A LYS 153 NZ # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id SER _pdbx_unobs_or_zero_occ_residues.auth_seq_id 0 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id SER _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HEZ O1 O N N 123 HEZ C1 C N N 124 HEZ C2 C N N 125 HEZ C3 C N N 126 HEZ C4 C N N 127 HEZ C5 C N N 128 HEZ C6 C N N 129 HEZ O6 O N N 130 HEZ HO1 H N N 131 HEZ H11 H N N 132 HEZ H12 H N N 133 HEZ H21 H N N 134 HEZ H22 H N N 135 HEZ H31 H N N 136 HEZ H32 H N N 137 HEZ H41 H N N 138 HEZ H42 H N N 139 HEZ H51 H N N 140 HEZ H52 H N N 141 HEZ H61 H N N 142 HEZ H62 H N N 143 HEZ HO6 H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HEZ O1 C1 sing N N 116 HEZ O1 HO1 sing N N 117 HEZ C1 C2 sing N N 118 HEZ C1 H11 sing N N 119 HEZ C1 H12 sing N N 120 HEZ C2 C3 sing N N 121 HEZ C2 H21 sing N N 122 HEZ C2 H22 sing N N 123 HEZ C3 C4 sing N N 124 HEZ C3 H31 sing N N 125 HEZ C3 H32 sing N N 126 HEZ C4 C5 sing N N 127 HEZ C4 H41 sing N N 128 HEZ C4 H42 sing N N 129 HEZ C5 C6 sing N N 130 HEZ C5 H51 sing N N 131 HEZ C5 H52 sing N N 132 HEZ C6 O6 sing N N 133 HEZ C6 H61 sing N N 134 HEZ C6 H62 sing N N 135 HEZ O6 HO6 sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM093123 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 HEXANE-1,6-DIOL HEZ 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code O67633 _pdbx_initial_refinement_model.details ? #