data_8TI5 # _entry.id 8TI5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.394 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8TI5 pdb_00008ti5 10.2210/pdb8ti5/pdb WWPDB D_1000276021 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-08 2 'Structure model' 1 1 2024-06-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8TI5 _pdbx_database_status.recvd_initial_deposition_date 2023-07-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email chruszcz@msu.edu _pdbx_contact_author.name_first Maksymilian _pdbx_contact_author.name_last Chruszcz _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7521-5485 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID ;O'Malley, A. ; 1 ? 'Sankaran, S.' 2 ? 'Chruszcz, M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biol.Chem. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1431-6730 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 405 _citation.language ? _citation.page_first 367 _citation.page_last 381 _citation.title 'Structural homology of mite profilins to plant profilins is not indicative of allergic cross-reactivity.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1515/hsz-2023-0366 _citation.pdbx_database_id_PubMed 38662449 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;O'Malley, A. ; 1 ? primary 'Sankaran, S.' 2 ? primary 'Carriuolo, A.' 3 ? primary 'Khatri, K.' 4 ? primary 'Kowal, K.' 5 ? primary 'Chruszcz, M.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Profilin 14410.242 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 186 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGSGSWQSYVDNQICQHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSNPNSFLEGGIHLGGEKYICIQ ADNSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNNVVEKLGDYLKANNY ; _entity_poly.pdbx_seq_one_letter_code_can ;SGSGSWQSYVDNQICQHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSNPNSFLEGGIHLGGEKYICIQ ADNSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNNVVEKLGDYLKANNY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 TRP n 1 7 GLN n 1 8 SER n 1 9 TYR n 1 10 VAL n 1 11 ASP n 1 12 ASN n 1 13 GLN n 1 14 ILE n 1 15 CYS n 1 16 GLN n 1 17 HIS n 1 18 VAL n 1 19 ASP n 1 20 CYS n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 VAL n 1 25 ILE n 1 26 ALA n 1 27 GLY n 1 28 LEU n 1 29 GLN n 1 30 ASP n 1 31 GLY n 1 32 ALA n 1 33 VAL n 1 34 TRP n 1 35 ALA n 1 36 LYS n 1 37 PHE n 1 38 GLU n 1 39 LYS n 1 40 ASP n 1 41 LEU n 1 42 PRO n 1 43 LYS n 1 44 GLN n 1 45 ILE n 1 46 THR n 1 47 GLN n 1 48 GLN n 1 49 GLU n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 ILE n 1 54 ALA n 1 55 ASP n 1 56 ALA n 1 57 ILE n 1 58 ARG n 1 59 SER n 1 60 ASN n 1 61 PRO n 1 62 ASN n 1 63 SER n 1 64 PHE n 1 65 LEU n 1 66 GLU n 1 67 GLY n 1 68 GLY n 1 69 ILE n 1 70 HIS n 1 71 LEU n 1 72 GLY n 1 73 GLY n 1 74 GLU n 1 75 LYS n 1 76 TYR n 1 77 ILE n 1 78 CYS n 1 79 ILE n 1 80 GLN n 1 81 ALA n 1 82 ASP n 1 83 ASN n 1 84 SER n 1 85 LEU n 1 86 VAL n 1 87 ARG n 1 88 GLY n 1 89 ARG n 1 90 LYS n 1 91 GLY n 1 92 SER n 1 93 SER n 1 94 ALA n 1 95 LEU n 1 96 CYS n 1 97 ILE n 1 98 VAL n 1 99 ALA n 1 100 THR n 1 101 ASN n 1 102 THR n 1 103 CYS n 1 104 LEU n 1 105 LEU n 1 106 ALA n 1 107 ALA n 1 108 ALA n 1 109 THR n 1 110 VAL n 1 111 ASP n 1 112 GLY n 1 113 PHE n 1 114 PRO n 1 115 PRO n 1 116 GLY n 1 117 GLN n 1 118 LEU n 1 119 ASN n 1 120 ASN n 1 121 VAL n 1 122 VAL n 1 123 GLU n 1 124 LYS n 1 125 LEU n 1 126 GLY n 1 127 ASP n 1 128 TYR n 1 129 LEU n 1 130 LYS n 1 131 ALA n 1 132 ASN n 1 133 ASN n 1 134 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 134 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Tyrophagus putrescentiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 59818 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 SER 3 0 ? ? ? A . n A 1 4 GLY 4 1 1 GLY GLY A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 TRP 6 3 3 TRP TRP A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 SER 8 5 5 SER SER A . n A 1 9 TYR 9 6 6 TYR TYR A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 ASP 11 8 8 ASP ASP A . n A 1 12 ASN 12 9 9 ASN ASN A . n A 1 13 GLN 13 10 10 GLN GLN A . n A 1 14 ILE 14 11 11 ILE ILE A . n A 1 15 CYS 15 12 12 CYS CYS A . n A 1 16 GLN 16 13 13 GLN GLN A . n A 1 17 HIS 17 14 14 HIS HIS A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 CYS 20 17 17 CYS CYS A . n A 1 21 ARG 21 18 18 ARG ARG A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 ILE 25 22 22 ILE ILE A . n A 1 26 ALA 26 23 23 ALA ALA A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 GLN 29 26 26 GLN GLN A . n A 1 30 ASP 30 27 27 ASP ASP A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 VAL 33 30 30 VAL VAL A . n A 1 34 TRP 34 31 31 TRP TRP A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 PHE 37 34 34 PHE PHE A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 LYS 39 36 36 LYS LYS A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 PRO 42 39 39 PRO PRO A . n A 1 43 LYS 43 40 40 LYS LYS A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 ILE 45 42 42 ILE ILE A . n A 1 46 THR 46 43 43 THR THR A . n A 1 47 GLN 47 44 44 GLN GLN A . n A 1 48 GLN 48 45 45 GLN GLN A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 ILE 57 54 54 ILE ILE A . n A 1 58 ARG 58 55 55 ARG ARG A . n A 1 59 SER 59 56 56 SER SER A . n A 1 60 ASN 60 57 57 ASN ASN A . n A 1 61 PRO 61 58 58 PRO PRO A . n A 1 62 ASN 62 59 59 ASN ASN A . n A 1 63 SER 63 60 60 SER SER A . n A 1 64 PHE 64 61 61 PHE PHE A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 GLU 66 63 63 GLU GLU A . n A 1 67 GLY 67 64 64 GLY GLY A . n A 1 68 GLY 68 65 65 GLY GLY A . n A 1 69 ILE 69 66 66 ILE ILE A . n A 1 70 HIS 70 67 67 HIS HIS A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 GLY 72 69 69 GLY GLY A . n A 1 73 GLY 73 70 70 GLY GLY A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 TYR 76 73 73 TYR TYR A . n A 1 77 ILE 77 74 74 ILE ILE A . n A 1 78 CYS 78 75 75 CYS CYS A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 GLN 80 77 77 GLN GLN A . n A 1 81 ALA 81 78 78 ALA ALA A . n A 1 82 ASP 82 79 79 ASP ASP A . n A 1 83 ASN 83 80 80 ASN ASN A . n A 1 84 SER 84 81 81 SER SER A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 VAL 86 83 83 VAL VAL A . n A 1 87 ARG 87 84 84 ARG ARG A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 ARG 89 86 86 ARG ARG A . n A 1 90 LYS 90 87 87 LYS LYS A . n A 1 91 GLY 91 88 88 GLY GLY A . n A 1 92 SER 92 89 89 SER SER A . n A 1 93 SER 93 90 90 SER SER A . n A 1 94 ALA 94 91 91 ALA ALA A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 CYS 96 93 93 CYS CYS A . n A 1 97 ILE 97 94 94 ILE ILE A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 THR 100 97 97 THR THR A . n A 1 101 ASN 101 98 98 ASN ASN A . n A 1 102 THR 102 99 99 THR THR A . n A 1 103 CYS 103 100 100 CYS CYS A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 LEU 105 102 102 LEU LEU A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 ALA 108 105 105 ALA ALA A . n A 1 109 THR 109 106 106 THR THR A . n A 1 110 VAL 110 107 107 VAL VAL A . n A 1 111 ASP 111 108 108 ASP ASP A . n A 1 112 GLY 112 109 109 GLY GLY A . n A 1 113 PHE 113 110 110 PHE PHE A . n A 1 114 PRO 114 111 111 PRO PRO A . n A 1 115 PRO 115 112 112 PRO PRO A . n A 1 116 GLY 116 113 113 GLY GLY A . n A 1 117 GLN 117 114 114 GLN GLN A . n A 1 118 LEU 118 115 115 LEU LEU A . n A 1 119 ASN 119 116 116 ASN ASN A . n A 1 120 ASN 120 117 117 ASN ASN A . n A 1 121 VAL 121 118 118 VAL VAL A . n A 1 122 VAL 122 119 119 VAL VAL A . n A 1 123 GLU 123 120 120 GLU GLU A . n A 1 124 LYS 124 121 121 LYS LYS A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 GLY 126 123 123 GLY GLY A . n A 1 127 ASP 127 124 124 ASP ASP A . n A 1 128 TYR 128 125 125 TYR TYR A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 LYS 130 127 127 LYS LYS A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 ASN 132 129 129 ASN ASN A . n A 1 133 ASN 133 130 130 ASN ASN A . n A 1 134 TYR 134 131 131 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 2 SO4 1 202 2 SO4 SO4 A . D 2 SO4 1 203 3 SO4 SO4 A . E 2 SO4 1 204 4 SO4 SO4 A . F 3 HOH 1 301 224 HOH HOH A . F 3 HOH 2 302 135 HOH HOH A . F 3 HOH 3 303 233 HOH HOH A . F 3 HOH 4 304 94 HOH HOH A . F 3 HOH 5 305 78 HOH HOH A . F 3 HOH 6 306 234 HOH HOH A . F 3 HOH 7 307 274 HOH HOH A . F 3 HOH 8 308 72 HOH HOH A . F 3 HOH 9 309 39 HOH HOH A . F 3 HOH 10 310 24 HOH HOH A . F 3 HOH 11 311 10 HOH HOH A . F 3 HOH 12 312 112 HOH HOH A . F 3 HOH 13 313 15 HOH HOH A . F 3 HOH 14 314 66 HOH HOH A . F 3 HOH 15 315 71 HOH HOH A . F 3 HOH 16 316 169 HOH HOH A . F 3 HOH 17 317 18 HOH HOH A . F 3 HOH 18 318 17 HOH HOH A . F 3 HOH 19 319 276 HOH HOH A . F 3 HOH 20 320 62 HOH HOH A . F 3 HOH 21 321 47 HOH HOH A . F 3 HOH 22 322 85 HOH HOH A . F 3 HOH 23 323 106 HOH HOH A . F 3 HOH 24 324 11 HOH HOH A . F 3 HOH 25 325 180 HOH HOH A . F 3 HOH 26 326 232 HOH HOH A . F 3 HOH 27 327 193 HOH HOH A . F 3 HOH 28 328 46 HOH HOH A . F 3 HOH 29 329 43 HOH HOH A . F 3 HOH 30 330 14 HOH HOH A . F 3 HOH 31 331 264 HOH HOH A . F 3 HOH 32 332 40 HOH HOH A . F 3 HOH 33 333 21 HOH HOH A . F 3 HOH 34 334 26 HOH HOH A . F 3 HOH 35 335 19 HOH HOH A . F 3 HOH 36 336 105 HOH HOH A . F 3 HOH 37 337 20 HOH HOH A . F 3 HOH 38 338 80 HOH HOH A . F 3 HOH 39 339 28 HOH HOH A . F 3 HOH 40 340 239 HOH HOH A . F 3 HOH 41 341 65 HOH HOH A . F 3 HOH 42 342 84 HOH HOH A . F 3 HOH 43 343 35 HOH HOH A . F 3 HOH 44 344 38 HOH HOH A . F 3 HOH 45 345 55 HOH HOH A . F 3 HOH 46 346 74 HOH HOH A . F 3 HOH 47 347 150 HOH HOH A . F 3 HOH 48 348 27 HOH HOH A . F 3 HOH 49 349 75 HOH HOH A . F 3 HOH 50 350 37 HOH HOH A . F 3 HOH 51 351 30 HOH HOH A . F 3 HOH 52 352 16 HOH HOH A . F 3 HOH 53 353 79 HOH HOH A . F 3 HOH 54 354 99 HOH HOH A . F 3 HOH 55 355 247 HOH HOH A . F 3 HOH 56 356 115 HOH HOH A . F 3 HOH 57 357 178 HOH HOH A . F 3 HOH 58 358 8 HOH HOH A . F 3 HOH 59 359 98 HOH HOH A . F 3 HOH 60 360 33 HOH HOH A . F 3 HOH 61 361 54 HOH HOH A . F 3 HOH 62 362 244 HOH HOH A . F 3 HOH 63 363 241 HOH HOH A . F 3 HOH 64 364 103 HOH HOH A . F 3 HOH 65 365 56 HOH HOH A . F 3 HOH 66 366 280 HOH HOH A . F 3 HOH 67 367 136 HOH HOH A . F 3 HOH 68 368 69 HOH HOH A . F 3 HOH 69 369 42 HOH HOH A . F 3 HOH 70 370 246 HOH HOH A . F 3 HOH 71 371 88 HOH HOH A . F 3 HOH 72 372 146 HOH HOH A . F 3 HOH 73 373 87 HOH HOH A . F 3 HOH 74 374 9 HOH HOH A . F 3 HOH 75 375 245 HOH HOH A . F 3 HOH 76 376 86 HOH HOH A . F 3 HOH 77 377 236 HOH HOH A . F 3 HOH 78 378 34 HOH HOH A . F 3 HOH 79 379 52 HOH HOH A . F 3 HOH 80 380 45 HOH HOH A . F 3 HOH 81 381 216 HOH HOH A . F 3 HOH 82 382 90 HOH HOH A . F 3 HOH 83 383 163 HOH HOH A . F 3 HOH 84 384 242 HOH HOH A . F 3 HOH 85 385 125 HOH HOH A . F 3 HOH 86 386 29 HOH HOH A . F 3 HOH 87 387 32 HOH HOH A . F 3 HOH 88 388 101 HOH HOH A . F 3 HOH 89 389 93 HOH HOH A . F 3 HOH 90 390 114 HOH HOH A . F 3 HOH 91 391 243 HOH HOH A . F 3 HOH 92 392 248 HOH HOH A . F 3 HOH 93 393 64 HOH HOH A . F 3 HOH 94 394 265 HOH HOH A . F 3 HOH 95 395 282 HOH HOH A . F 3 HOH 96 396 22 HOH HOH A . F 3 HOH 97 397 25 HOH HOH A . F 3 HOH 98 398 162 HOH HOH A . F 3 HOH 99 399 77 HOH HOH A . F 3 HOH 100 400 194 HOH HOH A . F 3 HOH 101 401 57 HOH HOH A . F 3 HOH 102 402 271 HOH HOH A . F 3 HOH 103 403 168 HOH HOH A . F 3 HOH 104 404 122 HOH HOH A . F 3 HOH 105 405 278 HOH HOH A . F 3 HOH 106 406 23 HOH HOH A . F 3 HOH 107 407 285 HOH HOH A . F 3 HOH 108 408 185 HOH HOH A . F 3 HOH 109 409 50 HOH HOH A . F 3 HOH 110 410 44 HOH HOH A . F 3 HOH 111 411 142 HOH HOH A . F 3 HOH 112 412 89 HOH HOH A . F 3 HOH 113 413 60 HOH HOH A . F 3 HOH 114 414 200 HOH HOH A . F 3 HOH 115 415 70 HOH HOH A . F 3 HOH 116 416 91 HOH HOH A . F 3 HOH 117 417 126 HOH HOH A . F 3 HOH 118 418 272 HOH HOH A . F 3 HOH 119 419 267 HOH HOH A . F 3 HOH 120 420 151 HOH HOH A . F 3 HOH 121 421 73 HOH HOH A . F 3 HOH 122 422 190 HOH HOH A . F 3 HOH 123 423 92 HOH HOH A . F 3 HOH 124 424 148 HOH HOH A . F 3 HOH 125 425 170 HOH HOH A . F 3 HOH 126 426 154 HOH HOH A . F 3 HOH 127 427 283 HOH HOH A . F 3 HOH 128 428 53 HOH HOH A . F 3 HOH 129 429 187 HOH HOH A . F 3 HOH 130 430 95 HOH HOH A . F 3 HOH 131 431 165 HOH HOH A . F 3 HOH 132 432 203 HOH HOH A . F 3 HOH 133 433 279 HOH HOH A . F 3 HOH 134 434 41 HOH HOH A . F 3 HOH 135 435 83 HOH HOH A . F 3 HOH 136 436 201 HOH HOH A . F 3 HOH 137 437 76 HOH HOH A . F 3 HOH 138 438 260 HOH HOH A . F 3 HOH 139 439 219 HOH HOH A . F 3 HOH 140 440 67 HOH HOH A . F 3 HOH 141 441 153 HOH HOH A . F 3 HOH 142 442 218 HOH HOH A . F 3 HOH 143 443 158 HOH HOH A . F 3 HOH 144 444 160 HOH HOH A . F 3 HOH 145 445 111 HOH HOH A . F 3 HOH 146 446 166 HOH HOH A . F 3 HOH 147 447 155 HOH HOH A . F 3 HOH 148 448 225 HOH HOH A . F 3 HOH 149 449 284 HOH HOH A . F 3 HOH 150 450 152 HOH HOH A . F 3 HOH 151 451 207 HOH HOH A . F 3 HOH 152 452 107 HOH HOH A . F 3 HOH 153 453 181 HOH HOH A . F 3 HOH 154 454 139 HOH HOH A . F 3 HOH 155 455 116 HOH HOH A . F 3 HOH 156 456 145 HOH HOH A . F 3 HOH 157 457 134 HOH HOH A . F 3 HOH 158 458 113 HOH HOH A . F 3 HOH 159 459 191 HOH HOH A . F 3 HOH 160 460 110 HOH HOH A . F 3 HOH 161 461 97 HOH HOH A . F 3 HOH 162 462 109 HOH HOH A . F 3 HOH 163 463 118 HOH HOH A . F 3 HOH 164 464 269 HOH HOH A . F 3 HOH 165 465 266 HOH HOH A . F 3 HOH 166 466 143 HOH HOH A . F 3 HOH 167 467 81 HOH HOH A . F 3 HOH 168 468 240 HOH HOH A . F 3 HOH 169 469 132 HOH HOH A . F 3 HOH 170 470 121 HOH HOH A . F 3 HOH 171 471 131 HOH HOH A . F 3 HOH 172 472 159 HOH HOH A . F 3 HOH 173 473 161 HOH HOH A . F 3 HOH 174 474 217 HOH HOH A . F 3 HOH 175 475 167 HOH HOH A . F 3 HOH 176 476 164 HOH HOH A . F 3 HOH 177 477 140 HOH HOH A . F 3 HOH 178 478 119 HOH HOH A . F 3 HOH 179 479 124 HOH HOH A . F 3 HOH 180 480 173 HOH HOH A . F 3 HOH 181 481 82 HOH HOH A . F 3 HOH 182 482 183 HOH HOH A . F 3 HOH 183 483 277 HOH HOH A . F 3 HOH 184 484 263 HOH HOH A . F 3 HOH 185 485 130 HOH HOH A . F 3 HOH 186 486 184 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0415 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 8TI5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.364 _cell.length_a_esd ? _cell.length_b 55.364 _cell.length_b_esd ? _cell.length_c 78.814 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8TI5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8TI5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.42 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M citric acid pH 3.5, 2 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-02-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8TI5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.15 _reflns.d_resolution_low 40.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 47953 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 95.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 34.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.063 _reflns.pdbx_Rpim_I_all 0.020 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.060 _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.15 _reflns_shell.d_res_low 1.17 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1441 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.349 _reflns_shell.pdbx_Rpim_I_all 0.164 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.919 _reflns_shell.pdbx_CC_star 0.979 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 57.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.304 _reflns_shell.pdbx_Rsym_value 0.304 _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.175 _refine.aniso_B[1][2] -0.088 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.175 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.568 _refine.B_iso_max ? _refine.B_iso_mean 15.857 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.978 _refine.correlation_coeff_Fo_to_Fc_free 0.972 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8TI5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.150 _refine.ls_d_res_low 30.462 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 43128 _refine.ls_number_reflns_R_free 2044 _refine.ls_number_reflns_R_work 41084 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.794 _refine.ls_percent_reflns_R_free 4.739 _refine.ls_R_factor_all 0.150 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1706 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1485 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.038 _refine.pdbx_overall_ESU_R_Free 0.037 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.107 _refine.overall_SU_ML 0.023 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 995 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 186 _refine_hist.number_atoms_total 1201 _refine_hist.d_res_high 1.150 _refine_hist.d_res_low 30.462 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1110 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1057 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.698 1.642 1524 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.695 1.578 2437 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.561 5.000 150 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 14.129 5.000 6 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.597 10.000 190 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.243 10.000 51 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.092 0.200 174 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1354 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 258 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.222 0.200 201 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.210 0.200 928 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.182 0.200 509 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.087 0.200 590 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.189 0.200 118 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.222 0.200 12 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.244 0.200 48 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.130 0.200 11 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.100 1.479 553 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.098 1.479 552 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.534 2.663 697 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.533 2.663 698 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.457 1.854 557 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.446 1.819 540 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 1.934 3.261 819 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.916 3.202 796 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 3.635 20.180 1279 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 2.814 17.230 1214 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 3.802 3.000 2167 ? r_rigid_bond_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.150 1.180 3681 . 39 664 19.0981 . 0.408 . . 0.408 . . . . . 0.357 . 20 . 0.966 0.943 0.412 'X-RAY DIFFRACTION' 1.180 1.212 3543 . 51 1261 37.0308 . 0.367 . . 0.365 . . . . . 0.296 . 20 . 0.964 0.969 0.410 'X-RAY DIFFRACTION' 1.212 1.247 3499 . 121 2569 76.8791 . 0.280 . . 0.279 . . . . . 0.229 . 20 . 0.973 0.962 0.311 'X-RAY DIFFRACTION' 1.247 1.286 3389 . 126 3009 92.5052 . 0.180 . . 0.180 . . . . . 0.144 . 20 . 0.984 0.978 0.193 'X-RAY DIFFRACTION' 1.286 1.328 3243 . 157 2848 92.6611 . 0.151 . . 0.149 . . . . . 0.119 . 20 . 0.988 0.977 0.199 'X-RAY DIFFRACTION' 1.328 1.374 3195 . 158 2862 94.5227 . 0.135 . . 0.134 . . . . . 0.109 . 20 . 0.989 0.986 0.154 'X-RAY DIFFRACTION' 1.374 1.426 3058 . 130 2785 95.3237 . 0.127 . . 0.126 . . . . . 0.108 . 20 . 0.990 0.987 0.149 'X-RAY DIFFRACTION' 1.426 1.484 2961 . 94 2761 96.4201 . 0.132 . . 0.131 . . . . . 0.115 . 20 . 0.990 0.984 0.163 'X-RAY DIFFRACTION' 1.484 1.550 2838 . 141 2635 97.8154 . 0.119 . . 0.119 . . . . . 0.107 . 20 . 0.991 0.990 0.126 'X-RAY DIFFRACTION' 1.550 1.625 2724 . 124 2550 98.1645 . 0.126 . . 0.125 . . . . . 0.116 . 20 . 0.991 0.987 0.144 'X-RAY DIFFRACTION' 1.625 1.713 2596 . 126 2434 98.6133 . 0.133 . . 0.131 . . . . . 0.125 . 20 . 0.989 0.983 0.163 'X-RAY DIFFRACTION' 1.713 1.816 2446 . 103 2327 99.3459 . 0.137 . . 0.137 . . . . . 0.134 . 20 . 0.989 0.986 0.151 'X-RAY DIFFRACTION' 1.816 1.941 2330 . 116 2204 99.5708 . 0.132 . . 0.131 . . . . . 0.133 . 20 . 0.989 0.984 0.153 'X-RAY DIFFRACTION' 1.941 2.096 2154 . 102 2047 99.7679 . 0.134 . . 0.133 . . . . . 0.143 . 20 . 0.990 0.986 0.156 'X-RAY DIFFRACTION' 2.096 2.295 2007 . 75 1931 99.9502 . 0.131 . . 0.131 . . . . . 0.147 . 20 . 0.990 0.985 0.150 'X-RAY DIFFRACTION' 2.295 2.564 1816 . 118 1696 99.8899 . 0.148 . . 0.147 . . . . . 0.170 . 20 . 0.986 0.981 0.162 'X-RAY DIFFRACTION' 2.564 2.957 1617 . 100 1517 100.0000 . 0.163 . . 0.161 . . . . . 0.189 . 20 . 0.983 0.975 0.195 'X-RAY DIFFRACTION' 2.957 3.614 1386 . 78 1302 99.5671 . 0.149 . . 0.148 . . . . . 0.178 . 20 . 0.986 0.984 0.173 'X-RAY DIFFRACTION' 3.614 5.075 1111 . 55 1054 99.8200 . 0.138 . . 0.137 . . . . . 0.173 . 20 . 0.990 0.987 0.173 'X-RAY DIFFRACTION' 5.075 30.462 664 . 30 627 98.9458 . 0.229 . . 0.231 . . . . . 0.308 . 20 . 0.969 0.976 0.194 # _struct.entry_id 8TI5 _struct.title 'Crystal structure of Tyr p 36.0101' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8TI5 _struct_keywords.text 'mite profilin, storage mite, allergy, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1B2YLJ4_TYRPU _struct_ref.pdbx_db_accession A0A1B2YLJ4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SWQSYVDNQICQHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSNPNSFLEGGIHLGGEKYICIQADNS LVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNNVVEKLGDYLKANNY ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8TI5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1B2YLJ4 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8TI5 SER A 1 ? UNP A0A1B2YLJ4 ? ? 'expression tag' -2 1 1 8TI5 GLY A 2 ? UNP A0A1B2YLJ4 ? ? 'expression tag' -1 2 1 8TI5 SER A 3 ? UNP A0A1B2YLJ4 ? ? 'expression tag' 0 3 1 8TI5 GLY A 4 ? UNP A0A1B2YLJ4 ? ? 'expression tag' 1 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 5 ? ASN A 12 ? SER A 2 ASN A 9 1 ? 8 HELX_P HELX_P2 AA2 THR A 46 ? ASN A 60 ? THR A 43 ASN A 57 1 ? 15 HELX_P HELX_P3 AA3 ASN A 62 ? GLY A 68 ? ASN A 59 GLY A 65 1 ? 7 HELX_P HELX_P4 AA4 PRO A 114 ? ASN A 132 ? PRO A 111 ASN A 129 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 15 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 20 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id A _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 12 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 17 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.204 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 33 ? GLU A 38 ? VAL A 30 GLU A 35 AA1 2 CYS A 20 ? GLY A 27 ? CYS A 17 GLY A 24 AA1 3 CYS A 103 ? THR A 109 ? CYS A 100 THR A 106 AA1 4 SER A 93 ? ALA A 99 ? SER A 90 ALA A 96 AA1 5 LEU A 85 ? LYS A 90 ? LEU A 82 LYS A 87 AA1 6 GLU A 74 ? ALA A 81 ? GLU A 71 ALA A 78 AA1 7 ILE A 69 ? LEU A 71 ? ILE A 66 LEU A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TRP A 34 ? O TRP A 31 N ILE A 25 ? N ILE A 22 AA1 2 3 N ALA A 26 ? N ALA A 23 O LEU A 104 ? O LEU A 101 AA1 3 4 O LEU A 105 ? O LEU A 102 N VAL A 98 ? N VAL A 95 AA1 4 5 O ILE A 97 ? O ILE A 94 N VAL A 86 ? N VAL A 83 AA1 5 6 O ARG A 89 ? O ARG A 86 N ILE A 77 ? N ILE A 74 AA1 6 7 O TYR A 76 ? O TYR A 73 N ILE A 69 ? N ILE A 66 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 9 ? ? -113.46 -76.04 2 1 LYS A 36 ? ? -90.64 -81.11 3 1 ASN A 57 ? ? -161.25 78.10 4 1 THR A 97 ? ? -96.95 -155.15 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 55 ? ? 0.135 'SIDE CHAIN' 2 1 ARG A 86 ? ? 0.086 'SIDE CHAIN' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 350 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_entry_details.entry_id 8TI5 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A SER 0 ? A SER 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 SO4 S S N N 284 SO4 O1 O N N 285 SO4 O2 O N N 286 SO4 O3 O N N 287 SO4 O4 O N N 288 THR N N N N 289 THR CA C N S 290 THR C C N N 291 THR O O N N 292 THR CB C N R 293 THR OG1 O N N 294 THR CG2 C N N 295 THR OXT O N N 296 THR H H N N 297 THR H2 H N N 298 THR HA H N N 299 THR HB H N N 300 THR HG1 H N N 301 THR HG21 H N N 302 THR HG22 H N N 303 THR HG23 H N N 304 THR HXT H N N 305 TRP N N N N 306 TRP CA C N S 307 TRP C C N N 308 TRP O O N N 309 TRP CB C N N 310 TRP CG C Y N 311 TRP CD1 C Y N 312 TRP CD2 C Y N 313 TRP NE1 N Y N 314 TRP CE2 C Y N 315 TRP CE3 C Y N 316 TRP CZ2 C Y N 317 TRP CZ3 C Y N 318 TRP CH2 C Y N 319 TRP OXT O N N 320 TRP H H N N 321 TRP H2 H N N 322 TRP HA H N N 323 TRP HB2 H N N 324 TRP HB3 H N N 325 TRP HD1 H N N 326 TRP HE1 H N N 327 TRP HE3 H N N 328 TRP HZ2 H N N 329 TRP HZ3 H N N 330 TRP HH2 H N N 331 TRP HXT H N N 332 TYR N N N N 333 TYR CA C N S 334 TYR C C N N 335 TYR O O N N 336 TYR CB C N N 337 TYR CG C Y N 338 TYR CD1 C Y N 339 TYR CD2 C Y N 340 TYR CE1 C Y N 341 TYR CE2 C Y N 342 TYR CZ C Y N 343 TYR OH O N N 344 TYR OXT O N N 345 TYR H H N N 346 TYR H2 H N N 347 TYR HA H N N 348 TYR HB2 H N N 349 TYR HB3 H N N 350 TYR HD1 H N N 351 TYR HD2 H N N 352 TYR HE1 H N N 353 TYR HE2 H N N 354 TYR HH H N N 355 TYR HXT H N N 356 VAL N N N N 357 VAL CA C N S 358 VAL C C N N 359 VAL O O N N 360 VAL CB C N N 361 VAL CG1 C N N 362 VAL CG2 C N N 363 VAL OXT O N N 364 VAL H H N N 365 VAL H2 H N N 366 VAL HA H N N 367 VAL HB H N N 368 VAL HG11 H N N 369 VAL HG12 H N N 370 VAL HG13 H N N 371 VAL HG21 H N N 372 VAL HG22 H N N 373 VAL HG23 H N N 374 VAL HXT H N N 375 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 SO4 S O1 doub N N 271 SO4 S O2 doub N N 272 SO4 S O3 sing N N 273 SO4 S O4 sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01AI077653 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ACF _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8TI5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018062 _atom_sites.fract_transf_matrix[1][2] 0.010428 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020857 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012688 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 0.8669 # loop_