data_8TQG # _entry.id 8TQG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8TQG pdb_00008tqg 10.2210/pdb8tqg/pdb WWPDB D_1000276391 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-04-24 2 'Structure model' 1 1 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8TQG _pdbx_database_status.recvd_initial_deposition_date 2023-08-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sacchett@tamu.edu _pdbx_contact_author.name_first Inna _pdbx_contact_author.name_last Krieger _pdbx_contact_author.name_mi V _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7144-3069 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Krieger, I.V.' 1 0000-0001-7144-3069 'Sacchettini, J.C.' 2 0000-0001-5767-2367 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Infect Dis.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2373-8227 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first 1561 _citation.page_last 1575 _citation.title ;Inhibitors of the Thioesterase Activity of Mycobacterium tuberculosis Pks13 Discovered Using DNA-Encoded Chemical Library Screening. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsinfecdis.3c00592 _citation.pdbx_database_id_PubMed 38577994 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krieger, I.V.' 1 ? primary 'Yalamanchili, S.' 2 ? primary 'Dickson, P.' 3 ? primary 'Engelhart, C.A.' 4 ? primary 'Zimmerman, M.D.' 5 ? primary 'Wood, J.' 6 ? primary 'Clary, E.' 7 ? primary 'Nguyen, J.' 8 ? primary 'Thornton, N.' 9 ? primary 'Centrella, P.A.' 10 ? primary 'Chan, B.' 11 ? primary 'Cuozzo, J.W.' 12 ? primary 'Gengenbacher, M.' 13 ? primary 'Guie, M.A.' 14 ? primary 'Guilinger, J.P.' 15 ? primary 'Bienstock, C.' 16 ? primary 'Hartl, H.' 17 ? primary 'Hupp, C.D.' 18 ? primary 'Jetson, R.' 19 ? primary 'Satoh, T.' 20 ? primary 'Yeoman, J.T.S.' 21 ? primary 'Zhang, Y.' 22 ? primary 'Dartois, V.' 23 ? primary 'Schnappinger, D.' 24 ? primary 'Keefe, A.D.' 25 ? primary 'Sacchettini, J.C.' 26 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polyketide synthase Pks13' 31777.742 1 2.3.1.- ? ? ? 2 non-polymer syn 'N-benzyl-2-{4-[4-(4,5-dimethoxy-1H-indole-2-carbonyl)piperazine-1-carbonyl]piperidin-1-yl}-6-methylpyrimidine-4-carboxamide' 625.717 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 water nat water 18.015 13 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Termination polyketide synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAQIDGFVRTLRARPEAGGKVPVFVFHPAGGSTVVYEPLLGRLPADTPMYGFERVEGSIEERAQQYVPKLIEMQGDGPY VLVGWSLGGVLAYACAIGLRRLGKDVRFVGLIDAVRAGEEIPQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDD EGQVRFVLDAVSQSGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAIMFEPRYAVRQPDGGWGEYV SDLEVVPIGGEHIQAIDEPIIAKVGEHMSRALGQIEADRTSEVGKQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAQIDGFVRTLRARPEAGGKVPVFVFHPAGGSTVVYEPLLGRLPADTPMYGFERVEGSIEERAQQYVPKLIEMQGDGPY VLVGWSLGGVLAYACAIGLRRLGKDVRFVGLIDAVRAGEEIPQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDD EGQVRFVLDAVSQSGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAIMFEPRYAVRQPDGGWGEYV SDLEVVPIGGEHIQAIDEPIIAKVGEHMSRALGQIEADRTSEVGKQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-benzyl-2-{4-[4-(4,5-dimethoxy-1H-indole-2-carbonyl)piperazine-1-carbonyl]piperidin-1-yl}-6-methylpyrimidine-4-carboxamide' JR0 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLN n 1 5 ILE n 1 6 ASP n 1 7 GLY n 1 8 PHE n 1 9 VAL n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ARG n 1 14 ALA n 1 15 ARG n 1 16 PRO n 1 17 GLU n 1 18 ALA n 1 19 GLY n 1 20 GLY n 1 21 LYS n 1 22 VAL n 1 23 PRO n 1 24 VAL n 1 25 PHE n 1 26 VAL n 1 27 PHE n 1 28 HIS n 1 29 PRO n 1 30 ALA n 1 31 GLY n 1 32 GLY n 1 33 SER n 1 34 THR n 1 35 VAL n 1 36 VAL n 1 37 TYR n 1 38 GLU n 1 39 PRO n 1 40 LEU n 1 41 LEU n 1 42 GLY n 1 43 ARG n 1 44 LEU n 1 45 PRO n 1 46 ALA n 1 47 ASP n 1 48 THR n 1 49 PRO n 1 50 MET n 1 51 TYR n 1 52 GLY n 1 53 PHE n 1 54 GLU n 1 55 ARG n 1 56 VAL n 1 57 GLU n 1 58 GLY n 1 59 SER n 1 60 ILE n 1 61 GLU n 1 62 GLU n 1 63 ARG n 1 64 ALA n 1 65 GLN n 1 66 GLN n 1 67 TYR n 1 68 VAL n 1 69 PRO n 1 70 LYS n 1 71 LEU n 1 72 ILE n 1 73 GLU n 1 74 MET n 1 75 GLN n 1 76 GLY n 1 77 ASP n 1 78 GLY n 1 79 PRO n 1 80 TYR n 1 81 VAL n 1 82 LEU n 1 83 VAL n 1 84 GLY n 1 85 TRP n 1 86 SER n 1 87 LEU n 1 88 GLY n 1 89 GLY n 1 90 VAL n 1 91 LEU n 1 92 ALA n 1 93 TYR n 1 94 ALA n 1 95 CYS n 1 96 ALA n 1 97 ILE n 1 98 GLY n 1 99 LEU n 1 100 ARG n 1 101 ARG n 1 102 LEU n 1 103 GLY n 1 104 LYS n 1 105 ASP n 1 106 VAL n 1 107 ARG n 1 108 PHE n 1 109 VAL n 1 110 GLY n 1 111 LEU n 1 112 ILE n 1 113 ASP n 1 114 ALA n 1 115 VAL n 1 116 ARG n 1 117 ALA n 1 118 GLY n 1 119 GLU n 1 120 GLU n 1 121 ILE n 1 122 PRO n 1 123 GLN n 1 124 THR n 1 125 LYS n 1 126 GLU n 1 127 GLU n 1 128 ILE n 1 129 ARG n 1 130 LYS n 1 131 ARG n 1 132 TRP n 1 133 ASP n 1 134 ARG n 1 135 TYR n 1 136 ALA n 1 137 ALA n 1 138 PHE n 1 139 ALA n 1 140 GLU n 1 141 LYS n 1 142 THR n 1 143 PHE n 1 144 ASN n 1 145 VAL n 1 146 THR n 1 147 ILE n 1 148 PRO n 1 149 ALA n 1 150 ILE n 1 151 PRO n 1 152 TYR n 1 153 GLU n 1 154 GLN n 1 155 LEU n 1 156 GLU n 1 157 GLU n 1 158 LEU n 1 159 ASP n 1 160 ASP n 1 161 GLU n 1 162 GLY n 1 163 GLN n 1 164 VAL n 1 165 ARG n 1 166 PHE n 1 167 VAL n 1 168 LEU n 1 169 ASP n 1 170 ALA n 1 171 VAL n 1 172 SER n 1 173 GLN n 1 174 SER n 1 175 GLY n 1 176 VAL n 1 177 GLN n 1 178 ILE n 1 179 PRO n 1 180 ALA n 1 181 GLY n 1 182 ILE n 1 183 ILE n 1 184 GLU n 1 185 HIS n 1 186 GLN n 1 187 ARG n 1 188 THR n 1 189 SER n 1 190 TYR n 1 191 LEU n 1 192 ASP n 1 193 ASN n 1 194 ARG n 1 195 ALA n 1 196 ILE n 1 197 ASP n 1 198 THR n 1 199 ALA n 1 200 GLN n 1 201 ILE n 1 202 GLN n 1 203 PRO n 1 204 TYR n 1 205 ASP n 1 206 GLY n 1 207 HIS n 1 208 VAL n 1 209 THR n 1 210 LEU n 1 211 TYR n 1 212 MET n 1 213 ALA n 1 214 ASP n 1 215 ARG n 1 216 TYR n 1 217 HIS n 1 218 ASP n 1 219 ASP n 1 220 ALA n 1 221 ILE n 1 222 MET n 1 223 PHE n 1 224 GLU n 1 225 PRO n 1 226 ARG n 1 227 TYR n 1 228 ALA n 1 229 VAL n 1 230 ARG n 1 231 GLN n 1 232 PRO n 1 233 ASP n 1 234 GLY n 1 235 GLY n 1 236 TRP n 1 237 GLY n 1 238 GLU n 1 239 TYR n 1 240 VAL n 1 241 SER n 1 242 ASP n 1 243 LEU n 1 244 GLU n 1 245 VAL n 1 246 VAL n 1 247 PRO n 1 248 ILE n 1 249 GLY n 1 250 GLY n 1 251 GLU n 1 252 HIS n 1 253 ILE n 1 254 GLN n 1 255 ALA n 1 256 ILE n 1 257 ASP n 1 258 GLU n 1 259 PRO n 1 260 ILE n 1 261 ILE n 1 262 ALA n 1 263 LYS n 1 264 VAL n 1 265 GLY n 1 266 GLU n 1 267 HIS n 1 268 MET n 1 269 SER n 1 270 ARG n 1 271 ALA n 1 272 LEU n 1 273 GLY n 1 274 GLN n 1 275 ILE n 1 276 GLU n 1 277 ALA n 1 278 ASP n 1 279 ARG n 1 280 THR n 1 281 SER n 1 282 GLU n 1 283 VAL n 1 284 GLY n 1 285 LYS n 1 286 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 286 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pks13, Rv3800c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 JR0 non-polymer . 'N-benzyl-2-{4-[4-(4,5-dimethoxy-1H-indole-2-carbonyl)piperazine-1-carbonyl]piperidin-1-yl}-6-methylpyrimidine-4-carboxamide' ? 'C34 H39 N7 O5' 625.717 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1448 ? ? ? A . n A 1 2 ASN 2 1449 ? ? ? A . n A 1 3 ALA 3 1450 ? ? ? A . n A 1 4 GLN 4 1451 1451 GLN GLN A . n A 1 5 ILE 5 1452 1452 ILE ILE A . n A 1 6 ASP 6 1453 1453 ASP ASP A . n A 1 7 GLY 7 1454 1454 GLY GLY A . n A 1 8 PHE 8 1455 1455 PHE PHE A . n A 1 9 VAL 9 1456 1456 VAL VAL A . n A 1 10 ARG 10 1457 1457 ARG ARG A . n A 1 11 THR 11 1458 1458 THR THR A . n A 1 12 LEU 12 1459 1459 LEU LEU A . n A 1 13 ARG 13 1460 1460 ARG ARG A . n A 1 14 ALA 14 1461 1461 ALA ALA A . n A 1 15 ARG 15 1462 1462 ARG ARG A . n A 1 16 PRO 16 1463 1463 PRO PRO A . n A 1 17 GLU 17 1464 1464 GLU GLU A . n A 1 18 ALA 18 1465 1465 ALA ALA A . n A 1 19 GLY 19 1466 1466 GLY GLY A . n A 1 20 GLY 20 1467 1467 GLY GLY A . n A 1 21 LYS 21 1468 1468 LYS LYS A . n A 1 22 VAL 22 1469 1469 VAL VAL A . n A 1 23 PRO 23 1470 1470 PRO PRO A . n A 1 24 VAL 24 1471 1471 VAL VAL A . n A 1 25 PHE 25 1472 1472 PHE PHE A . n A 1 26 VAL 26 1473 1473 VAL VAL A . n A 1 27 PHE 27 1474 1474 PHE PHE A . n A 1 28 HIS 28 1475 1475 HIS HIS A . n A 1 29 PRO 29 1476 1476 PRO PRO A . n A 1 30 ALA 30 1477 1477 ALA ALA A . n A 1 31 GLY 31 1478 1478 GLY GLY A . n A 1 32 GLY 32 1479 1479 GLY GLY A . n A 1 33 SER 33 1480 1480 SER SER A . n A 1 34 THR 34 1481 1481 THR THR A . n A 1 35 VAL 35 1482 1482 VAL VAL A . n A 1 36 VAL 36 1483 1483 VAL VAL A . n A 1 37 TYR 37 1484 1484 TYR TYR A . n A 1 38 GLU 38 1485 1485 GLU GLU A . n A 1 39 PRO 39 1486 1486 PRO PRO A . n A 1 40 LEU 40 1487 1487 LEU LEU A . n A 1 41 LEU 41 1488 1488 LEU LEU A . n A 1 42 GLY 42 1489 1489 GLY GLY A . n A 1 43 ARG 43 1490 1490 ARG ARG A . n A 1 44 LEU 44 1491 1491 LEU LEU A . n A 1 45 PRO 45 1492 1492 PRO PRO A . n A 1 46 ALA 46 1493 1493 ALA ALA A . n A 1 47 ASP 47 1494 1494 ASP ASP A . n A 1 48 THR 48 1495 1495 THR THR A . n A 1 49 PRO 49 1496 1496 PRO PRO A . n A 1 50 MET 50 1497 1497 MET MET A . n A 1 51 TYR 51 1498 1498 TYR TYR A . n A 1 52 GLY 52 1499 1499 GLY GLY A . n A 1 53 PHE 53 1500 1500 PHE PHE A . n A 1 54 GLU 54 1501 1501 GLU GLU A . n A 1 55 ARG 55 1502 1502 ARG ARG A . n A 1 56 VAL 56 1503 1503 VAL VAL A . n A 1 57 GLU 57 1504 1504 GLU GLU A . n A 1 58 GLY 58 1505 1505 GLY GLY A . n A 1 59 SER 59 1506 1506 SER SER A . n A 1 60 ILE 60 1507 1507 ILE ILE A . n A 1 61 GLU 61 1508 1508 GLU GLU A . n A 1 62 GLU 62 1509 1509 GLU GLU A . n A 1 63 ARG 63 1510 1510 ARG ARG A . n A 1 64 ALA 64 1511 1511 ALA ALA A . n A 1 65 GLN 65 1512 1512 GLN GLN A . n A 1 66 GLN 66 1513 1513 GLN GLN A . n A 1 67 TYR 67 1514 1514 TYR TYR A . n A 1 68 VAL 68 1515 1515 VAL VAL A . n A 1 69 PRO 69 1516 1516 PRO PRO A . n A 1 70 LYS 70 1517 1517 LYS LYS A . n A 1 71 LEU 71 1518 1518 LEU LEU A . n A 1 72 ILE 72 1519 1519 ILE ILE A . n A 1 73 GLU 73 1520 1520 GLU GLU A . n A 1 74 MET 74 1521 1521 MET MET A . n A 1 75 GLN 75 1522 1522 GLN GLN A . n A 1 76 GLY 76 1523 1523 GLY GLY A . n A 1 77 ASP 77 1524 1524 ASP ASP A . n A 1 78 GLY 78 1525 1525 GLY GLY A . n A 1 79 PRO 79 1526 1526 PRO PRO A . n A 1 80 TYR 80 1527 1527 TYR TYR A . n A 1 81 VAL 81 1528 1528 VAL VAL A . n A 1 82 LEU 82 1529 1529 LEU LEU A . n A 1 83 VAL 83 1530 1530 VAL VAL A . n A 1 84 GLY 84 1531 1531 GLY GLY A . n A 1 85 TRP 85 1532 1532 TRP TRP A . n A 1 86 SER 86 1533 1533 SER SER A . n A 1 87 LEU 87 1534 1534 LEU LEU A . n A 1 88 GLY 88 1535 1535 GLY GLY A . n A 1 89 GLY 89 1536 1536 GLY GLY A . n A 1 90 VAL 90 1537 1537 VAL VAL A . n A 1 91 LEU 91 1538 1538 LEU LEU A . n A 1 92 ALA 92 1539 1539 ALA ALA A . n A 1 93 TYR 93 1540 1540 TYR TYR A . n A 1 94 ALA 94 1541 1541 ALA ALA A . n A 1 95 CYS 95 1542 1542 CYS CYS A . n A 1 96 ALA 96 1543 1543 ALA ALA A . n A 1 97 ILE 97 1544 1544 ILE ILE A . n A 1 98 GLY 98 1545 1545 GLY GLY A . n A 1 99 LEU 99 1546 1546 LEU LEU A . n A 1 100 ARG 100 1547 1547 ARG ARG A . n A 1 101 ARG 101 1548 1548 ARG ARG A . n A 1 102 LEU 102 1549 1549 LEU LEU A . n A 1 103 GLY 103 1550 1550 GLY GLY A . n A 1 104 LYS 104 1551 1551 LYS LYS A . n A 1 105 ASP 105 1552 1552 ASP ASP A . n A 1 106 VAL 106 1553 1553 VAL VAL A . n A 1 107 ARG 107 1554 1554 ARG ARG A . n A 1 108 PHE 108 1555 1555 PHE PHE A . n A 1 109 VAL 109 1556 1556 VAL VAL A . n A 1 110 GLY 110 1557 1557 GLY GLY A . n A 1 111 LEU 111 1558 1558 LEU LEU A . n A 1 112 ILE 112 1559 1559 ILE ILE A . n A 1 113 ASP 113 1560 1560 ASP ASP A . n A 1 114 ALA 114 1561 1561 ALA ALA A . n A 1 115 VAL 115 1562 1562 VAL VAL A . n A 1 116 ARG 116 1563 1563 ARG ARG A . n A 1 117 ALA 117 1564 1564 ALA ALA A . n A 1 118 GLY 118 1565 1565 GLY GLY A . n A 1 119 GLU 119 1566 1566 GLU GLU A . n A 1 120 GLU 120 1567 1567 GLU GLU A . n A 1 121 ILE 121 1568 1568 ILE ILE A . n A 1 122 PRO 122 1569 1569 PRO PRO A . n A 1 123 GLN 123 1570 1570 GLN GLN A . n A 1 124 THR 124 1571 1571 THR THR A . n A 1 125 LYS 125 1572 1572 LYS LYS A . n A 1 126 GLU 126 1573 1573 GLU GLU A . n A 1 127 GLU 127 1574 1574 GLU GLU A . n A 1 128 ILE 128 1575 1575 ILE ILE A . n A 1 129 ARG 129 1576 1576 ARG ARG A . n A 1 130 LYS 130 1577 1577 LYS LYS A . n A 1 131 ARG 131 1578 1578 ARG ARG A . n A 1 132 TRP 132 1579 1579 TRP TRP A . n A 1 133 ASP 133 1580 1580 ASP ASP A . n A 1 134 ARG 134 1581 1581 ARG ARG A . n A 1 135 TYR 135 1582 1582 TYR TYR A . n A 1 136 ALA 136 1583 1583 ALA ALA A . n A 1 137 ALA 137 1584 1584 ALA ALA A . n A 1 138 PHE 138 1585 1585 PHE PHE A . n A 1 139 ALA 139 1586 1586 ALA ALA A . n A 1 140 GLU 140 1587 1587 GLU GLU A . n A 1 141 LYS 141 1588 1588 LYS LYS A . n A 1 142 THR 142 1589 1589 THR THR A . n A 1 143 PHE 143 1590 1590 PHE PHE A . n A 1 144 ASN 144 1591 1591 ASN ASN A . n A 1 145 VAL 145 1592 1592 VAL VAL A . n A 1 146 THR 146 1593 1593 THR THR A . n A 1 147 ILE 147 1594 1594 ILE ILE A . n A 1 148 PRO 148 1595 1595 PRO PRO A . n A 1 149 ALA 149 1596 1596 ALA ALA A . n A 1 150 ILE 150 1597 1597 ILE ILE A . n A 1 151 PRO 151 1598 1598 PRO PRO A . n A 1 152 TYR 152 1599 1599 TYR TYR A . n A 1 153 GLU 153 1600 1600 GLU GLU A . n A 1 154 GLN 154 1601 1601 GLN GLN A . n A 1 155 LEU 155 1602 1602 LEU LEU A . n A 1 156 GLU 156 1603 1603 GLU GLU A . n A 1 157 GLU 157 1604 1604 GLU GLU A . n A 1 158 LEU 158 1605 1605 LEU LEU A . n A 1 159 ASP 159 1606 1606 ASP ASP A . n A 1 160 ASP 160 1607 1607 ASP ASP A . n A 1 161 GLU 161 1608 1608 GLU GLU A . n A 1 162 GLY 162 1609 1609 GLY GLY A . n A 1 163 GLN 163 1610 1610 GLN GLN A . n A 1 164 VAL 164 1611 1611 VAL VAL A . n A 1 165 ARG 165 1612 1612 ARG ARG A . n A 1 166 PHE 166 1613 1613 PHE PHE A . n A 1 167 VAL 167 1614 1614 VAL VAL A . n A 1 168 LEU 168 1615 1615 LEU LEU A . n A 1 169 ASP 169 1616 1616 ASP ASP A . n A 1 170 ALA 170 1617 1617 ALA ALA A . n A 1 171 VAL 171 1618 1618 VAL VAL A . n A 1 172 SER 172 1619 1619 SER SER A . n A 1 173 GLN 173 1620 1620 GLN GLN A . n A 1 174 SER 174 1621 1621 SER SER A . n A 1 175 GLY 175 1622 1622 GLY GLY A . n A 1 176 VAL 176 1623 1623 VAL VAL A . n A 1 177 GLN 177 1624 1624 GLN GLN A . n A 1 178 ILE 178 1625 1625 ILE ILE A . n A 1 179 PRO 179 1626 1626 PRO PRO A . n A 1 180 ALA 180 1627 1627 ALA ALA A . n A 1 181 GLY 181 1628 1628 GLY GLY A . n A 1 182 ILE 182 1629 1629 ILE ILE A . n A 1 183 ILE 183 1630 1630 ILE ILE A . n A 1 184 GLU 184 1631 1631 GLU GLU A . n A 1 185 HIS 185 1632 1632 HIS HIS A . n A 1 186 GLN 186 1633 1633 GLN GLN A . n A 1 187 ARG 187 1634 1634 ARG ARG A . n A 1 188 THR 188 1635 1635 THR THR A . n A 1 189 SER 189 1636 1636 SER SER A . n A 1 190 TYR 190 1637 1637 TYR TYR A . n A 1 191 LEU 191 1638 1638 LEU LEU A . n A 1 192 ASP 192 1639 1639 ASP ASP A . n A 1 193 ASN 193 1640 1640 ASN ASN A . n A 1 194 ARG 194 1641 1641 ARG ARG A . n A 1 195 ALA 195 1642 1642 ALA ALA A . n A 1 196 ILE 196 1643 1643 ILE ILE A . n A 1 197 ASP 197 1644 1644 ASP ASP A . n A 1 198 THR 198 1645 1645 THR THR A . n A 1 199 ALA 199 1646 1646 ALA ALA A . n A 1 200 GLN 200 1647 1647 GLN GLN A . n A 1 201 ILE 201 1648 1648 ILE ILE A . n A 1 202 GLN 202 1649 1649 GLN GLN A . n A 1 203 PRO 203 1650 1650 PRO PRO A . n A 1 204 TYR 204 1651 1651 TYR TYR A . n A 1 205 ASP 205 1652 1652 ASP ASP A . n A 1 206 GLY 206 1653 1653 GLY GLY A . n A 1 207 HIS 207 1654 1654 HIS HIS A . n A 1 208 VAL 208 1655 1655 VAL VAL A . n A 1 209 THR 209 1656 1656 THR THR A . n A 1 210 LEU 210 1657 1657 LEU LEU A . n A 1 211 TYR 211 1658 1658 TYR TYR A . n A 1 212 MET 212 1659 1659 MET MET A . n A 1 213 ALA 213 1660 1660 ALA ALA A . n A 1 214 ASP 214 1661 1661 ASP ASP A . n A 1 215 ARG 215 1662 1662 ARG ARG A . n A 1 216 TYR 216 1663 1663 TYR TYR A . n A 1 217 HIS 217 1664 1664 HIS HIS A . n A 1 218 ASP 218 1665 1665 ASP ASP A . n A 1 219 ASP 219 1666 1666 ASP ASP A . n A 1 220 ALA 220 1667 1667 ALA ALA A . n A 1 221 ILE 221 1668 1668 ILE ILE A . n A 1 222 MET 222 1669 1669 MET MET A . n A 1 223 PHE 223 1670 1670 PHE PHE A . n A 1 224 GLU 224 1671 1671 GLU GLU A . n A 1 225 PRO 225 1672 1672 PRO PRO A . n A 1 226 ARG 226 1673 1673 ARG ARG A . n A 1 227 TYR 227 1674 1674 TYR TYR A . n A 1 228 ALA 228 1675 1675 ALA ALA A . n A 1 229 VAL 229 1676 1676 VAL VAL A . n A 1 230 ARG 230 1677 1677 ARG ARG A . n A 1 231 GLN 231 1678 1678 GLN GLN A . n A 1 232 PRO 232 1679 1679 PRO PRO A . n A 1 233 ASP 233 1680 1680 ASP ASP A . n A 1 234 GLY 234 1681 1681 GLY GLY A . n A 1 235 GLY 235 1682 1682 GLY GLY A . n A 1 236 TRP 236 1683 1683 TRP TRP A . n A 1 237 GLY 237 1684 1684 GLY GLY A . n A 1 238 GLU 238 1685 1685 GLU GLU A . n A 1 239 TYR 239 1686 1686 TYR TYR A . n A 1 240 VAL 240 1687 1687 VAL VAL A . n A 1 241 SER 241 1688 1688 SER SER A . n A 1 242 ASP 242 1689 1689 ASP ASP A . n A 1 243 LEU 243 1690 1690 LEU LEU A . n A 1 244 GLU 244 1691 1691 GLU GLU A . n A 1 245 VAL 245 1692 1692 VAL VAL A . n A 1 246 VAL 246 1693 1693 VAL VAL A . n A 1 247 PRO 247 1694 1694 PRO PRO A . n A 1 248 ILE 248 1695 1695 ILE ILE A . n A 1 249 GLY 249 1696 1696 GLY GLY A . n A 1 250 GLY 250 1697 1697 GLY GLY A . n A 1 251 GLU 251 1698 1698 GLU GLU A . n A 1 252 HIS 252 1699 1699 HIS HIS A . n A 1 253 ILE 253 1700 1700 ILE ILE A . n A 1 254 GLN 254 1701 1701 GLN GLN A . n A 1 255 ALA 255 1702 1702 ALA ALA A . n A 1 256 ILE 256 1703 1703 ILE ILE A . n A 1 257 ASP 257 1704 1704 ASP ASP A . n A 1 258 GLU 258 1705 1705 GLU GLU A . n A 1 259 PRO 259 1706 1706 PRO PRO A . n A 1 260 ILE 260 1707 1707 ILE ILE A . n A 1 261 ILE 261 1708 1708 ILE ILE A . n A 1 262 ALA 262 1709 1709 ALA ALA A . n A 1 263 LYS 263 1710 1710 LYS LYS A . n A 1 264 VAL 264 1711 1711 VAL VAL A . n A 1 265 GLY 265 1712 1712 GLY GLY A . n A 1 266 GLU 266 1713 1713 GLU GLU A . n A 1 267 HIS 267 1714 1714 HIS HIS A . n A 1 268 MET 268 1715 1715 MET MET A . n A 1 269 SER 269 1716 1716 SER SER A . n A 1 270 ARG 270 1717 1717 ARG ARG A . n A 1 271 ALA 271 1718 1718 ALA ALA A . n A 1 272 LEU 272 1719 1719 LEU LEU A . n A 1 273 GLY 273 1720 1720 GLY GLY A . n A 1 274 GLN 274 1721 1721 GLN GLN A . n A 1 275 ILE 275 1722 1722 ILE ILE A . n A 1 276 GLU 276 1723 1723 GLU GLU A . n A 1 277 ALA 277 1724 1724 ALA ALA A . n A 1 278 ASP 278 1725 1725 ASP ASP A . n A 1 279 ARG 279 1726 1726 ARG ARG A . n A 1 280 THR 280 1727 1727 THR THR A . n A 1 281 SER 281 1728 ? ? ? A . n A 1 282 GLU 282 1729 ? ? ? A . n A 1 283 VAL 283 1730 ? ? ? A . n A 1 284 GLY 284 1731 ? ? ? A . n A 1 285 LYS 285 1732 ? ? ? A . n A 1 286 GLN 286 1733 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 JR0 1 1801 1801 JR0 LIG A . C 3 SO4 1 1802 1 SO4 SO4 A . D 3 SO4 1 1803 2 SO4 SO4 A . E 4 HOH 1 1901 22 HOH HOH A . E 4 HOH 2 1902 1 HOH HOH A . E 4 HOH 3 1903 21 HOH HOH A . E 4 HOH 4 1904 3 HOH HOH A . E 4 HOH 5 1905 25 HOH HOH A . E 4 HOH 6 1906 17 HOH HOH A . E 4 HOH 7 1907 5 HOH HOH A . E 4 HOH 8 1908 4 HOH HOH A . E 4 HOH 9 1909 9 HOH HOH A . E 4 HOH 10 1910 15 HOH HOH A . E 4 HOH 11 1911 11 HOH HOH A . E 4 HOH 12 1912 10 HOH HOH A . E 4 HOH 13 1913 7 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8TQG _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.626 _cell.length_a_esd ? _cell.length_b 66.626 _cell.length_b_esd ? _cell.length_c 129.953 _cell.length_c_esd ? _cell.volume 576864.470 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8TQG _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8TQG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M TRIS-HCL, 2.0-1.8 M AMMONIUM SULFATE, 2%-5% V/V PPG P400 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 290 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03317 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03317 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 49.04 _reflns.entry_id 8TQG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 66.63 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15367 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.049 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.113 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1295 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.931 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.598 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.24 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 62.93 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8TQG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.20 _refine.ls_d_res_low 59.29 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15293 _refine.ls_number_reflns_R_free 796 _refine.ls_number_reflns_R_work 14497 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.41 _refine.ls_percent_reflns_R_free 5.20 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2457 _refine.ls_R_factor_R_free 0.3129 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2418 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.3638 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3911 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 59.29 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 2247 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2178 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0081 ? 2287 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0079 ? 3110 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0595 ? 324 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0121 ? 412 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.2846 ? 331 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.20 2.34 . . 122 2352 98.17 . . . . 0.3916 . . . . . . . . . . . 0.4437 'X-RAY DIFFRACTION' 2.34 2.52 . . 130 2369 98.70 . . . . 0.3360 . . . . . . . . . . . 0.4207 'X-RAY DIFFRACTION' 2.52 2.77 . . 114 2378 97.42 . . . . 0.3073 . . . . . . . . . . . 0.3959 'X-RAY DIFFRACTION' 2.77 3.17 . . 144 2388 98.75 . . . . 0.2831 . . . . . . . . . . . 0.3878 'X-RAY DIFFRACTION' 3.17 4.00 . . 125 2428 98.46 . . . . 0.2454 . . . . . . . . . . . 0.3198 'X-RAY DIFFRACTION' 4.00 59.29 . . 161 2582 98.92 . . . . 0.1906 . . . . . . . . . . . 0.2612 # _struct.entry_id 8TQG _struct.title 'Crystal Structure of Mtb Pks13 Thioesterase domain in complex with inhibitor X20419' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8TQG _struct_keywords.text 'polyketide synthase, thioesterase, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PKS13_MYCTU _struct_ref.pdbx_db_accession I6X8D2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QIDGFVRTLRARPEAGGKVPVFVFHPAGGSTVVYEPLLGRLPADTPMYGFERVEGSIEERAQQYVPKLIEMQGDGPYVLV GWSLGGVLAYACAIGLRRLGKDVRFVGLIDAVRAGEEIPQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDDEGQ VRFVLDAVSQSGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAIMFEPRYAVRQPDGGWGEYVSDL EVVPIGGEHIQAIDEPIIAKVGEHMSRALGQIEADRTSEVGKQ ; _struct_ref.pdbx_align_begin 1451 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8TQG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 286 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I6X8D2 _struct_ref_seq.db_align_beg 1451 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1733 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1451 _struct_ref_seq.pdbx_auth_seq_align_end 1733 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8TQG SER A 1 ? UNP I6X8D2 ? ? 'expression tag' 1448 1 1 8TQG ASN A 2 ? UNP I6X8D2 ? ? 'expression tag' 1449 2 1 8TQG ALA A 3 ? UNP I6X8D2 ? ? 'expression tag' 1450 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 33 ? VAL A 36 ? SER A 1480 VAL A 1483 5 ? 4 HELX_P HELX_P2 AA2 TYR A 37 ? ARG A 43 ? TYR A 1484 ARG A 1490 1 ? 7 HELX_P HELX_P3 AA3 SER A 59 ? GLY A 76 ? SER A 1506 GLY A 1523 1 ? 18 HELX_P HELX_P4 AA4 SER A 86 ? LEU A 102 ? SER A 1533 LEU A 1549 1 ? 17 HELX_P HELX_P5 AA5 THR A 124 ? PHE A 143 ? THR A 1571 PHE A 1590 1 ? 20 HELX_P HELX_P6 AA6 GLU A 153 ? LEU A 158 ? GLU A 1600 LEU A 1605 1 ? 6 HELX_P HELX_P7 AA7 ASP A 159 ? GLN A 173 ? ASP A 1606 GLN A 1620 1 ? 15 HELX_P HELX_P8 AA8 PRO A 179 ? ALA A 199 ? PRO A 1626 ALA A 1646 1 ? 21 HELX_P HELX_P9 AA9 HIS A 217 ? GLU A 224 ? HIS A 1664 GLU A 1671 1 ? 8 HELX_P HELX_P10 AB1 PRO A 225 ? VAL A 229 ? PRO A 1672 VAL A 1676 5 ? 5 HELX_P HELX_P11 AB2 ILE A 260 ? ASP A 278 ? ILE A 1707 ASP A 1725 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 78 A . ? GLY 1525 A PRO 79 A ? PRO 1526 A 1 -5.41 2 GLU 258 A . ? GLU 1705 A PRO 259 A ? PRO 1706 A 1 0.56 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 5 ? ASP A 6 ? ILE A 1452 ASP A 1453 AA1 2 VAL A 9 ? ARG A 13 ? VAL A 1456 ARG A 1460 AA1 3 MET A 50 ? PHE A 53 ? MET A 1497 PHE A 1500 AA1 4 VAL A 24 ? PHE A 27 ? VAL A 1471 PHE A 1474 AA1 5 TYR A 80 ? TRP A 85 ? TYR A 1527 TRP A 1532 AA1 6 VAL A 106 ? ILE A 112 ? VAL A 1553 ILE A 1559 AA1 7 VAL A 208 ? MET A 212 ? VAL A 1655 MET A 1659 AA1 8 LEU A 243 ? PRO A 247 ? LEU A 1690 PRO A 1694 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 6 ? N ASP A 1453 O VAL A 9 ? O VAL A 1456 AA1 2 3 N ARG A 10 ? N ARG A 1457 O GLY A 52 ? O GLY A 1499 AA1 3 4 O PHE A 53 ? O PHE A 1500 N VAL A 26 ? N VAL A 1473 AA1 4 5 N PHE A 25 ? N PHE A 1472 O VAL A 83 ? O VAL A 1530 AA1 5 6 N GLY A 84 ? N GLY A 1531 O ILE A 112 ? O ILE A 1559 AA1 6 7 N LEU A 111 ? N LEU A 1558 O TYR A 211 ? O TYR A 1658 AA1 7 8 N LEU A 210 ? N LEU A 1657 O GLU A 244 ? O GLU A 1691 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 1492 ? ? -43.69 155.74 2 1 ALA A 1493 ? ? -55.77 -83.85 3 1 ASP A 1494 ? ? -79.21 43.41 4 1 SER A 1533 ? ? 62.53 -140.36 5 1 PHE A 1590 ? ? -90.65 34.33 6 1 ASN A 1591 ? ? 49.18 -133.63 7 1 VAL A 1592 ? ? 55.59 70.42 8 1 PRO A 1595 ? ? -69.76 -155.32 9 1 ILE A 1695 ? ? -143.54 -5.13 10 1 ALA A 1718 ? ? 173.99 -43.49 11 1 ASP A 1725 ? ? -59.45 6.14 # _pdbx_entry_details.entry_id 8TQG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1448 ? A SER 1 2 1 Y 1 A ASN 1449 ? A ASN 2 3 1 Y 1 A ALA 1450 ? A ALA 3 4 1 Y 1 A SER 1728 ? A SER 281 5 1 Y 1 A GLU 1729 ? A GLU 282 6 1 Y 1 A VAL 1730 ? A VAL 283 7 1 Y 1 A GLY 1731 ? A GLY 284 8 1 Y 1 A LYS 1732 ? A LYS 285 9 1 Y 1 A GLN 1733 ? A GLN 286 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 JR0 C10 C Y N 183 JR0 C15 C N N 184 JR0 C20 C N N 185 JR0 C22 C N N 186 JR0 C24 C N N 187 JR0 C26 C N N 188 JR0 C28 C Y N 189 JR0 C01 C N N 190 JR0 C03 C Y N 191 JR0 C04 C Y N 192 JR0 C06 C N N 193 JR0 C07 C Y N 194 JR0 C08 C Y N 195 JR0 C11 C Y N 196 JR0 C12 C N N 197 JR0 C16 C N N 198 JR0 C18 C N N 199 JR0 C19 C N N 200 JR0 C23 C N N 201 JR0 C27 C N N 202 JR0 C30 C Y N 203 JR0 C31 C N N 204 JR0 C32 C Y N 205 JR0 C33 C Y N 206 JR0 C35 C N N 207 JR0 C38 C N N 208 JR0 C39 C Y N 209 JR0 C40 C Y N 210 JR0 C41 C Y N 211 JR0 C42 C Y N 212 JR0 C43 C Y N 213 JR0 C44 C Y N 214 JR0 C45 C Y N 215 JR0 C46 C Y N 216 JR0 N09 N Y N 217 JR0 N14 N N N 218 JR0 N17 N N N 219 JR0 N25 N N N 220 JR0 N29 N Y N 221 JR0 N34 N Y N 222 JR0 N37 N N N 223 JR0 O02 O N N 224 JR0 O05 O N N 225 JR0 O13 O N N 226 JR0 O21 O N N 227 JR0 O36 O N N 228 JR0 H151 H N N 229 JR0 H152 H N N 230 JR0 H221 H N N 231 JR0 H242 H N N 232 JR0 H241 H N N 233 JR0 H262 H N N 234 JR0 H261 H N N 235 JR0 H011 H N N 236 JR0 H012 H N N 237 JR0 H013 H N N 238 JR0 H061 H N N 239 JR0 H062 H N N 240 JR0 H063 H N N 241 JR0 H111 H N N 242 JR0 H161 H N N 243 JR0 H162 H N N 244 JR0 H182 H N N 245 JR0 H181 H N N 246 JR0 H191 H N N 247 JR0 H192 H N N 248 JR0 H231 H N N 249 JR0 H232 H N N 250 JR0 H272 H N N 251 JR0 H271 H N N 252 JR0 H313 H N N 253 JR0 H311 H N N 254 JR0 H312 H N N 255 JR0 H321 H N N 256 JR0 H381 H N N 257 JR0 H382 H N N 258 JR0 H401 H N N 259 JR0 H411 H N N 260 JR0 H421 H N N 261 JR0 H431 H N N 262 JR0 H441 H N N 263 JR0 H451 H N N 264 JR0 H461 H N N 265 JR0 H091 H N N 266 JR0 H371 H N N 267 LEU N N N N 268 LEU CA C N S 269 LEU C C N N 270 LEU O O N N 271 LEU CB C N N 272 LEU CG C N N 273 LEU CD1 C N N 274 LEU CD2 C N N 275 LEU OXT O N N 276 LEU H H N N 277 LEU H2 H N N 278 LEU HA H N N 279 LEU HB2 H N N 280 LEU HB3 H N N 281 LEU HG H N N 282 LEU HD11 H N N 283 LEU HD12 H N N 284 LEU HD13 H N N 285 LEU HD21 H N N 286 LEU HD22 H N N 287 LEU HD23 H N N 288 LEU HXT H N N 289 LYS N N N N 290 LYS CA C N S 291 LYS C C N N 292 LYS O O N N 293 LYS CB C N N 294 LYS CG C N N 295 LYS CD C N N 296 LYS CE C N N 297 LYS NZ N N N 298 LYS OXT O N N 299 LYS H H N N 300 LYS H2 H N N 301 LYS HA H N N 302 LYS HB2 H N N 303 LYS HB3 H N N 304 LYS HG2 H N N 305 LYS HG3 H N N 306 LYS HD2 H N N 307 LYS HD3 H N N 308 LYS HE2 H N N 309 LYS HE3 H N N 310 LYS HZ1 H N N 311 LYS HZ2 H N N 312 LYS HZ3 H N N 313 LYS HXT H N N 314 MET N N N N 315 MET CA C N S 316 MET C C N N 317 MET O O N N 318 MET CB C N N 319 MET CG C N N 320 MET SD S N N 321 MET CE C N N 322 MET OXT O N N 323 MET H H N N 324 MET H2 H N N 325 MET HA H N N 326 MET HB2 H N N 327 MET HB3 H N N 328 MET HG2 H N N 329 MET HG3 H N N 330 MET HE1 H N N 331 MET HE2 H N N 332 MET HE3 H N N 333 MET HXT H N N 334 PHE N N N N 335 PHE CA C N S 336 PHE C C N N 337 PHE O O N N 338 PHE CB C N N 339 PHE CG C Y N 340 PHE CD1 C Y N 341 PHE CD2 C Y N 342 PHE CE1 C Y N 343 PHE CE2 C Y N 344 PHE CZ C Y N 345 PHE OXT O N N 346 PHE H H N N 347 PHE H2 H N N 348 PHE HA H N N 349 PHE HB2 H N N 350 PHE HB3 H N N 351 PHE HD1 H N N 352 PHE HD2 H N N 353 PHE HE1 H N N 354 PHE HE2 H N N 355 PHE HZ H N N 356 PHE HXT H N N 357 PRO N N N N 358 PRO CA C N S 359 PRO C C N N 360 PRO O O N N 361 PRO CB C N N 362 PRO CG C N N 363 PRO CD C N N 364 PRO OXT O N N 365 PRO H H N N 366 PRO HA H N N 367 PRO HB2 H N N 368 PRO HB3 H N N 369 PRO HG2 H N N 370 PRO HG3 H N N 371 PRO HD2 H N N 372 PRO HD3 H N N 373 PRO HXT H N N 374 SER N N N N 375 SER CA C N S 376 SER C C N N 377 SER O O N N 378 SER CB C N N 379 SER OG O N N 380 SER OXT O N N 381 SER H H N N 382 SER H2 H N N 383 SER HA H N N 384 SER HB2 H N N 385 SER HB3 H N N 386 SER HG H N N 387 SER HXT H N N 388 SO4 S S N N 389 SO4 O1 O N N 390 SO4 O2 O N N 391 SO4 O3 O N N 392 SO4 O4 O N N 393 THR N N N N 394 THR CA C N S 395 THR C C N N 396 THR O O N N 397 THR CB C N R 398 THR OG1 O N N 399 THR CG2 C N N 400 THR OXT O N N 401 THR H H N N 402 THR H2 H N N 403 THR HA H N N 404 THR HB H N N 405 THR HG1 H N N 406 THR HG21 H N N 407 THR HG22 H N N 408 THR HG23 H N N 409 THR HXT H N N 410 TRP N N N N 411 TRP CA C N S 412 TRP C C N N 413 TRP O O N N 414 TRP CB C N N 415 TRP CG C Y N 416 TRP CD1 C Y N 417 TRP CD2 C Y N 418 TRP NE1 N Y N 419 TRP CE2 C Y N 420 TRP CE3 C Y N 421 TRP CZ2 C Y N 422 TRP CZ3 C Y N 423 TRP CH2 C Y N 424 TRP OXT O N N 425 TRP H H N N 426 TRP H2 H N N 427 TRP HA H N N 428 TRP HB2 H N N 429 TRP HB3 H N N 430 TRP HD1 H N N 431 TRP HE1 H N N 432 TRP HE3 H N N 433 TRP HZ2 H N N 434 TRP HZ3 H N N 435 TRP HH2 H N N 436 TRP HXT H N N 437 TYR N N N N 438 TYR CA C N S 439 TYR C C N N 440 TYR O O N N 441 TYR CB C N N 442 TYR CG C Y N 443 TYR CD1 C Y N 444 TYR CD2 C Y N 445 TYR CE1 C Y N 446 TYR CE2 C Y N 447 TYR CZ C Y N 448 TYR OH O N N 449 TYR OXT O N N 450 TYR H H N N 451 TYR H2 H N N 452 TYR HA H N N 453 TYR HB2 H N N 454 TYR HB3 H N N 455 TYR HD1 H N N 456 TYR HD2 H N N 457 TYR HE1 H N N 458 TYR HE2 H N N 459 TYR HH H N N 460 TYR HXT H N N 461 VAL N N N N 462 VAL CA C N S 463 VAL C C N N 464 VAL O O N N 465 VAL CB C N N 466 VAL CG1 C N N 467 VAL CG2 C N N 468 VAL OXT O N N 469 VAL H H N N 470 VAL H2 H N N 471 VAL HA H N N 472 VAL HB H N N 473 VAL HG11 H N N 474 VAL HG12 H N N 475 VAL HG13 H N N 476 VAL HG21 H N N 477 VAL HG22 H N N 478 VAL HG23 H N N 479 VAL HXT H N N 480 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 JR0 O02 C01 sing N N 173 JR0 C03 O02 sing N N 174 JR0 C04 C03 doub Y N 175 JR0 C06 O05 sing N N 176 JR0 O05 C04 sing N N 177 JR0 C07 C04 sing Y N 178 JR0 C08 C07 doub Y N 179 JR0 C10 N09 sing Y N 180 JR0 C11 C10 doub Y N 181 JR0 C12 C10 sing N N 182 JR0 O13 C12 doub N N 183 JR0 N14 C12 sing N N 184 JR0 C15 N14 sing N N 185 JR0 C16 C15 sing N N 186 JR0 N17 C16 sing N N 187 JR0 C19 C18 sing N N 188 JR0 C18 N17 sing N N 189 JR0 C20 N17 sing N N 190 JR0 O21 C20 doub N N 191 JR0 C22 C20 sing N N 192 JR0 C23 C22 sing N N 193 JR0 C24 C23 sing N N 194 JR0 N25 C24 sing N N 195 JR0 C27 C26 sing N N 196 JR0 C26 N25 sing N N 197 JR0 C28 N25 sing N N 198 JR0 N29 C28 doub Y N 199 JR0 C30 N29 sing Y N 200 JR0 C31 C30 sing N N 201 JR0 C32 C30 doub Y N 202 JR0 C33 C32 sing Y N 203 JR0 N34 C33 doub Y N 204 JR0 C35 C33 sing N N 205 JR0 O36 C35 doub N N 206 JR0 N37 C35 sing N N 207 JR0 C38 N37 sing N N 208 JR0 C39 C38 sing N N 209 JR0 C40 C39 doub Y N 210 JR0 C41 C40 sing Y N 211 JR0 C42 C41 doub Y N 212 JR0 C43 C42 sing Y N 213 JR0 C44 C43 doub Y N 214 JR0 N09 C08 sing Y N 215 JR0 C45 C08 sing Y N 216 JR0 C46 C45 doub Y N 217 JR0 C03 C46 sing Y N 218 JR0 C07 C11 sing Y N 219 JR0 N14 C19 sing N N 220 JR0 C22 C27 sing N N 221 JR0 C28 N34 sing Y N 222 JR0 C39 C44 sing Y N 223 JR0 C15 H151 sing N N 224 JR0 C15 H152 sing N N 225 JR0 C22 H221 sing N N 226 JR0 C24 H242 sing N N 227 JR0 C24 H241 sing N N 228 JR0 C26 H262 sing N N 229 JR0 C26 H261 sing N N 230 JR0 C01 H011 sing N N 231 JR0 C01 H012 sing N N 232 JR0 C01 H013 sing N N 233 JR0 C06 H061 sing N N 234 JR0 C06 H062 sing N N 235 JR0 C06 H063 sing N N 236 JR0 C11 H111 sing N N 237 JR0 C16 H161 sing N N 238 JR0 C16 H162 sing N N 239 JR0 C18 H182 sing N N 240 JR0 C18 H181 sing N N 241 JR0 C19 H191 sing N N 242 JR0 C19 H192 sing N N 243 JR0 C23 H231 sing N N 244 JR0 C23 H232 sing N N 245 JR0 C27 H272 sing N N 246 JR0 C27 H271 sing N N 247 JR0 C31 H313 sing N N 248 JR0 C31 H311 sing N N 249 JR0 C31 H312 sing N N 250 JR0 C32 H321 sing N N 251 JR0 C38 H381 sing N N 252 JR0 C38 H382 sing N N 253 JR0 C40 H401 sing N N 254 JR0 C41 H411 sing N N 255 JR0 C42 H421 sing N N 256 JR0 C43 H431 sing N N 257 JR0 C44 H441 sing N N 258 JR0 C45 H451 sing N N 259 JR0 C46 H461 sing N N 260 JR0 N09 H091 sing N N 261 JR0 N37 H371 sing N N 262 LEU N CA sing N N 263 LEU N H sing N N 264 LEU N H2 sing N N 265 LEU CA C sing N N 266 LEU CA CB sing N N 267 LEU CA HA sing N N 268 LEU C O doub N N 269 LEU C OXT sing N N 270 LEU CB CG sing N N 271 LEU CB HB2 sing N N 272 LEU CB HB3 sing N N 273 LEU CG CD1 sing N N 274 LEU CG CD2 sing N N 275 LEU CG HG sing N N 276 LEU CD1 HD11 sing N N 277 LEU CD1 HD12 sing N N 278 LEU CD1 HD13 sing N N 279 LEU CD2 HD21 sing N N 280 LEU CD2 HD22 sing N N 281 LEU CD2 HD23 sing N N 282 LEU OXT HXT sing N N 283 LYS N CA sing N N 284 LYS N H sing N N 285 LYS N H2 sing N N 286 LYS CA C sing N N 287 LYS CA CB sing N N 288 LYS CA HA sing N N 289 LYS C O doub N N 290 LYS C OXT sing N N 291 LYS CB CG sing N N 292 LYS CB HB2 sing N N 293 LYS CB HB3 sing N N 294 LYS CG CD sing N N 295 LYS CG HG2 sing N N 296 LYS CG HG3 sing N N 297 LYS CD CE sing N N 298 LYS CD HD2 sing N N 299 LYS CD HD3 sing N N 300 LYS CE NZ sing N N 301 LYS CE HE2 sing N N 302 LYS CE HE3 sing N N 303 LYS NZ HZ1 sing N N 304 LYS NZ HZ2 sing N N 305 LYS NZ HZ3 sing N N 306 LYS OXT HXT sing N N 307 MET N CA sing N N 308 MET N H sing N N 309 MET N H2 sing N N 310 MET CA C sing N N 311 MET CA CB sing N N 312 MET CA HA sing N N 313 MET C O doub N N 314 MET C OXT sing N N 315 MET CB CG sing N N 316 MET CB HB2 sing N N 317 MET CB HB3 sing N N 318 MET CG SD sing N N 319 MET CG HG2 sing N N 320 MET CG HG3 sing N N 321 MET SD CE sing N N 322 MET CE HE1 sing N N 323 MET CE HE2 sing N N 324 MET CE HE3 sing N N 325 MET OXT HXT sing N N 326 PHE N CA sing N N 327 PHE N H sing N N 328 PHE N H2 sing N N 329 PHE CA C sing N N 330 PHE CA CB sing N N 331 PHE CA HA sing N N 332 PHE C O doub N N 333 PHE C OXT sing N N 334 PHE CB CG sing N N 335 PHE CB HB2 sing N N 336 PHE CB HB3 sing N N 337 PHE CG CD1 doub Y N 338 PHE CG CD2 sing Y N 339 PHE CD1 CE1 sing Y N 340 PHE CD1 HD1 sing N N 341 PHE CD2 CE2 doub Y N 342 PHE CD2 HD2 sing N N 343 PHE CE1 CZ doub Y N 344 PHE CE1 HE1 sing N N 345 PHE CE2 CZ sing Y N 346 PHE CE2 HE2 sing N N 347 PHE CZ HZ sing N N 348 PHE OXT HXT sing N N 349 PRO N CA sing N N 350 PRO N CD sing N N 351 PRO N H sing N N 352 PRO CA C sing N N 353 PRO CA CB sing N N 354 PRO CA HA sing N N 355 PRO C O doub N N 356 PRO C OXT sing N N 357 PRO CB CG sing N N 358 PRO CB HB2 sing N N 359 PRO CB HB3 sing N N 360 PRO CG CD sing N N 361 PRO CG HG2 sing N N 362 PRO CG HG3 sing N N 363 PRO CD HD2 sing N N 364 PRO CD HD3 sing N N 365 PRO OXT HXT sing N N 366 SER N CA sing N N 367 SER N H sing N N 368 SER N H2 sing N N 369 SER CA C sing N N 370 SER CA CB sing N N 371 SER CA HA sing N N 372 SER C O doub N N 373 SER C OXT sing N N 374 SER CB OG sing N N 375 SER CB HB2 sing N N 376 SER CB HB3 sing N N 377 SER OG HG sing N N 378 SER OXT HXT sing N N 379 SO4 S O1 doub N N 380 SO4 S O2 doub N N 381 SO4 S O3 sing N N 382 SO4 S O4 sing N N 383 THR N CA sing N N 384 THR N H sing N N 385 THR N H2 sing N N 386 THR CA C sing N N 387 THR CA CB sing N N 388 THR CA HA sing N N 389 THR C O doub N N 390 THR C OXT sing N N 391 THR CB OG1 sing N N 392 THR CB CG2 sing N N 393 THR CB HB sing N N 394 THR OG1 HG1 sing N N 395 THR CG2 HG21 sing N N 396 THR CG2 HG22 sing N N 397 THR CG2 HG23 sing N N 398 THR OXT HXT sing N N 399 TRP N CA sing N N 400 TRP N H sing N N 401 TRP N H2 sing N N 402 TRP CA C sing N N 403 TRP CA CB sing N N 404 TRP CA HA sing N N 405 TRP C O doub N N 406 TRP C OXT sing N N 407 TRP CB CG sing N N 408 TRP CB HB2 sing N N 409 TRP CB HB3 sing N N 410 TRP CG CD1 doub Y N 411 TRP CG CD2 sing Y N 412 TRP CD1 NE1 sing Y N 413 TRP CD1 HD1 sing N N 414 TRP CD2 CE2 doub Y N 415 TRP CD2 CE3 sing Y N 416 TRP NE1 CE2 sing Y N 417 TRP NE1 HE1 sing N N 418 TRP CE2 CZ2 sing Y N 419 TRP CE3 CZ3 doub Y N 420 TRP CE3 HE3 sing N N 421 TRP CZ2 CH2 doub Y N 422 TRP CZ2 HZ2 sing N N 423 TRP CZ3 CH2 sing Y N 424 TRP CZ3 HZ3 sing N N 425 TRP CH2 HH2 sing N N 426 TRP OXT HXT sing N N 427 TYR N CA sing N N 428 TYR N H sing N N 429 TYR N H2 sing N N 430 TYR CA C sing N N 431 TYR CA CB sing N N 432 TYR CA HA sing N N 433 TYR C O doub N N 434 TYR C OXT sing N N 435 TYR CB CG sing N N 436 TYR CB HB2 sing N N 437 TYR CB HB3 sing N N 438 TYR CG CD1 doub Y N 439 TYR CG CD2 sing Y N 440 TYR CD1 CE1 sing Y N 441 TYR CD1 HD1 sing N N 442 TYR CD2 CE2 doub Y N 443 TYR CD2 HD2 sing N N 444 TYR CE1 CZ doub Y N 445 TYR CE1 HE1 sing N N 446 TYR CE2 CZ sing Y N 447 TYR CE2 HE2 sing N N 448 TYR CZ OH sing N N 449 TYR OH HH sing N N 450 TYR OXT HXT sing N N 451 VAL N CA sing N N 452 VAL N H sing N N 453 VAL N H2 sing N N 454 VAL CA C sing N N 455 VAL CA CB sing N N 456 VAL CA HA sing N N 457 VAL C O doub N N 458 VAL C OXT sing N N 459 VAL CB CG1 sing N N 460 VAL CB CG2 sing N N 461 VAL CB HB sing N N 462 VAL CG1 HG11 sing N N 463 VAL CG1 HG12 sing N N 464 VAL CG1 HG13 sing N N 465 VAL CG2 HG21 sing N N 466 VAL CG2 HG22 sing N N 467 VAL CG2 HG23 sing N N 468 VAL OXT HXT sing N N 469 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' P01AI095208 1 'Welch Foundation' 'United States' A-0015 2 'Bill & Melinda Gates Foundation' 'United States' INV-040487 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id JR0 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id JR0 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5V3Y _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8TQG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015009 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015009 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007695 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_