data_8TRE # _entry.id 8TRE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8TRE pdb_00008tre 10.2210/pdb8tre/pdb WWPDB D_1000276492 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-12-20 2 'Structure model' 1 1 2024-07-31 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_sf' # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2024-07-31 _pdbx_database_PDB_obs_spr.pdb_id 9BKR _pdbx_database_PDB_obs_spr.replace_pdb_id 8TRE _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8TRE _pdbx_database_status.recvd_initial_deposition_date 2023-08-09 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 1 _pdbx_contact_author.email l.halabelian@utoronto.ca _pdbx_contact_author.name_first Levon _pdbx_contact_author.name_last Halabelian _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4361-3619 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kimani, S.' 1 ? 'Dong, A.' 2 ? 'Li, Y.' 3 ? 'Arrowsmith, C.H.' 4 ? 'Edwards, A.M.' 5 ? 'Halabelian, L.' 6 ? 'Structural Genomics Consortium (SGC)' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ATP' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kimani, S.' 1 ? primary 'Dong, A.' 2 ? primary 'Li, Y.' 3 ? primary 'Arrowsmith, C.H.' 4 ? primary 'Edwards, A.M.' 5 ? primary 'Halabelian, L.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 2 of E3 ubiquitin-protein ligase TRIP12' 9090.911 1 2.3.2.26 ? 'WWE domain' ? 2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer nat 'UNKNOWN ATOM OR ION' 18.015 1 ? ? ? ? 4 water nat water 18.015 54 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;E3 ubiquitin-protein ligase for Arf,ULF,HECT-type E3 ubiquitin transferase TRIP12,Thyroid receptor-interacting protein 12,TR-interacting protein 12,TRIP-12 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAQNTDGAIWQWRDDRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANS _entity_poly.pdbx_seq_one_letter_code_can GAQNTDGAIWQWRDDRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 3 'UNKNOWN ATOM OR ION' UNX 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 GLN n 1 4 ASN n 1 5 THR n 1 6 ASP n 1 7 GLY n 1 8 ALA n 1 9 ILE n 1 10 TRP n 1 11 GLN n 1 12 TRP n 1 13 ARG n 1 14 ASP n 1 15 ASP n 1 16 ARG n 1 17 GLY n 1 18 LEU n 1 19 TRP n 1 20 HIS n 1 21 PRO n 1 22 TYR n 1 23 ASN n 1 24 ARG n 1 25 ILE n 1 26 ASP n 1 27 SER n 1 28 ARG n 1 29 ILE n 1 30 ILE n 1 31 GLU n 1 32 ALA n 1 33 ALA n 1 34 HIS n 1 35 GLN n 1 36 VAL n 1 37 GLY n 1 38 GLU n 1 39 ASP n 1 40 GLU n 1 41 ILE n 1 42 SER n 1 43 LEU n 1 44 SER n 1 45 THR n 1 46 LEU n 1 47 GLY n 1 48 ARG n 1 49 VAL n 1 50 TYR n 1 51 THR n 1 52 ILE n 1 53 ASP n 1 54 PHE n 1 55 ASN n 1 56 SER n 1 57 MET n 1 58 GLN n 1 59 GLN n 1 60 ILE n 1 61 ASN n 1 62 GLU n 1 63 ASP n 1 64 THR n 1 65 GLY n 1 66 THR n 1 67 ALA n 1 68 ARG n 1 69 ALA n 1 70 ILE n 1 71 GLN n 1 72 ARG n 1 73 LYS n 1 74 PRO n 1 75 ASN n 1 76 PRO n 1 77 LEU n 1 78 ALA n 1 79 ASN n 1 80 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 80 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TRIP12, KIAA0045, ULF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNX non-polymer . 'UNKNOWN ATOM OR ION' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 760 ? ? ? A . n A 1 2 ALA 2 761 ? ? ? A . n A 1 3 GLN 3 762 ? ? ? A . n A 1 4 ASN 4 763 ? ? ? A . n A 1 5 THR 5 764 ? ? ? A . n A 1 6 ASP 6 765 765 ASP ASP A . n A 1 7 GLY 7 766 766 GLY GLY A . n A 1 8 ALA 8 767 767 ALA ALA A . n A 1 9 ILE 9 768 768 ILE ILE A . n A 1 10 TRP 10 769 769 TRP TRP A . n A 1 11 GLN 11 770 770 GLN GLN A . n A 1 12 TRP 12 771 771 TRP TRP A . n A 1 13 ARG 13 772 772 ARG ARG A . n A 1 14 ASP 14 773 773 ASP ASP A . n A 1 15 ASP 15 774 774 ASP ASP A . n A 1 16 ARG 16 775 775 ARG ARG A . n A 1 17 GLY 17 776 776 GLY GLY A . n A 1 18 LEU 18 777 777 LEU LEU A . n A 1 19 TRP 19 778 778 TRP TRP A . n A 1 20 HIS 20 779 779 HIS HIS A . n A 1 21 PRO 21 780 780 PRO PRO A . n A 1 22 TYR 22 781 781 TYR TYR A . n A 1 23 ASN 23 782 782 ASN ASN A . n A 1 24 ARG 24 783 783 ARG ARG A . n A 1 25 ILE 25 784 784 ILE ILE A . n A 1 26 ASP 26 785 785 ASP ASP A . n A 1 27 SER 27 786 786 SER SER A . n A 1 28 ARG 28 787 787 ARG ARG A . n A 1 29 ILE 29 788 788 ILE ILE A . n A 1 30 ILE 30 789 789 ILE ILE A . n A 1 31 GLU 31 790 790 GLU GLU A . n A 1 32 ALA 32 791 791 ALA ALA A . n A 1 33 ALA 33 792 792 ALA ALA A . n A 1 34 HIS 34 793 793 HIS HIS A . n A 1 35 GLN 35 794 794 GLN GLN A . n A 1 36 VAL 36 795 795 VAL VAL A . n A 1 37 GLY 37 796 796 GLY GLY A . n A 1 38 GLU 38 797 797 GLU GLU A . n A 1 39 ASP 39 798 798 ASP ASP A . n A 1 40 GLU 40 799 799 GLU GLU A . n A 1 41 ILE 41 800 800 ILE ILE A . n A 1 42 SER 42 801 801 SER SER A . n A 1 43 LEU 43 802 802 LEU LEU A . n A 1 44 SER 44 803 803 SER SER A . n A 1 45 THR 45 804 804 THR THR A . n A 1 46 LEU 46 805 805 LEU LEU A . n A 1 47 GLY 47 806 806 GLY GLY A . n A 1 48 ARG 48 807 807 ARG ARG A . n A 1 49 VAL 49 808 808 VAL VAL A . n A 1 50 TYR 50 809 809 TYR TYR A . n A 1 51 THR 51 810 810 THR THR A . n A 1 52 ILE 52 811 811 ILE ILE A . n A 1 53 ASP 53 812 812 ASP ASP A . n A 1 54 PHE 54 813 813 PHE PHE A . n A 1 55 ASN 55 814 814 ASN ASN A . n A 1 56 SER 56 815 815 SER SER A . n A 1 57 MET 57 816 816 MET MET A . n A 1 58 GLN 58 817 817 GLN GLN A . n A 1 59 GLN 59 818 818 GLN GLN A . n A 1 60 ILE 60 819 819 ILE ILE A . n A 1 61 ASN 61 820 820 ASN ASN A . n A 1 62 GLU 62 821 821 GLU GLU A . n A 1 63 ASP 63 822 822 ASP ASP A . n A 1 64 THR 64 823 823 THR THR A . n A 1 65 GLY 65 824 824 GLY GLY A . n A 1 66 THR 66 825 825 THR THR A . n A 1 67 ALA 67 826 826 ALA ALA A . n A 1 68 ARG 68 827 827 ARG ARG A . n A 1 69 ALA 69 828 828 ALA ALA A . n A 1 70 ILE 70 829 829 ILE ILE A . n A 1 71 GLN 71 830 830 GLN GLN A . n A 1 72 ARG 72 831 831 ARG ARG A . n A 1 73 LYS 73 832 832 LYS LYS A . n A 1 74 PRO 74 833 833 PRO PRO A . n A 1 75 ASN 75 834 834 ASN ASN A . n A 1 76 PRO 76 835 835 PRO PRO A . n A 1 77 LEU 77 836 836 LEU LEU A . n A 1 78 ALA 78 837 837 ALA ALA A . n A 1 79 ASN 79 838 838 ASN ASN A . n A 1 80 SER 80 839 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ATP 1 1001 1001 ATP ATP A . C 3 UNX 1 1002 1001 UNX UNX A . D 4 HOH 1 1101 80 HOH HOH A . D 4 HOH 2 1102 22 HOH HOH A . D 4 HOH 3 1103 23 HOH HOH A . D 4 HOH 4 1104 62 HOH HOH A . D 4 HOH 5 1105 67 HOH HOH A . D 4 HOH 6 1106 38 HOH HOH A . D 4 HOH 7 1107 79 HOH HOH A . D 4 HOH 8 1108 81 HOH HOH A . D 4 HOH 9 1109 64 HOH HOH A . D 4 HOH 10 1110 47 HOH HOH A . D 4 HOH 11 1111 68 HOH HOH A . D 4 HOH 12 1112 24 HOH HOH A . D 4 HOH 13 1113 2 HOH HOH A . D 4 HOH 14 1114 72 HOH HOH A . D 4 HOH 15 1115 52 HOH HOH A . D 4 HOH 16 1116 9 HOH HOH A . D 4 HOH 17 1117 55 HOH HOH A . D 4 HOH 18 1118 32 HOH HOH A . D 4 HOH 19 1119 19 HOH HOH A . D 4 HOH 20 1120 40 HOH HOH A . D 4 HOH 21 1121 35 HOH HOH A . D 4 HOH 22 1122 7 HOH HOH A . D 4 HOH 23 1123 37 HOH HOH A . D 4 HOH 24 1124 42 HOH HOH A . D 4 HOH 25 1125 51 HOH HOH A . D 4 HOH 26 1126 25 HOH HOH A . D 4 HOH 27 1127 17 HOH HOH A . D 4 HOH 28 1128 50 HOH HOH A . D 4 HOH 29 1129 36 HOH HOH A . D 4 HOH 30 1130 15 HOH HOH A . D 4 HOH 31 1131 77 HOH HOH A . D 4 HOH 32 1132 13 HOH HOH A . D 4 HOH 33 1133 26 HOH HOH A . D 4 HOH 34 1134 56 HOH HOH A . D 4 HOH 35 1135 10 HOH HOH A . D 4 HOH 36 1136 71 HOH HOH A . D 4 HOH 37 1137 5 HOH HOH A . D 4 HOH 38 1138 20 HOH HOH A . D 4 HOH 39 1139 65 HOH HOH A . D 4 HOH 40 1140 84 HOH HOH A . D 4 HOH 41 1141 63 HOH HOH A . D 4 HOH 42 1142 45 HOH HOH A . D 4 HOH 43 1143 54 HOH HOH A . D 4 HOH 44 1144 75 HOH HOH A . D 4 HOH 45 1145 59 HOH HOH A . D 4 HOH 46 1146 49 HOH HOH A . D 4 HOH 47 1147 12 HOH HOH A . D 4 HOH 48 1148 39 HOH HOH A . D 4 HOH 49 1149 76 HOH HOH A . D 4 HOH 50 1150 83 HOH HOH A . D 4 HOH 51 1151 70 HOH HOH A . D 4 HOH 52 1152 74 HOH HOH A . D 4 HOH 53 1153 82 HOH HOH A . D 4 HOH 54 1154 33 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 794 ? CD ? A GLN 35 CD 2 1 Y 1 A GLN 794 ? OE1 ? A GLN 35 OE1 3 1 Y 1 A GLN 794 ? NE2 ? A GLN 35 NE2 4 1 Y 1 A ASN 838 ? CG ? A ASN 79 CG 5 1 Y 1 A ASN 838 ? OD1 ? A ASN 79 OD1 6 1 Y 1 A ASN 838 ? ND2 ? A ASN 79 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8TRE _cell.details ? _cell.formula_units_Z ? _cell.length_a 30.351 _cell.length_a_esd ? _cell.length_b 33.492 _cell.length_b_esd ? _cell.length_c 66.081 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8TRE _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8TRE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 33.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.2 M MgCl2, 0.1 M Tris pH 8.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-12-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8TRE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13611 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.632 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.134 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 166083 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.128 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.40 1.42 ? ? ? ? ? ? 525 ? ? ? ? ? ? ? ? ? ? ? 4.5 0.700 ? ? 0.843 0.407 ? 1 1 0.126 0.474 ? 78.2 ? 0.724 ? ? ? ? ? ? ? ? ? 1.42 1.45 ? ? ? ? ? ? 627 ? ? ? ? ? ? ? ? ? ? ? 5.9 0.633 ? ? 0.695 0.266 ? 2 1 0.858 0.961 ? 88.7 ? 0.637 ? ? ? ? ? ? ? ? ? 1.45 1.48 ? ? ? ? ? ? 632 ? ? ? ? ? ? ? ? ? ? ? 8.5 0.737 ? ? 0.630 0.201 ? 3 1 0.936 0.983 ? 96.9 ? 0.596 ? ? ? ? ? ? ? ? ? 1.48 1.51 ? ? ? ? ? ? 684 ? ? ? ? ? ? ? ? ? ? ? 10.2 0.718 ? ? 0.565 0.168 ? 4 1 0.965 0.991 ? 99.6 ? 0.538 ? ? ? ? ? ? ? ? ? 1.51 1.54 ? ? ? ? ? ? 677 ? ? ? ? ? ? ? ? ? ? ? 11.5 0.758 ? ? 0.551 0.160 ? 5 1 0.965 0.991 ? 100.0 ? 0.527 ? ? ? ? ? ? ? ? ? 1.54 1.58 ? ? ? ? ? ? 673 ? ? ? ? ? ? ? ? ? ? ? 13.0 0.768 ? ? 0.539 0.148 ? 6 1 0.978 0.994 ? 99.9 ? 0.517 ? ? ? ? ? ? ? ? ? 1.58 1.62 ? ? ? ? ? ? 690 ? ? ? ? ? ? ? ? ? ? ? 13.9 0.784 ? ? 0.547 0.147 ? 7 1 0.965 0.991 ? 99.7 ? 0.527 ? ? ? ? ? ? ? ? ? 1.62 1.66 ? ? ? ? ? ? 675 ? ? ? ? ? ? ? ? ? ? ? 14.9 0.826 ? ? 0.520 0.135 ? 8 1 0.983 0.996 ? 100.0 ? 0.501 ? ? ? ? ? ? ? ? ? 1.66 1.71 ? ? ? ? ? ? 677 ? ? ? ? ? ? ? ? ? ? ? 14.8 0.880 ? ? 0.458 0.121 ? 9 1 0.980 0.995 ? 99.9 ? 0.441 ? ? ? ? ? ? ? ? ? 1.71 1.76 ? ? ? ? ? ? 683 ? ? ? ? ? ? ? ? ? ? ? 14.2 1.013 ? ? 0.392 0.107 ? 10 1 0.968 0.992 ? 99.3 ? 0.377 ? ? ? ? ? ? ? ? ? 1.76 1.83 ? ? ? ? ? ? 676 ? ? ? ? ? ? ? ? ? ? ? 13.9 1.140 ? ? 0.326 0.089 ? 11 1 0.951 0.987 ? 99.1 ? 0.313 ? ? ? ? ? ? ? ? ? 1.83 1.90 ? ? ? ? ? ? 706 ? ? ? ? ? ? ? ? ? ? ? 15.2 1.335 ? ? 0.272 0.074 ? 12 1 0.980 0.995 ? 100.0 ? 0.262 ? ? ? ? ? ? ? ? ? 1.90 1.99 ? ? ? ? ? ? 678 ? ? ? ? ? ? ? ? ? ? ? 14.9 1.601 ? ? 0.249 0.069 ? 13 1 0.979 0.995 ? 100.0 ? 0.239 ? ? ? ? ? ? ? ? ? 1.99 2.09 ? ? ? ? ? ? 691 ? ? ? ? ? ? ? ? ? ? ? 13.8 1.863 ? ? 0.207 0.058 ? 14 1 0.981 0.995 ? 100.0 ? 0.198 ? ? ? ? ? ? ? ? ? 2.09 2.22 ? ? ? ? ? ? 698 ? ? ? ? ? ? ? ? ? ? ? 13.2 2.269 ? ? 0.188 0.055 ? 15 1 0.981 0.995 ? 99.4 ? 0.180 ? ? ? ? ? ? ? ? ? 2.22 2.39 ? ? ? ? ? ? 704 ? ? ? ? ? ? ? ? ? ? ? 12.0 2.638 ? ? 0.166 0.051 ? 16 1 0.983 0.996 ? 99.6 ? 0.157 ? ? ? ? ? ? ? ? ? 2.39 2.63 ? ? ? ? ? ? 688 ? ? ? ? ? ? ? ? ? ? ? 11.0 2.628 ? ? 0.142 0.046 ? 17 1 0.975 0.994 ? 98.9 ? 0.133 ? ? ? ? ? ? ? ? ? 2.63 3.02 ? ? ? ? ? ? 722 ? ? ? ? ? ? ? ? ? ? ? 12.8 3.293 ? ? 0.122 0.036 ? 18 1 0.992 0.998 ? 100.0 ? 0.117 ? ? ? ? ? ? ? ? ? 3.02 3.80 ? ? ? ? ? ? 726 ? ? ? ? ? ? ? ? ? ? ? 11.8 3.512 ? ? 0.101 0.030 ? 19 1 0.994 0.998 ? 99.9 ? 0.096 ? ? ? ? ? ? ? ? ? 3.80 50.00 ? ? ? ? ? ? 779 ? ? ? ? ? ? ? ? ? ? ? 11.5 3.140 ? ? 0.091 0.027 ? 20 1 0.994 0.999 ? 99.4 ? 0.087 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -1.89 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 1.27 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.61 _refine.B_iso_max ? _refine.B_iso_mean 20.355 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8TRE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.40 _refine.ls_d_res_low 33.04 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12941 _refine.ls_number_reflns_R_free 630 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.47 _refine.ls_percent_reflns_R_free 4.6 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19504 _refine.ls_R_factor_R_free 0.22762 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19339 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.077 _refine.pdbx_overall_ESU_R_Free 0.079 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.481 _refine.overall_SU_ML 0.058 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.40 _refine_hist.d_res_low 33.04 _refine_hist.number_atoms_solvent 54 _refine_hist.number_atoms_total 681 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 595 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.013 731 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.018 640 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.487 1.660 1009 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.368 1.590 1477 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.832 5.000 90 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 24.487 19.600 50 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.642 15.000 119 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.825 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.075 0.200 97 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 861 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 179 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.970 1.955 339 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.896 1.945 338 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.998 2.927 436 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.003 2.936 437 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.664 2.201 392 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.662 2.202 392 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.138 3.210 574 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.200 21.993 793 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.141 21.662 784 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.40 _refine_ls_shell.d_res_low 1.433 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_R_work 710 _refine_ls_shell.percent_reflns_obs 74.78 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.343 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.432 # _struct.entry_id 8TRE _struct.title 'Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ATP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8TRE _struct_keywords.text 'TRIP12, Isoform 2, WWE, SGC, TRANSPORT PROTEIN, Structural Genomics, PSI-Biology, Structural Genomics Consortium, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRIPC-2_HUMAN _struct_ref.pdbx_db_accession Q14669-2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AQNTDGAIWQWRDDRGLWHPYNRIDSRIIEAAHQVGEDEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANS _struct_ref.pdbx_align_begin 761 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8TRE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14669-2 _struct_ref_seq.db_align_beg 761 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 839 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 761 _struct_ref_seq.pdbx_auth_seq_align_end 839 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8TRE _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q14669-2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 760 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 23 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 36 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 782 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 795 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 19 ? PRO A 21 ? TRP A 778 PRO A 780 AA1 2 ALA A 8 ? ARG A 13 ? ALA A 767 ARG A 772 AA1 3 ALA A 67 ? PRO A 74 ? ALA A 826 PRO A 833 AA1 4 GLN A 58 ? ASN A 61 ? GLN A 817 ASN A 820 AA1 5 ARG A 48 ? ASP A 53 ? ARG A 807 ASP A 812 AA1 6 GLU A 40 ? THR A 45 ? GLU A 799 THR A 804 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 20 ? O HIS A 779 N TRP A 12 ? N TRP A 771 AA1 2 3 N ILE A 9 ? N ILE A 768 O LYS A 73 ? O LYS A 832 AA1 3 4 O ARG A 68 ? O ARG A 827 N GLN A 59 ? N GLN A 818 AA1 4 5 O ILE A 60 ? O ILE A 819 N THR A 51 ? N THR A 810 AA1 5 6 O TYR A 50 ? O TYR A 809 N LEU A 43 ? N LEU A 802 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # _pdbx_entry_details.entry_id 8TRE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 760 ? A GLY 1 2 1 Y 1 A ALA 761 ? A ALA 2 3 1 Y 1 A GLN 762 ? A GLN 3 4 1 Y 1 A ASN 763 ? A ASN 4 5 1 Y 1 A THR 764 ? A THR 5 6 1 Y 1 A SER 839 ? A SER 80 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 ATP PG P N N 74 ATP O1G O N N 75 ATP O2G O N N 76 ATP O3G O N N 77 ATP PB P N R 78 ATP O1B O N N 79 ATP O2B O N N 80 ATP O3B O N N 81 ATP PA P N R 82 ATP O1A O N N 83 ATP O2A O N N 84 ATP O3A O N N 85 ATP "O5'" O N N 86 ATP "C5'" C N N 87 ATP "C4'" C N R 88 ATP "O4'" O N N 89 ATP "C3'" C N S 90 ATP "O3'" O N N 91 ATP "C2'" C N R 92 ATP "O2'" O N N 93 ATP "C1'" C N R 94 ATP N9 N Y N 95 ATP C8 C Y N 96 ATP N7 N Y N 97 ATP C5 C Y N 98 ATP C6 C Y N 99 ATP N6 N N N 100 ATP N1 N Y N 101 ATP C2 C Y N 102 ATP N3 N Y N 103 ATP C4 C Y N 104 ATP HOG2 H N N 105 ATP HOG3 H N N 106 ATP HOB2 H N N 107 ATP HOA2 H N N 108 ATP "H5'1" H N N 109 ATP "H5'2" H N N 110 ATP "H4'" H N N 111 ATP "H3'" H N N 112 ATP "HO3'" H N N 113 ATP "H2'" H N N 114 ATP "HO2'" H N N 115 ATP "H1'" H N N 116 ATP H8 H N N 117 ATP HN61 H N N 118 ATP HN62 H N N 119 ATP H2 H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HIS N N N N 170 HIS CA C N S 171 HIS C C N N 172 HIS O O N N 173 HIS CB C N N 174 HIS CG C Y N 175 HIS ND1 N Y N 176 HIS CD2 C Y N 177 HIS CE1 C Y N 178 HIS NE2 N Y N 179 HIS OXT O N N 180 HIS H H N N 181 HIS H2 H N N 182 HIS HA H N N 183 HIS HB2 H N N 184 HIS HB3 H N N 185 HIS HD1 H N N 186 HIS HD2 H N N 187 HIS HE1 H N N 188 HIS HE2 H N N 189 HIS HXT H N N 190 HOH O O N N 191 HOH H1 H N N 192 HOH H2 H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 LEU N N N N 216 LEU CA C N S 217 LEU C C N N 218 LEU O O N N 219 LEU CB C N N 220 LEU CG C N N 221 LEU CD1 C N N 222 LEU CD2 C N N 223 LEU OXT O N N 224 LEU H H N N 225 LEU H2 H N N 226 LEU HA H N N 227 LEU HB2 H N N 228 LEU HB3 H N N 229 LEU HG H N N 230 LEU HD11 H N N 231 LEU HD12 H N N 232 LEU HD13 H N N 233 LEU HD21 H N N 234 LEU HD22 H N N 235 LEU HD23 H N N 236 LEU HXT H N N 237 LYS N N N N 238 LYS CA C N S 239 LYS C C N N 240 LYS O O N N 241 LYS CB C N N 242 LYS CG C N N 243 LYS CD C N N 244 LYS CE C N N 245 LYS NZ N N N 246 LYS OXT O N N 247 LYS H H N N 248 LYS H2 H N N 249 LYS HA H N N 250 LYS HB2 H N N 251 LYS HB3 H N N 252 LYS HG2 H N N 253 LYS HG3 H N N 254 LYS HD2 H N N 255 LYS HD3 H N N 256 LYS HE2 H N N 257 LYS HE3 H N N 258 LYS HZ1 H N N 259 LYS HZ2 H N N 260 LYS HZ3 H N N 261 LYS HXT H N N 262 MET N N N N 263 MET CA C N S 264 MET C C N N 265 MET O O N N 266 MET CB C N N 267 MET CG C N N 268 MET SD S N N 269 MET CE C N N 270 MET OXT O N N 271 MET H H N N 272 MET H2 H N N 273 MET HA H N N 274 MET HB2 H N N 275 MET HB3 H N N 276 MET HG2 H N N 277 MET HG3 H N N 278 MET HE1 H N N 279 MET HE2 H N N 280 MET HE3 H N N 281 MET HXT H N N 282 PHE N N N N 283 PHE CA C N S 284 PHE C C N N 285 PHE O O N N 286 PHE CB C N N 287 PHE CG C Y N 288 PHE CD1 C Y N 289 PHE CD2 C Y N 290 PHE CE1 C Y N 291 PHE CE2 C Y N 292 PHE CZ C Y N 293 PHE OXT O N N 294 PHE H H N N 295 PHE H2 H N N 296 PHE HA H N N 297 PHE HB2 H N N 298 PHE HB3 H N N 299 PHE HD1 H N N 300 PHE HD2 H N N 301 PHE HE1 H N N 302 PHE HE2 H N N 303 PHE HZ H N N 304 PHE HXT H N N 305 PRO N N N N 306 PRO CA C N S 307 PRO C C N N 308 PRO O O N N 309 PRO CB C N N 310 PRO CG C N N 311 PRO CD C N N 312 PRO OXT O N N 313 PRO H H N N 314 PRO HA H N N 315 PRO HB2 H N N 316 PRO HB3 H N N 317 PRO HG2 H N N 318 PRO HG3 H N N 319 PRO HD2 H N N 320 PRO HD3 H N N 321 PRO HXT H N N 322 SER N N N N 323 SER CA C N S 324 SER C C N N 325 SER O O N N 326 SER CB C N N 327 SER OG O N N 328 SER OXT O N N 329 SER H H N N 330 SER H2 H N N 331 SER HA H N N 332 SER HB2 H N N 333 SER HB3 H N N 334 SER HG H N N 335 SER HXT H N N 336 THR N N N N 337 THR CA C N S 338 THR C C N N 339 THR O O N N 340 THR CB C N R 341 THR OG1 O N N 342 THR CG2 C N N 343 THR OXT O N N 344 THR H H N N 345 THR H2 H N N 346 THR HA H N N 347 THR HB H N N 348 THR HG1 H N N 349 THR HG21 H N N 350 THR HG22 H N N 351 THR HG23 H N N 352 THR HXT H N N 353 TRP N N N N 354 TRP CA C N S 355 TRP C C N N 356 TRP O O N N 357 TRP CB C N N 358 TRP CG C Y N 359 TRP CD1 C Y N 360 TRP CD2 C Y N 361 TRP NE1 N Y N 362 TRP CE2 C Y N 363 TRP CE3 C Y N 364 TRP CZ2 C Y N 365 TRP CZ3 C Y N 366 TRP CH2 C Y N 367 TRP OXT O N N 368 TRP H H N N 369 TRP H2 H N N 370 TRP HA H N N 371 TRP HB2 H N N 372 TRP HB3 H N N 373 TRP HD1 H N N 374 TRP HE1 H N N 375 TRP HE3 H N N 376 TRP HZ2 H N N 377 TRP HZ3 H N N 378 TRP HH2 H N N 379 TRP HXT H N N 380 TYR N N N N 381 TYR CA C N S 382 TYR C C N N 383 TYR O O N N 384 TYR CB C N N 385 TYR CG C Y N 386 TYR CD1 C Y N 387 TYR CD2 C Y N 388 TYR CE1 C Y N 389 TYR CE2 C Y N 390 TYR CZ C Y N 391 TYR OH O N N 392 TYR OXT O N N 393 TYR H H N N 394 TYR H2 H N N 395 TYR HA H N N 396 TYR HB2 H N N 397 TYR HB3 H N N 398 TYR HD1 H N N 399 TYR HD2 H N N 400 TYR HE1 H N N 401 TYR HE2 H N N 402 TYR HH H N N 403 TYR HXT H N N 404 VAL N N N N 405 VAL CA C N S 406 VAL C C N N 407 VAL O O N N 408 VAL CB C N N 409 VAL CG1 C N N 410 VAL CG2 C N N 411 VAL OXT O N N 412 VAL H H N N 413 VAL H2 H N N 414 VAL HA H N N 415 VAL HB H N N 416 VAL HG11 H N N 417 VAL HG12 H N N 418 VAL HG13 H N N 419 VAL HG21 H N N 420 VAL HG22 H N N 421 VAL HG23 H N N 422 VAL HXT H N N 423 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 ATP PG O1G doub N N 70 ATP PG O2G sing N N 71 ATP PG O3G sing N N 72 ATP PG O3B sing N N 73 ATP O2G HOG2 sing N N 74 ATP O3G HOG3 sing N N 75 ATP PB O1B doub N N 76 ATP PB O2B sing N N 77 ATP PB O3B sing N N 78 ATP PB O3A sing N N 79 ATP O2B HOB2 sing N N 80 ATP PA O1A doub N N 81 ATP PA O2A sing N N 82 ATP PA O3A sing N N 83 ATP PA "O5'" sing N N 84 ATP O2A HOA2 sing N N 85 ATP "O5'" "C5'" sing N N 86 ATP "C5'" "C4'" sing N N 87 ATP "C5'" "H5'1" sing N N 88 ATP "C5'" "H5'2" sing N N 89 ATP "C4'" "O4'" sing N N 90 ATP "C4'" "C3'" sing N N 91 ATP "C4'" "H4'" sing N N 92 ATP "O4'" "C1'" sing N N 93 ATP "C3'" "O3'" sing N N 94 ATP "C3'" "C2'" sing N N 95 ATP "C3'" "H3'" sing N N 96 ATP "O3'" "HO3'" sing N N 97 ATP "C2'" "O2'" sing N N 98 ATP "C2'" "C1'" sing N N 99 ATP "C2'" "H2'" sing N N 100 ATP "O2'" "HO2'" sing N N 101 ATP "C1'" N9 sing N N 102 ATP "C1'" "H1'" sing N N 103 ATP N9 C8 sing Y N 104 ATP N9 C4 sing Y N 105 ATP C8 N7 doub Y N 106 ATP C8 H8 sing N N 107 ATP N7 C5 sing Y N 108 ATP C5 C6 sing Y N 109 ATP C5 C4 doub Y N 110 ATP C6 N6 sing N N 111 ATP C6 N1 doub Y N 112 ATP N6 HN61 sing N N 113 ATP N6 HN62 sing N N 114 ATP N1 C2 sing Y N 115 ATP C2 N3 doub Y N 116 ATP C2 H2 sing N N 117 ATP N3 C4 sing Y N 118 GLN N CA sing N N 119 GLN N H sing N N 120 GLN N H2 sing N N 121 GLN CA C sing N N 122 GLN CA CB sing N N 123 GLN CA HA sing N N 124 GLN C O doub N N 125 GLN C OXT sing N N 126 GLN CB CG sing N N 127 GLN CB HB2 sing N N 128 GLN CB HB3 sing N N 129 GLN CG CD sing N N 130 GLN CG HG2 sing N N 131 GLN CG HG3 sing N N 132 GLN CD OE1 doub N N 133 GLN CD NE2 sing N N 134 GLN NE2 HE21 sing N N 135 GLN NE2 HE22 sing N N 136 GLN OXT HXT sing N N 137 GLU N CA sing N N 138 GLU N H sing N N 139 GLU N H2 sing N N 140 GLU CA C sing N N 141 GLU CA CB sing N N 142 GLU CA HA sing N N 143 GLU C O doub N N 144 GLU C OXT sing N N 145 GLU CB CG sing N N 146 GLU CB HB2 sing N N 147 GLU CB HB3 sing N N 148 GLU CG CD sing N N 149 GLU CG HG2 sing N N 150 GLU CG HG3 sing N N 151 GLU CD OE1 doub N N 152 GLU CD OE2 sing N N 153 GLU OE2 HE2 sing N N 154 GLU OXT HXT sing N N 155 GLY N CA sing N N 156 GLY N H sing N N 157 GLY N H2 sing N N 158 GLY CA C sing N N 159 GLY CA HA2 sing N N 160 GLY CA HA3 sing N N 161 GLY C O doub N N 162 GLY C OXT sing N N 163 GLY OXT HXT sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 HOH O H1 sing N N 186 HOH O H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ATP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ATP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6MIW _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 8TRE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.032948 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029858 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015133 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S X # loop_