data_8TU5 # _entry.id 8TU5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8TU5 pdb_00008tu5 10.2210/pdb8tu5/pdb WWPDB D_1000276647 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-06-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8TU5 _pdbx_database_status.recvd_initial_deposition_date 2023-08-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 8TU3 unspecified PDB . 8TU4 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email claire.metrick@biogen.com _pdbx_contact_author.name_first Claire _pdbx_contact_author.name_last Metrick _pdbx_contact_author.name_mi M _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8660-5665 # _audit_author.name 'Metrick, C.M.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0001-8660-5665 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 8122 _citation.page_last 8140 _citation.title ;Discovery and Preclinical Characterization of BIIB129, a Covalent, Selective, and Brain-Penetrant BTK Inhibitor for the Treatment of Multiple Sclerosis. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c00220 _citation.pdbx_database_id_PubMed 38712838 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Himmelbauer, M.K.' 1 0000-0003-4960-4457 primary 'Bajrami, B.' 2 ? primary 'Basile, R.' 3 ? primary 'Capacci, A.' 4 ? primary 'Chen, T.' 5 ? primary 'Choi, C.K.' 6 ? primary 'Gilfillan, R.' 7 ? primary 'Gonzalez-Lopez de Turiso, F.' 8 ? primary 'Gu, C.' 9 ? primary 'Hoemberger, M.' 10 ? primary 'Johnson, D.S.' 11 ? primary 'Jones, J.H.' 12 ? primary 'Kadakia, E.' 13 ? primary 'Kirkland, M.' 14 ? primary 'Lin, E.Y.' 15 ? primary 'Liu, Y.' 16 ? primary 'Ma, B.' 17 0000-0002-3913-0545 primary 'Magee, T.' 18 ? primary 'Mantena, S.' 19 ? primary 'Marx, I.E.' 20 ? primary 'Metrick, C.M.' 21 ? primary 'Mingueneau, M.' 22 ? primary 'Murugan, P.' 23 ? primary 'Muste, C.A.' 24 0000-0002-9246-8449 primary 'Nadella, P.' 25 ? primary 'Nevalainen, M.' 26 ? primary 'Parker Harp, C.R.' 27 ? primary 'Pattaropong, V.' 28 ? primary 'Pietrasiewicz, A.' 29 ? primary 'Prince, R.J.' 30 ? primary 'Purgett, T.J.' 31 ? primary 'Santoro, J.C.' 32 ? primary 'Schulz, J.' 33 ? primary 'Sciabola, S.' 34 0000-0003-1448-3608 primary 'Tang, H.' 35 ? primary 'Vandeveer, H.G.' 36 ? primary 'Wang, T.' 37 ? primary 'Yousaf, Z.' 38 ? primary 'Helal, C.J.' 39 ? primary 'Hopkins, B.T.' 40 0000-0002-2912-9954 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein kinase BTK' 32680.471 1 2.7.10.2 ? 'Protein kinase domain residues 382-659' ? 2 non-polymer syn ;1-[(1S,5S,6S)-6-methyl-6-{[(6M,8R)-6-(1-methyl-1H-pyrazol-4-yl)pyrazolo[1,5-a]pyrazin-4-yl]oxy}-2-azabicyclo[3.2.0]heptan-2-yl]propan-1-one ; 380.444 1 ? ? ? ? 3 water nat water 18.015 35 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Agammaglobulinemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bruton tyrosine kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEK LVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVK VSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRL YRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEK LVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVK VSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRL YRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;1-[(1S,5S,6S)-6-methyl-6-{[(6M,8R)-6-(1-methyl-1H-pyrazol-4-yl)pyrazolo[1,5-a]pyrazin-4-yl]oxy}-2-azabicyclo[3.2.0]heptan-2-yl]propan-1-one ; V7I 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 LYS n 1 7 ASN n 1 8 ALA n 1 9 PRO n 1 10 SER n 1 11 THR n 1 12 ALA n 1 13 GLY n 1 14 LEU n 1 15 GLY n 1 16 TYR n 1 17 GLY n 1 18 SER n 1 19 TRP n 1 20 GLU n 1 21 ILE n 1 22 ASP n 1 23 PRO n 1 24 LYS n 1 25 ASP n 1 26 LEU n 1 27 THR n 1 28 PHE n 1 29 LEU n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 GLY n 1 36 GLN n 1 37 PHE n 1 38 GLY n 1 39 VAL n 1 40 VAL n 1 41 LYS n 1 42 TYR n 1 43 GLY n 1 44 LYS n 1 45 TRP n 1 46 ARG n 1 47 GLY n 1 48 GLN n 1 49 TYR n 1 50 ASP n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 LYS n 1 55 MET n 1 56 ILE n 1 57 LYS n 1 58 GLU n 1 59 GLY n 1 60 SER n 1 61 MET n 1 62 SER n 1 63 GLU n 1 64 ASP n 1 65 GLU n 1 66 PHE n 1 67 ILE n 1 68 GLU n 1 69 GLU n 1 70 ALA n 1 71 LYS n 1 72 VAL n 1 73 MET n 1 74 MET n 1 75 ASN n 1 76 LEU n 1 77 SER n 1 78 HIS n 1 79 GLU n 1 80 LYS n 1 81 LEU n 1 82 VAL n 1 83 GLN n 1 84 LEU n 1 85 TYR n 1 86 GLY n 1 87 VAL n 1 88 CYS n 1 89 THR n 1 90 LYS n 1 91 GLN n 1 92 ARG n 1 93 PRO n 1 94 ILE n 1 95 PHE n 1 96 ILE n 1 97 ILE n 1 98 THR n 1 99 GLU n 1 100 TYR n 1 101 MET n 1 102 ALA n 1 103 ASN n 1 104 GLY n 1 105 CYS n 1 106 LEU n 1 107 LEU n 1 108 ASN n 1 109 TYR n 1 110 LEU n 1 111 ARG n 1 112 GLU n 1 113 MET n 1 114 ARG n 1 115 HIS n 1 116 ARG n 1 117 PHE n 1 118 GLN n 1 119 THR n 1 120 GLN n 1 121 GLN n 1 122 LEU n 1 123 LEU n 1 124 GLU n 1 125 MET n 1 126 CYS n 1 127 LYS n 1 128 ASP n 1 129 VAL n 1 130 CYS n 1 131 GLU n 1 132 ALA n 1 133 MET n 1 134 GLU n 1 135 TYR n 1 136 LEU n 1 137 GLU n 1 138 SER n 1 139 LYS n 1 140 GLN n 1 141 PHE n 1 142 LEU n 1 143 HIS n 1 144 ARG n 1 145 ASP n 1 146 LEU n 1 147 ALA n 1 148 ALA n 1 149 ARG n 1 150 ASN n 1 151 CYS n 1 152 LEU n 1 153 VAL n 1 154 ASN n 1 155 ASP n 1 156 GLN n 1 157 GLY n 1 158 VAL n 1 159 VAL n 1 160 LYS n 1 161 VAL n 1 162 SER n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 LEU n 1 167 SER n 1 168 ARG n 1 169 TYR n 1 170 VAL n 1 171 LEU n 1 172 ASP n 1 173 ASP n 1 174 GLU n 1 175 TYR n 1 176 THR n 1 177 SER n 1 178 SER n 1 179 VAL n 1 180 GLY n 1 181 SER n 1 182 LYS n 1 183 PHE n 1 184 PRO n 1 185 VAL n 1 186 ARG n 1 187 TRP n 1 188 SER n 1 189 PRO n 1 190 PRO n 1 191 GLU n 1 192 VAL n 1 193 LEU n 1 194 MET n 1 195 TYR n 1 196 SER n 1 197 LYS n 1 198 PHE n 1 199 SER n 1 200 SER n 1 201 LYS n 1 202 SER n 1 203 ASP n 1 204 ILE n 1 205 TRP n 1 206 ALA n 1 207 PHE n 1 208 GLY n 1 209 VAL n 1 210 LEU n 1 211 MET n 1 212 TRP n 1 213 GLU n 1 214 ILE n 1 215 TYR n 1 216 SER n 1 217 LEU n 1 218 GLY n 1 219 LYS n 1 220 MET n 1 221 PRO n 1 222 TYR n 1 223 GLU n 1 224 ARG n 1 225 PHE n 1 226 THR n 1 227 ASN n 1 228 SER n 1 229 GLU n 1 230 THR n 1 231 ALA n 1 232 GLU n 1 233 HIS n 1 234 ILE n 1 235 ALA n 1 236 GLN n 1 237 GLY n 1 238 LEU n 1 239 ARG n 1 240 LEU n 1 241 TYR n 1 242 ARG n 1 243 PRO n 1 244 HIS n 1 245 LEU n 1 246 ALA n 1 247 SER n 1 248 GLU n 1 249 LYS n 1 250 VAL n 1 251 TYR n 1 252 THR n 1 253 ILE n 1 254 MET n 1 255 TYR n 1 256 SER n 1 257 CYS n 1 258 TRP n 1 259 HIS n 1 260 GLU n 1 261 LYS n 1 262 ALA n 1 263 ASP n 1 264 GLU n 1 265 ARG n 1 266 PRO n 1 267 THR n 1 268 PHE n 1 269 LYS n 1 270 ILE n 1 271 LEU n 1 272 LEU n 1 273 SER n 1 274 ASN n 1 275 ILE n 1 276 LEU n 1 277 ASP n 1 278 VAL n 1 279 MET n 1 280 ASP n 1 281 GLU n 1 282 GLU n 1 283 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 283 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BTK, AGMX1, ATK, BPK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 V7I non-polymer . ;1-[(1S,5S,6S)-6-methyl-6-{[(6M,8R)-6-(1-methyl-1H-pyrazol-4-yl)pyrazolo[1,5-a]pyrazin-4-yl]oxy}-2-azabicyclo[3.2.0]heptan-2-yl]propan-1-one ; ? 'C20 H24 N6 O2' 380.444 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 377 ? ? ? A . n A 1 2 PRO 2 378 ? ? ? A . n A 1 3 LEU 3 379 ? ? ? A . n A 1 4 GLY 4 380 ? ? ? A . n A 1 5 SER 5 381 ? ? ? A . n A 1 6 LYS 6 382 ? ? ? A . n A 1 7 ASN 7 383 ? ? ? A . n A 1 8 ALA 8 384 ? ? ? A . n A 1 9 PRO 9 385 ? ? ? A . n A 1 10 SER 10 386 ? ? ? A . n A 1 11 THR 11 387 ? ? ? A . n A 1 12 ALA 12 388 ? ? ? A . n A 1 13 GLY 13 389 ? ? ? A . n A 1 14 LEU 14 390 ? ? ? A . n A 1 15 GLY 15 391 ? ? ? A . n A 1 16 TYR 16 392 ? ? ? A . n A 1 17 GLY 17 393 ? ? ? A . n A 1 18 SER 18 394 ? ? ? A . n A 1 19 TRP 19 395 395 TRP TRP A . n A 1 20 GLU 20 396 396 GLU GLU A . n A 1 21 ILE 21 397 397 ILE ILE A . n A 1 22 ASP 22 398 398 ASP ASP A . n A 1 23 PRO 23 399 399 PRO PRO A . n A 1 24 LYS 24 400 400 LYS LYS A . n A 1 25 ASP 25 401 401 ASP ASP A . n A 1 26 LEU 26 402 402 LEU LEU A . n A 1 27 THR 27 403 403 THR THR A . n A 1 28 PHE 28 404 404 PHE PHE A . n A 1 29 LEU 29 405 405 LEU LEU A . n A 1 30 LYS 30 406 406 LYS LYS A . n A 1 31 GLU 31 407 407 GLU GLU A . n A 1 32 LEU 32 408 408 LEU LEU A . n A 1 33 GLY 33 409 409 GLY GLY A . n A 1 34 THR 34 410 410 THR THR A . n A 1 35 GLY 35 411 411 GLY GLY A . n A 1 36 GLN 36 412 412 GLN GLN A . n A 1 37 PHE 37 413 413 PHE PHE A . n A 1 38 GLY 38 414 414 GLY GLY A . n A 1 39 VAL 39 415 415 VAL VAL A . n A 1 40 VAL 40 416 416 VAL VAL A . n A 1 41 LYS 41 417 417 LYS LYS A . n A 1 42 TYR 42 418 418 TYR TYR A . n A 1 43 GLY 43 419 419 GLY GLY A . n A 1 44 LYS 44 420 420 LYS LYS A . n A 1 45 TRP 45 421 421 TRP TRP A . n A 1 46 ARG 46 422 422 ARG ARG A . n A 1 47 GLY 47 423 423 GLY GLY A . n A 1 48 GLN 48 424 424 GLN GLN A . n A 1 49 TYR 49 425 425 TYR TYR A . n A 1 50 ASP 50 426 426 ASP ASP A . n A 1 51 VAL 51 427 427 VAL VAL A . n A 1 52 ALA 52 428 428 ALA ALA A . n A 1 53 ILE 53 429 429 ILE ILE A . n A 1 54 LYS 54 430 430 LYS LYS A . n A 1 55 MET 55 431 431 MET MET A . n A 1 56 ILE 56 432 432 ILE ILE A . n A 1 57 LYS 57 433 433 LYS LYS A . n A 1 58 GLU 58 434 434 GLU GLU A . n A 1 59 GLY 59 435 435 GLY GLY A . n A 1 60 SER 60 436 436 SER SER A . n A 1 61 MET 61 437 437 MET MET A . n A 1 62 SER 62 438 438 SER SER A . n A 1 63 GLU 63 439 439 GLU GLU A . n A 1 64 ASP 64 440 440 ASP ASP A . n A 1 65 GLU 65 441 441 GLU GLU A . n A 1 66 PHE 66 442 442 PHE PHE A . n A 1 67 ILE 67 443 443 ILE ILE A . n A 1 68 GLU 68 444 444 GLU GLU A . n A 1 69 GLU 69 445 445 GLU GLU A . n A 1 70 ALA 70 446 446 ALA ALA A . n A 1 71 LYS 71 447 447 LYS LYS A . n A 1 72 VAL 72 448 448 VAL VAL A . n A 1 73 MET 73 449 449 MET MET A . n A 1 74 MET 74 450 450 MET MET A . n A 1 75 ASN 75 451 451 ASN ASN A . n A 1 76 LEU 76 452 452 LEU LEU A . n A 1 77 SER 77 453 453 SER SER A . n A 1 78 HIS 78 454 454 HIS HIS A . n A 1 79 GLU 79 455 455 GLU GLU A . n A 1 80 LYS 80 456 456 LYS LYS A . n A 1 81 LEU 81 457 457 LEU LEU A . n A 1 82 VAL 82 458 458 VAL VAL A . n A 1 83 GLN 83 459 459 GLN GLN A . n A 1 84 LEU 84 460 460 LEU LEU A . n A 1 85 TYR 85 461 461 TYR TYR A . n A 1 86 GLY 86 462 462 GLY GLY A . n A 1 87 VAL 87 463 463 VAL VAL A . n A 1 88 CYS 88 464 464 CYS CYS A . n A 1 89 THR 89 465 465 THR THR A . n A 1 90 LYS 90 466 466 LYS LYS A . n A 1 91 GLN 91 467 467 GLN GLN A . n A 1 92 ARG 92 468 468 ARG ARG A . n A 1 93 PRO 93 469 469 PRO PRO A . n A 1 94 ILE 94 470 470 ILE ILE A . n A 1 95 PHE 95 471 471 PHE PHE A . n A 1 96 ILE 96 472 472 ILE ILE A . n A 1 97 ILE 97 473 473 ILE ILE A . n A 1 98 THR 98 474 474 THR THR A . n A 1 99 GLU 99 475 475 GLU GLU A . n A 1 100 TYR 100 476 476 TYR TYR A . n A 1 101 MET 101 477 477 MET MET A . n A 1 102 ALA 102 478 478 ALA ALA A . n A 1 103 ASN 103 479 479 ASN ASN A . n A 1 104 GLY 104 480 480 GLY GLY A . n A 1 105 CYS 105 481 481 CYS CYS A . n A 1 106 LEU 106 482 482 LEU LEU A . n A 1 107 LEU 107 483 483 LEU LEU A . n A 1 108 ASN 108 484 484 ASN ASN A . n A 1 109 TYR 109 485 485 TYR TYR A . n A 1 110 LEU 110 486 486 LEU LEU A . n A 1 111 ARG 111 487 487 ARG ARG A . n A 1 112 GLU 112 488 488 GLU GLU A . n A 1 113 MET 113 489 489 MET MET A . n A 1 114 ARG 114 490 490 ARG ARG A . n A 1 115 HIS 115 491 491 HIS HIS A . n A 1 116 ARG 116 492 492 ARG ARG A . n A 1 117 PHE 117 493 493 PHE PHE A . n A 1 118 GLN 118 494 494 GLN GLN A . n A 1 119 THR 119 495 495 THR THR A . n A 1 120 GLN 120 496 496 GLN GLN A . n A 1 121 GLN 121 497 497 GLN GLN A . n A 1 122 LEU 122 498 498 LEU LEU A . n A 1 123 LEU 123 499 499 LEU LEU A . n A 1 124 GLU 124 500 500 GLU GLU A . n A 1 125 MET 125 501 501 MET MET A . n A 1 126 CYS 126 502 502 CYS CYS A . n A 1 127 LYS 127 503 503 LYS LYS A . n A 1 128 ASP 128 504 504 ASP ASP A . n A 1 129 VAL 129 505 505 VAL VAL A . n A 1 130 CYS 130 506 506 CYS CYS A . n A 1 131 GLU 131 507 507 GLU GLU A . n A 1 132 ALA 132 508 508 ALA ALA A . n A 1 133 MET 133 509 509 MET MET A . n A 1 134 GLU 134 510 510 GLU GLU A . n A 1 135 TYR 135 511 511 TYR TYR A . n A 1 136 LEU 136 512 512 LEU LEU A . n A 1 137 GLU 137 513 513 GLU GLU A . n A 1 138 SER 138 514 514 SER SER A . n A 1 139 LYS 139 515 515 LYS LYS A . n A 1 140 GLN 140 516 516 GLN GLN A . n A 1 141 PHE 141 517 517 PHE PHE A . n A 1 142 LEU 142 518 518 LEU LEU A . n A 1 143 HIS 143 519 519 HIS HIS A . n A 1 144 ARG 144 520 520 ARG ARG A . n A 1 145 ASP 145 521 521 ASP ASP A . n A 1 146 LEU 146 522 522 LEU LEU A . n A 1 147 ALA 147 523 523 ALA ALA A . n A 1 148 ALA 148 524 524 ALA ALA A . n A 1 149 ARG 149 525 525 ARG ARG A . n A 1 150 ASN 150 526 526 ASN ASN A . n A 1 151 CYS 151 527 527 CYS CYS A . n A 1 152 LEU 152 528 528 LEU LEU A . n A 1 153 VAL 153 529 529 VAL VAL A . n A 1 154 ASN 154 530 530 ASN ASN A . n A 1 155 ASP 155 531 531 ASP ASP A . n A 1 156 GLN 156 532 532 GLN GLN A . n A 1 157 GLY 157 533 533 GLY GLY A . n A 1 158 VAL 158 534 534 VAL VAL A . n A 1 159 VAL 159 535 535 VAL VAL A . n A 1 160 LYS 160 536 536 LYS LYS A . n A 1 161 VAL 161 537 537 VAL VAL A . n A 1 162 SER 162 538 538 SER SER A . n A 1 163 ASP 163 539 539 ASP ASP A . n A 1 164 PHE 164 540 540 PHE PHE A . n A 1 165 GLY 165 541 541 GLY GLY A . n A 1 166 LEU 166 542 542 LEU LEU A . n A 1 167 SER 167 543 543 SER SER A . n A 1 168 ARG 168 544 544 ARG ARG A . n A 1 169 TYR 169 545 545 TYR TYR A . n A 1 170 VAL 170 546 546 VAL VAL A . n A 1 171 LEU 171 547 547 LEU LEU A . n A 1 172 ASP 172 548 548 ASP ASP A . n A 1 173 ASP 173 549 549 ASP ASP A . n A 1 174 GLU 174 550 550 GLU GLU A . n A 1 175 TYR 175 551 551 TYR TYR A . n A 1 176 THR 176 552 ? ? ? A . n A 1 177 SER 177 553 ? ? ? A . n A 1 178 SER 178 554 ? ? ? A . n A 1 179 VAL 179 555 ? ? ? A . n A 1 180 GLY 180 556 ? ? ? A . n A 1 181 SER 181 557 ? ? ? A . n A 1 182 LYS 182 558 ? ? ? A . n A 1 183 PHE 183 559 559 PHE PHE A . n A 1 184 PRO 184 560 560 PRO PRO A . n A 1 185 VAL 185 561 561 VAL VAL A . n A 1 186 ARG 186 562 562 ARG ARG A . n A 1 187 TRP 187 563 563 TRP TRP A . n A 1 188 SER 188 564 564 SER SER A . n A 1 189 PRO 189 565 565 PRO PRO A . n A 1 190 PRO 190 566 566 PRO PRO A . n A 1 191 GLU 191 567 567 GLU GLU A . n A 1 192 VAL 192 568 568 VAL VAL A . n A 1 193 LEU 193 569 569 LEU LEU A . n A 1 194 MET 194 570 570 MET MET A . n A 1 195 TYR 195 571 571 TYR TYR A . n A 1 196 SER 196 572 572 SER SER A . n A 1 197 LYS 197 573 573 LYS LYS A . n A 1 198 PHE 198 574 574 PHE PHE A . n A 1 199 SER 199 575 575 SER SER A . n A 1 200 SER 200 576 576 SER SER A . n A 1 201 LYS 201 577 577 LYS LYS A . n A 1 202 SER 202 578 578 SER SER A . n A 1 203 ASP 203 579 579 ASP ASP A . n A 1 204 ILE 204 580 580 ILE ILE A . n A 1 205 TRP 205 581 581 TRP TRP A . n A 1 206 ALA 206 582 582 ALA ALA A . n A 1 207 PHE 207 583 583 PHE PHE A . n A 1 208 GLY 208 584 584 GLY GLY A . n A 1 209 VAL 209 585 585 VAL VAL A . n A 1 210 LEU 210 586 586 LEU LEU A . n A 1 211 MET 211 587 587 MET MET A . n A 1 212 TRP 212 588 588 TRP TRP A . n A 1 213 GLU 213 589 589 GLU GLU A . n A 1 214 ILE 214 590 590 ILE ILE A . n A 1 215 TYR 215 591 591 TYR TYR A . n A 1 216 SER 216 592 592 SER SER A . n A 1 217 LEU 217 593 593 LEU LEU A . n A 1 218 GLY 218 594 594 GLY GLY A . n A 1 219 LYS 219 595 595 LYS LYS A . n A 1 220 MET 220 596 596 MET MET A . n A 1 221 PRO 221 597 597 PRO PRO A . n A 1 222 TYR 222 598 598 TYR TYR A . n A 1 223 GLU 223 599 599 GLU GLU A . n A 1 224 ARG 224 600 600 ARG ARG A . n A 1 225 PHE 225 601 601 PHE PHE A . n A 1 226 THR 226 602 602 THR THR A . n A 1 227 ASN 227 603 603 ASN ASN A . n A 1 228 SER 228 604 604 SER SER A . n A 1 229 GLU 229 605 605 GLU GLU A . n A 1 230 THR 230 606 606 THR THR A . n A 1 231 ALA 231 607 607 ALA ALA A . n A 1 232 GLU 232 608 608 GLU GLU A . n A 1 233 HIS 233 609 609 HIS HIS A . n A 1 234 ILE 234 610 610 ILE ILE A . n A 1 235 ALA 235 611 611 ALA ALA A . n A 1 236 GLN 236 612 612 GLN GLN A . n A 1 237 GLY 237 613 613 GLY GLY A . n A 1 238 LEU 238 614 614 LEU LEU A . n A 1 239 ARG 239 615 615 ARG ARG A . n A 1 240 LEU 240 616 616 LEU LEU A . n A 1 241 TYR 241 617 617 TYR TYR A . n A 1 242 ARG 242 618 618 ARG ARG A . n A 1 243 PRO 243 619 619 PRO PRO A . n A 1 244 HIS 244 620 620 HIS HIS A . n A 1 245 LEU 245 621 621 LEU LEU A . n A 1 246 ALA 246 622 622 ALA ALA A . n A 1 247 SER 247 623 623 SER SER A . n A 1 248 GLU 248 624 624 GLU GLU A . n A 1 249 LYS 249 625 625 LYS LYS A . n A 1 250 VAL 250 626 626 VAL VAL A . n A 1 251 TYR 251 627 627 TYR TYR A . n A 1 252 THR 252 628 628 THR THR A . n A 1 253 ILE 253 629 629 ILE ILE A . n A 1 254 MET 254 630 630 MET MET A . n A 1 255 TYR 255 631 631 TYR TYR A . n A 1 256 SER 256 632 632 SER SER A . n A 1 257 CYS 257 633 633 CYS CYS A . n A 1 258 TRP 258 634 634 TRP TRP A . n A 1 259 HIS 259 635 635 HIS HIS A . n A 1 260 GLU 260 636 636 GLU GLU A . n A 1 261 LYS 261 637 637 LYS LYS A . n A 1 262 ALA 262 638 638 ALA ALA A . n A 1 263 ASP 263 639 639 ASP ASP A . n A 1 264 GLU 264 640 640 GLU GLU A . n A 1 265 ARG 265 641 641 ARG ARG A . n A 1 266 PRO 266 642 642 PRO PRO A . n A 1 267 THR 267 643 643 THR THR A . n A 1 268 PHE 268 644 644 PHE PHE A . n A 1 269 LYS 269 645 645 LYS LYS A . n A 1 270 ILE 270 646 646 ILE ILE A . n A 1 271 LEU 271 647 647 LEU LEU A . n A 1 272 LEU 272 648 648 LEU LEU A . n A 1 273 SER 273 649 649 SER SER A . n A 1 274 ASN 274 650 650 ASN ASN A . n A 1 275 ILE 275 651 651 ILE ILE A . n A 1 276 LEU 276 652 652 LEU LEU A . n A 1 277 ASP 277 653 653 ASP ASP A . n A 1 278 VAL 278 654 654 VAL VAL A . n A 1 279 MET 279 655 655 MET MET A . n A 1 280 ASP 280 656 656 ASP ASP A . n A 1 281 GLU 281 657 657 GLU GLU A . n A 1 282 GLU 282 658 ? ? ? A . n A 1 283 SER 283 659 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 V7I 1 701 701 V7I LIG A . C 3 HOH 1 801 10 HOH HOH A . C 3 HOH 2 802 16 HOH HOH A . C 3 HOH 3 803 13 HOH HOH A . C 3 HOH 4 804 20 HOH HOH A . C 3 HOH 5 805 25 HOH HOH A . C 3 HOH 6 806 28 HOH HOH A . C 3 HOH 7 807 9 HOH HOH A . C 3 HOH 8 808 31 HOH HOH A . C 3 HOH 9 809 21 HOH HOH A . C 3 HOH 10 810 4 HOH HOH A . C 3 HOH 11 811 2 HOH HOH A . C 3 HOH 12 812 22 HOH HOH A . C 3 HOH 13 813 3 HOH HOH A . C 3 HOH 14 814 36 HOH HOH A . C 3 HOH 15 815 23 HOH HOH A . C 3 HOH 16 816 27 HOH HOH A . C 3 HOH 17 817 26 HOH HOH A . C 3 HOH 18 818 14 HOH HOH A . C 3 HOH 19 819 8 HOH HOH A . C 3 HOH 20 820 18 HOH HOH A . C 3 HOH 21 821 24 HOH HOH A . C 3 HOH 22 822 35 HOH HOH A . C 3 HOH 23 823 1 HOH HOH A . C 3 HOH 24 824 7 HOH HOH A . C 3 HOH 25 825 17 HOH HOH A . C 3 HOH 26 826 19 HOH HOH A . C 3 HOH 27 827 34 HOH HOH A . C 3 HOH 28 828 11 HOH HOH A . C 3 HOH 29 829 12 HOH HOH A . C 3 HOH 30 830 15 HOH HOH A . C 3 HOH 31 831 30 HOH HOH A . C 3 HOH 32 832 6 HOH HOH A . C 3 HOH 33 833 32 HOH HOH A . C 3 HOH 34 834 29 HOH HOH A . C 3 HOH 35 835 33 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TRP 395 ? CG ? A TRP 19 CG 2 1 Y 1 A TRP 395 ? CD1 ? A TRP 19 CD1 3 1 Y 1 A TRP 395 ? CD2 ? A TRP 19 CD2 4 1 Y 1 A TRP 395 ? NE1 ? A TRP 19 NE1 5 1 Y 1 A TRP 395 ? CE2 ? A TRP 19 CE2 6 1 Y 1 A TRP 395 ? CE3 ? A TRP 19 CE3 7 1 Y 1 A TRP 395 ? CZ2 ? A TRP 19 CZ2 8 1 Y 1 A TRP 395 ? CZ3 ? A TRP 19 CZ3 9 1 Y 1 A TRP 395 ? CH2 ? A TRP 19 CH2 10 1 Y 1 A ASP 398 ? CG ? A ASP 22 CG 11 1 Y 1 A ASP 398 ? OD1 ? A ASP 22 OD1 12 1 Y 1 A ASP 398 ? OD2 ? A ASP 22 OD2 13 1 Y 1 A LYS 400 ? CG ? A LYS 24 CG 14 1 Y 1 A LYS 400 ? CD ? A LYS 24 CD 15 1 Y 1 A LYS 400 ? CE ? A LYS 24 CE 16 1 Y 1 A LYS 400 ? NZ ? A LYS 24 NZ 17 1 Y 1 A LYS 406 ? CG ? A LYS 30 CG 18 1 Y 1 A LYS 406 ? CD ? A LYS 30 CD 19 1 Y 1 A LYS 406 ? CE ? A LYS 30 CE 20 1 Y 1 A LYS 406 ? NZ ? A LYS 30 NZ 21 1 Y 1 A GLU 407 ? CG ? A GLU 31 CG 22 1 Y 1 A GLU 407 ? CD ? A GLU 31 CD 23 1 Y 1 A GLU 407 ? OE1 ? A GLU 31 OE1 24 1 Y 1 A GLU 407 ? OE2 ? A GLU 31 OE2 25 1 Y 1 A THR 410 ? OG1 ? A THR 34 OG1 26 1 Y 1 A THR 410 ? CG2 ? A THR 34 CG2 27 1 Y 1 A GLN 412 ? CG ? A GLN 36 CG 28 1 Y 1 A GLN 412 ? CD ? A GLN 36 CD 29 1 Y 1 A GLN 412 ? OE1 ? A GLN 36 OE1 30 1 Y 1 A GLN 412 ? NE2 ? A GLN 36 NE2 31 1 Y 1 A PHE 413 ? CG ? A PHE 37 CG 32 1 Y 1 A PHE 413 ? CD1 ? A PHE 37 CD1 33 1 Y 1 A PHE 413 ? CD2 ? A PHE 37 CD2 34 1 Y 1 A PHE 413 ? CE1 ? A PHE 37 CE1 35 1 Y 1 A PHE 413 ? CE2 ? A PHE 37 CE2 36 1 Y 1 A PHE 413 ? CZ ? A PHE 37 CZ 37 1 Y 1 A LYS 417 ? CE ? A LYS 41 CE 38 1 Y 1 A LYS 417 ? NZ ? A LYS 41 NZ 39 1 Y 1 A ARG 422 ? CG ? A ARG 46 CG 40 1 Y 1 A ARG 422 ? CD ? A ARG 46 CD 41 1 Y 1 A ARG 422 ? NE ? A ARG 46 NE 42 1 Y 1 A ARG 422 ? CZ ? A ARG 46 CZ 43 1 Y 1 A ARG 422 ? NH1 ? A ARG 46 NH1 44 1 Y 1 A ARG 422 ? NH2 ? A ARG 46 NH2 45 1 Y 1 A GLN 424 ? CG ? A GLN 48 CG 46 1 Y 1 A GLN 424 ? CD ? A GLN 48 CD 47 1 Y 1 A GLN 424 ? OE1 ? A GLN 48 OE1 48 1 Y 1 A GLN 424 ? NE2 ? A GLN 48 NE2 49 1 Y 1 A TYR 425 ? CG ? A TYR 49 CG 50 1 Y 1 A TYR 425 ? CD1 ? A TYR 49 CD1 51 1 Y 1 A TYR 425 ? CD2 ? A TYR 49 CD2 52 1 Y 1 A TYR 425 ? CE1 ? A TYR 49 CE1 53 1 Y 1 A TYR 425 ? CE2 ? A TYR 49 CE2 54 1 Y 1 A TYR 425 ? CZ ? A TYR 49 CZ 55 1 Y 1 A TYR 425 ? OH ? A TYR 49 OH 56 1 Y 1 A LYS 430 ? CE ? A LYS 54 CE 57 1 Y 1 A LYS 430 ? NZ ? A LYS 54 NZ 58 1 Y 1 A LYS 433 ? CG ? A LYS 57 CG 59 1 Y 1 A LYS 433 ? CD ? A LYS 57 CD 60 1 Y 1 A LYS 433 ? CE ? A LYS 57 CE 61 1 Y 1 A LYS 433 ? NZ ? A LYS 57 NZ 62 1 Y 1 A GLU 434 ? CD ? A GLU 58 CD 63 1 Y 1 A GLU 434 ? OE1 ? A GLU 58 OE1 64 1 Y 1 A GLU 434 ? OE2 ? A GLU 58 OE2 65 1 Y 1 A LYS 447 ? CG ? A LYS 71 CG 66 1 Y 1 A LYS 447 ? CD ? A LYS 71 CD 67 1 Y 1 A LYS 447 ? CE ? A LYS 71 CE 68 1 Y 1 A LYS 447 ? NZ ? A LYS 71 NZ 69 1 Y 1 A MET 450 ? CG ? A MET 74 CG 70 1 Y 1 A MET 450 ? SD ? A MET 74 SD 71 1 Y 1 A MET 450 ? CE ? A MET 74 CE 72 1 Y 1 A ASN 451 ? CG ? A ASN 75 CG 73 1 Y 1 A ASN 451 ? OD1 ? A ASN 75 OD1 74 1 Y 1 A ASN 451 ? ND2 ? A ASN 75 ND2 75 1 Y 1 A SER 453 ? OG ? A SER 77 OG 76 1 Y 1 A GLU 455 ? CG ? A GLU 79 CG 77 1 Y 1 A GLU 455 ? CD ? A GLU 79 CD 78 1 Y 1 A GLU 455 ? OE1 ? A GLU 79 OE1 79 1 Y 1 A GLU 455 ? OE2 ? A GLU 79 OE2 80 1 Y 1 A GLN 459 ? CG ? A GLN 83 CG 81 1 Y 1 A GLN 459 ? CD ? A GLN 83 CD 82 1 Y 1 A GLN 459 ? OE1 ? A GLN 83 OE1 83 1 Y 1 A GLN 459 ? NE2 ? A GLN 83 NE2 84 1 Y 1 A LYS 466 ? CG ? A LYS 90 CG 85 1 Y 1 A LYS 466 ? CD ? A LYS 90 CD 86 1 Y 1 A LYS 466 ? CE ? A LYS 90 CE 87 1 Y 1 A LYS 466 ? NZ ? A LYS 90 NZ 88 1 Y 1 A GLN 467 ? CG ? A GLN 91 CG 89 1 Y 1 A GLN 467 ? CD ? A GLN 91 CD 90 1 Y 1 A GLN 467 ? OE1 ? A GLN 91 OE1 91 1 Y 1 A GLN 467 ? NE2 ? A GLN 91 NE2 92 1 Y 1 A ARG 468 ? CG ? A ARG 92 CG 93 1 Y 1 A ARG 468 ? CD ? A ARG 92 CD 94 1 Y 1 A ARG 468 ? NE ? A ARG 92 NE 95 1 Y 1 A ARG 468 ? CZ ? A ARG 92 CZ 96 1 Y 1 A ARG 468 ? NH1 ? A ARG 92 NH1 97 1 Y 1 A ARG 468 ? NH2 ? A ARG 92 NH2 98 1 Y 1 A GLN 496 ? CG ? A GLN 120 CG 99 1 Y 1 A GLN 496 ? CD ? A GLN 120 CD 100 1 Y 1 A GLN 496 ? OE1 ? A GLN 120 OE1 101 1 Y 1 A GLN 496 ? NE2 ? A GLN 120 NE2 102 1 Y 1 A ASP 548 ? CG ? A ASP 172 CG 103 1 Y 1 A ASP 548 ? OD1 ? A ASP 172 OD1 104 1 Y 1 A ASP 548 ? OD2 ? A ASP 172 OD2 105 1 Y 1 A ASP 549 ? CG ? A ASP 173 CG 106 1 Y 1 A ASP 549 ? OD1 ? A ASP 173 OD1 107 1 Y 1 A ASP 549 ? OD2 ? A ASP 173 OD2 108 1 Y 1 A GLU 550 ? CG ? A GLU 174 CG 109 1 Y 1 A GLU 550 ? CD ? A GLU 174 CD 110 1 Y 1 A GLU 550 ? OE1 ? A GLU 174 OE1 111 1 Y 1 A GLU 550 ? OE2 ? A GLU 174 OE2 112 1 Y 1 A TYR 551 ? CG ? A TYR 175 CG 113 1 Y 1 A TYR 551 ? CD1 ? A TYR 175 CD1 114 1 Y 1 A TYR 551 ? CD2 ? A TYR 175 CD2 115 1 Y 1 A TYR 551 ? CE1 ? A TYR 175 CE1 116 1 Y 1 A TYR 551 ? CE2 ? A TYR 175 CE2 117 1 Y 1 A TYR 551 ? CZ ? A TYR 175 CZ 118 1 Y 1 A TYR 551 ? OH ? A TYR 175 OH 119 1 Y 1 A ARG 600 ? CZ ? A ARG 224 CZ 120 1 Y 1 A ARG 600 ? NH1 ? A ARG 224 NH1 121 1 Y 1 A ARG 600 ? NH2 ? A ARG 224 NH2 122 1 Y 0 A SER 604 ? N A A SER 228 N 123 1 Y 0 A SER 604 ? CA A A SER 228 CA 124 1 Y 0 A SER 604 ? C A A SER 228 C 125 1 Y 0 A SER 604 ? O A A SER 228 O 126 1 Y 0 A SER 604 ? CB A A SER 228 CB 127 1 Y 0 A SER 604 ? OG A A SER 228 OG 128 1 Y 1 A GLU 608 ? CG ? A GLU 232 CG 129 1 Y 1 A GLU 608 ? CD ? A GLU 232 CD 130 1 Y 1 A GLU 608 ? OE1 ? A GLU 232 OE1 131 1 Y 1 A GLU 608 ? OE2 ? A GLU 232 OE2 132 1 Y 1 A ILE 610 ? CG1 ? A ILE 234 CG1 133 1 Y 1 A ILE 610 ? CG2 ? A ILE 234 CG2 134 1 Y 1 A ILE 610 ? CD1 ? A ILE 234 CD1 135 1 Y 1 A GLN 612 ? CG ? A GLN 236 CG 136 1 Y 1 A GLN 612 ? CD ? A GLN 236 CD 137 1 Y 1 A GLN 612 ? OE1 ? A GLN 236 OE1 138 1 Y 1 A GLN 612 ? NE2 ? A GLN 236 NE2 139 1 Y 1 A LYS 625 ? CG ? A LYS 249 CG 140 1 Y 1 A LYS 625 ? CD ? A LYS 249 CD 141 1 Y 1 A LYS 625 ? CE ? A LYS 249 CE 142 1 Y 1 A LYS 625 ? NZ ? A LYS 249 NZ 143 1 Y 1 A LYS 637 ? CD ? A LYS 261 CD 144 1 Y 1 A LYS 637 ? CE ? A LYS 261 CE 145 1 Y 1 A LYS 637 ? NZ ? A LYS 261 NZ 146 1 Y 1 A ASP 639 ? CG ? A ASP 263 CG 147 1 Y 1 A ASP 639 ? OD1 ? A ASP 263 OD1 148 1 Y 1 A ASP 639 ? OD2 ? A ASP 263 OD2 149 1 Y 1 A GLU 640 ? CD ? A GLU 264 CD 150 1 Y 1 A GLU 640 ? OE1 ? A GLU 264 OE1 151 1 Y 1 A GLU 640 ? OE2 ? A GLU 264 OE2 152 1 Y 1 A GLU 657 ? CG ? A GLU 281 CG 153 1 Y 1 A GLU 657 ? CD ? A GLU 281 CD 154 1 Y 1 A GLU 657 ? OE1 ? A GLU 281 OE1 155 1 Y 1 A GLU 657 ? OE2 ? A GLU 281 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 8TU5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.780 _cell.length_a_esd ? _cell.length_b 102.040 _cell.length_b_esd ? _cell.length_c 38.280 _cell.length_c_esd ? _cell.volume 253036.588 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8TU5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall 'P 2 2ab' _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8TU5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'bis-tris pH 6.5, ammonium tartrate, PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 12M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-03-27 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 35.02 _reflns.entry_id 8TU5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 28391 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.15 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.15 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.23 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4616 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.535 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 39.88 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8TU5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 40.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15366 _refine.ls_number_reflns_R_free 770 _refine.ls_number_reflns_R_work 14596 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.45 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2593 _refine.ls_R_factor_R_free 0.2724 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2586 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.1614 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2722 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 40.08 _refine_hist.number_atoms_solvent 35 _refine_hist.number_atoms_total 2030 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1967 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0099 ? 2058 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.3600 ? 2799 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0759 ? 311 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0342 ? 351 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.6741 ? 741 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.26 . . 150 2837 98.91 . . . . 0.3470 . . . . . . . . . . . 0.3713 'X-RAY DIFFRACTION' 2.26 2.49 . . 151 2874 99.54 . . . . 0.3102 . . . . . . . . . . . 0.3145 'X-RAY DIFFRACTION' 2.49 2.85 . . 152 2874 99.64 . . . . 0.3022 . . . . . . . . . . . 0.3103 'X-RAY DIFFRACTION' 2.85 3.59 . . 155 2942 99.61 . . . . 0.2563 . . . . . . . . . . . 0.2856 'X-RAY DIFFRACTION' 3.59 40.08 . . 162 3069 99.54 . . . . 0.2221 . . . . . . . . . . . 0.2280 # _struct.entry_id 8TU5 _struct.title ;Bruton's tyrosine kinase in complex with covalent inhibitor compound 27 ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8TU5 _struct_keywords.text 'kinase, TRANSFERASE, TRANSFERASE-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSFERASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BTK_HUMAN _struct_ref.pdbx_db_accession Q06187 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLY GVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFG LSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHL ASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES ; _struct_ref.pdbx_align_begin 382 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8TU5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 283 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06187 _struct_ref_seq.db_align_beg 382 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 659 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 382 _struct_ref_seq.pdbx_auth_seq_align_end 659 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8TU5 GLY A 1 ? UNP Q06187 ? ? 'expression tag' 377 1 1 8TU5 PRO A 2 ? UNP Q06187 ? ? 'expression tag' 378 2 1 8TU5 LEU A 3 ? UNP Q06187 ? ? 'expression tag' 379 3 1 8TU5 GLY A 4 ? UNP Q06187 ? ? 'expression tag' 380 4 1 8TU5 SER A 5 ? UNP Q06187 ? ? 'expression tag' 381 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 22 ? LYS A 24 ? ASP A 398 LYS A 400 5 ? 3 HELX_P HELX_P2 AA2 SER A 62 ? ASN A 75 ? SER A 438 ASN A 451 1 ? 14 HELX_P HELX_P3 AA3 CYS A 105 ? GLU A 112 ? CYS A 481 GLU A 488 1 ? 8 HELX_P HELX_P4 AA4 MET A 113 ? ARG A 116 ? MET A 489 ARG A 492 5 ? 4 HELX_P HELX_P5 AA5 GLN A 118 ? LYS A 139 ? GLN A 494 LYS A 515 1 ? 22 HELX_P HELX_P6 AA6 ALA A 147 ? ARG A 149 ? ALA A 523 ARG A 525 5 ? 3 HELX_P HELX_P7 AA7 GLY A 165 ? VAL A 170 ? GLY A 541 VAL A 546 5 ? 6 HELX_P HELX_P8 AA8 PRO A 184 ? SER A 188 ? PRO A 560 SER A 564 5 ? 5 HELX_P HELX_P9 AA9 PRO A 189 ? SER A 196 ? PRO A 565 SER A 572 1 ? 8 HELX_P HELX_P10 AB1 SER A 199 ? SER A 216 ? SER A 575 SER A 592 1 ? 18 HELX_P HELX_P11 AB2 THR A 226 ? GLY A 237 ? THR A 602 GLY A 613 1 ? 12 HELX_P HELX_P12 AB3 SER A 247 ? CYS A 257 ? SER A 623 CYS A 633 1 ? 11 HELX_P HELX_P13 AB4 LYS A 261 ? ARG A 265 ? LYS A 637 ARG A 641 5 ? 5 HELX_P HELX_P14 AB5 THR A 267 ? GLU A 281 ? THR A 643 GLU A 657 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 105 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id V7I _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C14 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 481 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id V7I _struct_conn.ptnr2_auth_seq_id 701 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.872 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 92 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 468 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 93 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 469 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.40 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 26 ? THR A 34 ? LEU A 402 THR A 410 AA1 2 VAL A 39 ? TRP A 45 ? VAL A 415 TRP A 421 AA1 3 TYR A 49 ? MET A 55 ? TYR A 425 MET A 431 AA1 4 PHE A 95 ? THR A 98 ? PHE A 471 THR A 474 AA1 5 LEU A 84 ? CYS A 88 ? LEU A 460 CYS A 464 AA2 1 CYS A 151 ? VAL A 153 ? CYS A 527 VAL A 529 AA2 2 VAL A 159 ? VAL A 161 ? VAL A 535 VAL A 537 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 30 ? N LYS A 406 O TYR A 42 ? O TYR A 418 AA1 2 3 N LYS A 41 ? N LYS A 417 O ILE A 53 ? O ILE A 429 AA1 3 4 N LYS A 54 ? N LYS A 430 O ILE A 96 ? O ILE A 472 AA1 4 5 O ILE A 97 ? O ILE A 473 N GLY A 86 ? N GLY A 462 AA2 1 2 N LEU A 152 ? N LEU A 528 O LYS A 160 ? O LYS A 536 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 424 ? ? -150.25 -39.04 2 1 ARG A 520 ? ? 79.73 -8.49 3 1 ASP A 521 ? ? -154.01 45.31 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 487 ? ? 0.086 'SIDE CHAIN' 2 1 ARG A 525 ? ? 0.121 'SIDE CHAIN' 3 1 ARG A 544 ? ? 0.143 'SIDE CHAIN' 4 1 ARG A 618 ? ? 0.284 'SIDE CHAIN' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x+1/2,y+1/2,-z 4 -x,-y,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 17.5021377078 -3.34782790453 5.89101117483 0.498119440108 ? 0.0323210839964 ? -0.0183989267614 ? 0.315188668005 ? -0.0528824661555 ? 0.362774699604 ? 1.49716826751 ? -0.358453151346 ? -0.769106976537 ? 1.79017707843 ? -0.835051417167 ? 2.26086746862 ? 0.0278157667311 ? 0.109405684266 ? 0.052217224947 ? -0.168004987482 ? 0.0311524383765 ? 0.329634005617 ? 0.0831845699936 ? 0.10567047369 ? 0.104274309824 ? 2 'X-RAY DIFFRACTION' ? refined 12.1331929821 11.3806937415 6.73147719225 0.317454906998 ? 0.0206289267613 ? 0.0089470389697 ? 0.274615818474 ? -0.0188438971987 ? 0.278237258849 ? 0.73845397349 ? -0.191553671855 ? -0.174969844397 ? 1.26496298973 ? 0.153217069405 ? 1.04286117454 ? -0.0863681600558 ? -0.108851372153 ? -0.0794020163712 ? 0.0803869362073 ? 0.0750656131861 ? 0.0331221366119 ? 0.300005356776 ? 0.0719836537418 ? 0.00890163399231 ? 3 'X-RAY DIFFRACTION' ? refined 19.0618474639 26.3190030784 17.7082106081 0.394847751692 ? 0.045631486015 ? 0.0312550658661 ? 0.432650645077 ? 0.0193206613835 ? 0.268141672402 ? 0.415890195582 ? 0.482192512023 ? -0.103424807615 ? 0.621678268155 ? -0.555441602025 ? 1.25583763811 ? 0.088940965004 ? -0.381667969146 ? 0.233570929449 ? -0.263886017834 ? 0.0511962193305 ? -0.292234809715 ? 0.338536504203 ? 0.243628151212 ? -0.0963437075957 ? 4 'X-RAY DIFFRACTION' ? refined 12.2259831097 31.5104856428 4.50389817914 0.203440899978 ? -0.00814307057389 ? 0.0156997384586 ? 0.231556941729 ? -0.000201493763792 ? 0.236897864611 ? 0.624764440184 ? -0.653254771801 ? -0.181792599908 ? 1.1696575591 ? 0.0445518530039 ? 1.55428013628 ? 0.0261202049454 ? 0.0631558014011 ? -0.0559742244312 ? 0.0615102710689 ? 0.00867099660894 ? 0.0105871365447 ? -0.265646299592 ? 0.0433039246786 ? 0.0147417671028 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 395 ? A 30 A 424 ? ? ;chain 'A' and (resid 395 through 424 ) ; 2 'X-RAY DIFFRACTION' 2 A 31 A 425 ? A 151 A 545 ? ? ;chain 'A' and (resid 425 through 545 ) ; 3 'X-RAY DIFFRACTION' 3 A 152 A 546 ? A 174 A 575 ? ? ;chain 'A' and (resid 546 through 575 ) ; 4 'X-RAY DIFFRACTION' 4 A 175 A 576 ? A 256 A 657 ? ? ;chain 'A' and (resid 576 through 657 ) ; # _pdbx_entry_details.entry_id 8TU5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 377 ? A GLY 1 2 1 Y 1 A PRO 378 ? A PRO 2 3 1 Y 1 A LEU 379 ? A LEU 3 4 1 Y 1 A GLY 380 ? A GLY 4 5 1 Y 1 A SER 381 ? A SER 5 6 1 Y 1 A LYS 382 ? A LYS 6 7 1 Y 1 A ASN 383 ? A ASN 7 8 1 Y 1 A ALA 384 ? A ALA 8 9 1 Y 1 A PRO 385 ? A PRO 9 10 1 Y 1 A SER 386 ? A SER 10 11 1 Y 1 A THR 387 ? A THR 11 12 1 Y 1 A ALA 388 ? A ALA 12 13 1 Y 1 A GLY 389 ? A GLY 13 14 1 Y 1 A LEU 390 ? A LEU 14 15 1 Y 1 A GLY 391 ? A GLY 15 16 1 Y 1 A TYR 392 ? A TYR 16 17 1 Y 1 A GLY 393 ? A GLY 17 18 1 Y 1 A SER 394 ? A SER 18 19 1 Y 1 A THR 552 ? A THR 176 20 1 Y 1 A SER 553 ? A SER 177 21 1 Y 1 A SER 554 ? A SER 178 22 1 Y 1 A VAL 555 ? A VAL 179 23 1 Y 1 A GLY 556 ? A GLY 180 24 1 Y 1 A SER 557 ? A SER 181 25 1 Y 1 A LYS 558 ? A LYS 182 26 1 Y 1 A GLU 658 ? A GLU 282 27 1 Y 1 A SER 659 ? A SER 283 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 V7I N1 N Y N 372 V7I N3 N Y N 373 V7I C4 C Y N 374 V7I C5 C N N 375 V7I C6 C Y N 376 V7I C7 C Y N 377 V7I C8 C N S 378 V7I C10 C N R 379 V7I C13 C N N 380 V7I C15 C N N 381 V7I C17 C N N 382 V7I C20 C Y N 383 V7I C1 C Y N 384 V7I C11 C N R 385 V7I C12 C N N 386 V7I C14 C N N 387 V7I C16 C N N 388 V7I C18 C Y N 389 V7I C19 C Y N 390 V7I C2 C Y N 391 V7I C3 C Y N 392 V7I C9 C N N 393 V7I N2 N Y N 394 V7I N4 N N N 395 V7I N5 N Y N 396 V7I N6 N Y N 397 V7I O1 O N N 398 V7I O2 O N N 399 V7I H2 H N N 400 V7I H3 H N N 401 V7I H5 H N N 402 V7I H4 H N N 403 V7I H6 H N N 404 V7I H10 H N N 405 V7I H13 H N N 406 V7I H12 H N N 407 V7I H17 H N N 408 V7I H18 H N N 409 V7I H22 H N N 410 V7I H21 H N N 411 V7I H24 H N N 412 V7I H1 H N N 413 V7I H11 H N N 414 V7I H16 H N N 415 V7I H15 H N N 416 V7I H14 H N N 417 V7I H19 H N N 418 V7I H20 H N N 419 V7I H23 H N N 420 V7I H8 H N N 421 V7I H9 H N N 422 V7I H7 H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 V7I C1 C2 doub Y N 358 V7I C2 C3 sing N N 359 V7I C3 C4 doub Y N 360 V7I C4 N1 sing Y N 361 V7I N1 C5 sing N N 362 V7I N1 N2 sing Y N 363 V7I N2 C6 doub Y N 364 V7I C2 N3 sing Y N 365 V7I N3 C7 doub Y N 366 V7I C7 O1 sing N N 367 V7I O1 C8 sing N N 368 V7I C8 C9 sing N N 369 V7I C8 C10 sing N N 370 V7I C10 C11 sing N N 371 V7I C11 N4 sing N N 372 V7I N4 C12 sing N N 373 V7I C12 C13 sing N N 374 V7I C13 C14 sing N N 375 V7I C12 O2 doub N N 376 V7I N4 C15 sing N N 377 V7I C15 C16 sing N N 378 V7I C11 C17 sing N N 379 V7I C7 C18 sing Y N 380 V7I C18 N5 sing Y N 381 V7I N5 N6 sing Y N 382 V7I N6 C19 doub Y N 383 V7I C19 C20 sing Y N 384 V7I C1 N5 sing Y N 385 V7I C3 C6 sing Y N 386 V7I C8 C17 sing N N 387 V7I C10 C16 sing N N 388 V7I C18 C20 doub Y N 389 V7I C4 H2 sing N N 390 V7I C5 H3 sing N N 391 V7I C5 H5 sing N N 392 V7I C5 H4 sing N N 393 V7I C6 H6 sing N N 394 V7I C10 H10 sing N N 395 V7I C13 H13 sing N N 396 V7I C13 H12 sing N N 397 V7I C15 H17 sing N N 398 V7I C15 H18 sing N N 399 V7I C17 H22 sing N N 400 V7I C17 H21 sing N N 401 V7I C20 H24 sing N N 402 V7I C1 H1 sing N N 403 V7I C11 H11 sing N N 404 V7I C14 H16 sing N N 405 V7I C14 H15 sing N N 406 V7I C14 H14 sing N N 407 V7I C16 H19 sing N N 408 V7I C16 H20 sing N N 409 V7I C19 H23 sing N N 410 V7I C9 H8 sing N N 411 V7I C9 H9 sing N N 412 V7I C9 H7 sing N N 413 VAL N CA sing N N 414 VAL N H sing N N 415 VAL N H2 sing N N 416 VAL CA C sing N N 417 VAL CA CB sing N N 418 VAL CA HA sing N N 419 VAL C O doub N N 420 VAL C OXT sing N N 421 VAL CB CG1 sing N N 422 VAL CB CG2 sing N N 423 VAL CB HB sing N N 424 VAL CG1 HG11 sing N N 425 VAL CG1 HG12 sing N N 426 VAL CG1 HG13 sing N N 427 VAL CG2 HG21 sing N N 428 VAL CG2 HG22 sing N N 429 VAL CG2 HG23 sing N N 430 VAL OXT HXT sing N N 431 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id V7I _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id V7I _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5p9j _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 2' _space_group.name_Hall 'P 2 2ab' _space_group.IT_number 18 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 8TU5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015437 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009800 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026123 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_