data_8U57 # _entry.id 8U57 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8U57 pdb_00008u57 10.2210/pdb8u57/pdb WWPDB D_1000277376 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-07-24 2 'Structure model' 1 1 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_entry_details 2 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8U57 _pdbx_database_status.recvd_initial_deposition_date 2023-09-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email john.bruning@adelaide.edu.au _pdbx_contact_author.name_first John _pdbx_contact_author.name_last Bruning _pdbx_contact_author.name_mi B _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6919-1824 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pederick, J.L.' 1 0000-0003-4048-9771 'Frkic, R.L.' 2 ? 'McDougal, D.P.' 3 ? 'Bruning, J.B.' 4 0000-0002-6919-1824 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemosphere _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1879-1298 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 354 _citation.language ? _citation.page_first 141723 _citation.page_last 141723 _citation.title ;A structural basis for the activation of peroxisome proliferator-activated receptor gamma (PPAR gamma ) by perfluorooctanoic acid (PFOA). ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.chemosphere.2024.141723 _citation.pdbx_database_id_PubMed 38494006 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pederick, J.L.' 1 ? primary 'Frkic, R.L.' 2 ? primary 'McDougal, D.P.' 3 ? primary 'Bruning, J.B.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peroxisome proliferator-activated receptor gamma' 33316.520 1 ? ? 'Ligand binding domain' ? 2 non-polymer syn 'pentadecafluorooctanoic acid' 414.068 4 ? ? ? ? 3 non-polymer syn '(4S,5S)-1,2-DITHIANE-4,5-DIOL' 152.235 1 ? ? ? ? 4 water nat water 18.015 112 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHVDDDDKMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHI TPLQEQSKEVAIRIFQG(CSO)QFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISE GQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKL NHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHVDDDDKMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHI TPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGF MTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPE SSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'pentadecafluorooctanoic acid' 8PF 3 '(4S,5S)-1,2-DITHIANE-4,5-DIOL' D1D 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 MET n 1 16 GLN n 1 17 LEU n 1 18 ASN n 1 19 PRO n 1 20 GLU n 1 21 SER n 1 22 ALA n 1 23 ASP n 1 24 LEU n 1 25 ARG n 1 26 ALA n 1 27 LEU n 1 28 ALA n 1 29 LYS n 1 30 HIS n 1 31 LEU n 1 32 TYR n 1 33 ASP n 1 34 SER n 1 35 TYR n 1 36 ILE n 1 37 LYS n 1 38 SER n 1 39 PHE n 1 40 PRO n 1 41 LEU n 1 42 THR n 1 43 LYS n 1 44 ALA n 1 45 LYS n 1 46 ALA n 1 47 ARG n 1 48 ALA n 1 49 ILE n 1 50 LEU n 1 51 THR n 1 52 GLY n 1 53 LYS n 1 54 THR n 1 55 THR n 1 56 ASP n 1 57 LYS n 1 58 SER n 1 59 PRO n 1 60 PHE n 1 61 VAL n 1 62 ILE n 1 63 TYR n 1 64 ASP n 1 65 MET n 1 66 ASN n 1 67 SER n 1 68 LEU n 1 69 MET n 1 70 MET n 1 71 GLY n 1 72 GLU n 1 73 ASP n 1 74 LYS n 1 75 ILE n 1 76 LYS n 1 77 PHE n 1 78 LYS n 1 79 HIS n 1 80 ILE n 1 81 THR n 1 82 PRO n 1 83 LEU n 1 84 GLN n 1 85 GLU n 1 86 GLN n 1 87 SER n 1 88 LYS n 1 89 GLU n 1 90 VAL n 1 91 ALA n 1 92 ILE n 1 93 ARG n 1 94 ILE n 1 95 PHE n 1 96 GLN n 1 97 GLY n 1 98 CSO n 1 99 GLN n 1 100 PHE n 1 101 ARG n 1 102 SER n 1 103 VAL n 1 104 GLU n 1 105 ALA n 1 106 VAL n 1 107 GLN n 1 108 GLU n 1 109 ILE n 1 110 THR n 1 111 GLU n 1 112 TYR n 1 113 ALA n 1 114 LYS n 1 115 SER n 1 116 ILE n 1 117 PRO n 1 118 GLY n 1 119 PHE n 1 120 VAL n 1 121 ASN n 1 122 LEU n 1 123 ASP n 1 124 LEU n 1 125 ASN n 1 126 ASP n 1 127 GLN n 1 128 VAL n 1 129 THR n 1 130 LEU n 1 131 LEU n 1 132 LYS n 1 133 TYR n 1 134 GLY n 1 135 VAL n 1 136 HIS n 1 137 GLU n 1 138 ILE n 1 139 ILE n 1 140 TYR n 1 141 THR n 1 142 MET n 1 143 LEU n 1 144 ALA n 1 145 SER n 1 146 LEU n 1 147 MET n 1 148 ASN n 1 149 LYS n 1 150 ASP n 1 151 GLY n 1 152 VAL n 1 153 LEU n 1 154 ILE n 1 155 SER n 1 156 GLU n 1 157 GLY n 1 158 GLN n 1 159 GLY n 1 160 PHE n 1 161 MET n 1 162 THR n 1 163 ARG n 1 164 GLU n 1 165 PHE n 1 166 LEU n 1 167 LYS n 1 168 SER n 1 169 LEU n 1 170 ARG n 1 171 LYS n 1 172 PRO n 1 173 PHE n 1 174 GLY n 1 175 ASP n 1 176 PHE n 1 177 MET n 1 178 GLU n 1 179 PRO n 1 180 LYS n 1 181 PHE n 1 182 GLU n 1 183 PHE n 1 184 ALA n 1 185 VAL n 1 186 LYS n 1 187 PHE n 1 188 ASN n 1 189 ALA n 1 190 LEU n 1 191 GLU n 1 192 LEU n 1 193 ASP n 1 194 ASP n 1 195 SER n 1 196 ASP n 1 197 LEU n 1 198 ALA n 1 199 ILE n 1 200 PHE n 1 201 ILE n 1 202 ALA n 1 203 VAL n 1 204 ILE n 1 205 ILE n 1 206 LEU n 1 207 SER n 1 208 GLY n 1 209 ASP n 1 210 ARG n 1 211 PRO n 1 212 GLY n 1 213 LEU n 1 214 LEU n 1 215 ASN n 1 216 VAL n 1 217 LYS n 1 218 PRO n 1 219 ILE n 1 220 GLU n 1 221 ASP n 1 222 ILE n 1 223 GLN n 1 224 ASP n 1 225 ASN n 1 226 LEU n 1 227 LEU n 1 228 GLN n 1 229 ALA n 1 230 LEU n 1 231 GLU n 1 232 LEU n 1 233 GLN n 1 234 LEU n 1 235 LYS n 1 236 LEU n 1 237 ASN n 1 238 HIS n 1 239 PRO n 1 240 GLU n 1 241 SER n 1 242 SER n 1 243 GLN n 1 244 LEU n 1 245 PHE n 1 246 ALA n 1 247 LYS n 1 248 LEU n 1 249 LEU n 1 250 GLN n 1 251 LYS n 1 252 MET n 1 253 THR n 1 254 ASP n 1 255 LEU n 1 256 ARG n 1 257 GLN n 1 258 ILE n 1 259 VAL n 1 260 THR n 1 261 GLU n 1 262 HIS n 1 263 VAL n 1 264 GLN n 1 265 LEU n 1 266 LEU n 1 267 GLN n 1 268 VAL n 1 269 ILE n 1 270 LYS n 1 271 LYS n 1 272 THR n 1 273 GLU n 1 274 THR n 1 275 ASP n 1 276 MET n 1 277 SER n 1 278 LEU n 1 279 HIS n 1 280 PRO n 1 281 LEU n 1 282 LEU n 1 283 GLN n 1 284 GLU n 1 285 ILE n 1 286 TYR n 1 287 LYS n 1 288 ASP n 1 289 LEU n 1 290 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 290 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PPARG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8PF non-polymer . 'pentadecafluorooctanoic acid' ? 'C8 H F15 O2' 414.068 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 D1D non-polymer . '(4S,5S)-1,2-DITHIANE-4,5-DIOL' ? 'C4 H8 O2 S2' 152.235 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 188 ? ? ? A . n A 1 2 ALA 2 189 ? ? ? A . n A 1 3 HIS 3 190 ? ? ? A . n A 1 4 HIS 4 191 ? ? ? A . n A 1 5 HIS 5 192 ? ? ? A . n A 1 6 HIS 6 193 ? ? ? A . n A 1 7 HIS 7 194 ? ? ? A . n A 1 8 HIS 8 195 ? ? ? A . n A 1 9 VAL 9 196 ? ? ? A . n A 1 10 ASP 10 197 ? ? ? A . n A 1 11 ASP 11 198 ? ? ? A . n A 1 12 ASP 12 199 ? ? ? A . n A 1 13 ASP 13 200 ? ? ? A . n A 1 14 LYS 14 201 ? ? ? A . n A 1 15 MET 15 202 ? ? ? A . n A 1 16 GLN 16 203 ? ? ? A . n A 1 17 LEU 17 204 ? ? ? A . n A 1 18 ASN 18 205 ? ? ? A . n A 1 19 PRO 19 206 ? ? ? A . n A 1 20 GLU 20 207 207 GLU GLU A . n A 1 21 SER 21 208 208 SER SER A . n A 1 22 ALA 22 209 209 ALA ALA A . n A 1 23 ASP 23 210 210 ASP ASP A . n A 1 24 LEU 24 211 211 LEU LEU A . n A 1 25 ARG 25 212 212 ARG ARG A . n A 1 26 ALA 26 213 213 ALA ALA A . n A 1 27 LEU 27 214 214 LEU LEU A . n A 1 28 ALA 28 215 215 ALA ALA A . n A 1 29 LYS 29 216 216 LYS LYS A . n A 1 30 HIS 30 217 217 HIS HIS A . n A 1 31 LEU 31 218 218 LEU LEU A . n A 1 32 TYR 32 219 219 TYR TYR A . n A 1 33 ASP 33 220 220 ASP ASP A . n A 1 34 SER 34 221 221 SER SER A . n A 1 35 TYR 35 222 222 TYR TYR A . n A 1 36 ILE 36 223 223 ILE ILE A . n A 1 37 LYS 37 224 224 LYS LYS A . n A 1 38 SER 38 225 225 SER SER A . n A 1 39 PHE 39 226 226 PHE PHE A . n A 1 40 PRO 40 227 227 PRO PRO A . n A 1 41 LEU 41 228 228 LEU LEU A . n A 1 42 THR 42 229 229 THR THR A . n A 1 43 LYS 43 230 230 LYS LYS A . n A 1 44 ALA 44 231 231 ALA ALA A . n A 1 45 LYS 45 232 232 LYS LYS A . n A 1 46 ALA 46 233 233 ALA ALA A . n A 1 47 ARG 47 234 234 ARG ARG A . n A 1 48 ALA 48 235 235 ALA ALA A . n A 1 49 ILE 49 236 236 ILE ILE A . n A 1 50 LEU 50 237 237 LEU LEU A . n A 1 51 THR 51 238 238 THR THR A . n A 1 52 GLY 52 239 239 GLY GLY A . n A 1 53 LYS 53 240 240 LYS LYS A . n A 1 54 THR 54 241 ? ? ? A . n A 1 55 THR 55 242 ? ? ? A . n A 1 56 ASP 56 243 ? ? ? A . n A 1 57 LYS 57 244 ? ? ? A . n A 1 58 SER 58 245 245 SER SER A . n A 1 59 PRO 59 246 246 PRO PRO A . n A 1 60 PHE 60 247 247 PHE PHE A . n A 1 61 VAL 61 248 248 VAL VAL A . n A 1 62 ILE 62 249 249 ILE ILE A . n A 1 63 TYR 63 250 250 TYR TYR A . n A 1 64 ASP 64 251 251 ASP ASP A . n A 1 65 MET 65 252 252 MET MET A . n A 1 66 ASN 66 253 253 ASN ASN A . n A 1 67 SER 67 254 254 SER SER A . n A 1 68 LEU 68 255 255 LEU LEU A . n A 1 69 MET 69 256 256 MET MET A . n A 1 70 MET 70 257 257 MET MET A . n A 1 71 GLY 71 258 258 GLY GLY A . n A 1 72 GLU 72 259 259 GLU GLU A . n A 1 73 ASP 73 260 260 ASP ASP A . n A 1 74 LYS 74 261 261 LYS LYS A . n A 1 75 ILE 75 262 262 ILE ILE A . n A 1 76 LYS 76 263 ? ? ? A . n A 1 77 PHE 77 264 ? ? ? A . n A 1 78 LYS 78 265 ? ? ? A . n A 1 79 HIS 79 266 ? ? ? A . n A 1 80 ILE 80 267 ? ? ? A . n A 1 81 THR 81 268 ? ? ? A . n A 1 82 PRO 82 269 ? ? ? A . n A 1 83 LEU 83 270 ? ? ? A . n A 1 84 GLN 84 271 ? ? ? A . n A 1 85 GLU 85 272 ? ? ? A . n A 1 86 GLN 86 273 ? ? ? A . n A 1 87 SER 87 274 ? ? ? A . n A 1 88 LYS 88 275 ? ? ? A . n A 1 89 GLU 89 276 276 GLU GLU A . n A 1 90 VAL 90 277 277 VAL VAL A . n A 1 91 ALA 91 278 278 ALA ALA A . n A 1 92 ILE 92 279 279 ILE ILE A . n A 1 93 ARG 93 280 280 ARG ARG A . n A 1 94 ILE 94 281 281 ILE ILE A . n A 1 95 PHE 95 282 282 PHE PHE A . n A 1 96 GLN 96 283 283 GLN GLN A . n A 1 97 GLY 97 284 284 GLY GLY A . n A 1 98 CSO 98 285 285 CSO CSO A . n A 1 99 GLN 99 286 286 GLN GLN A . n A 1 100 PHE 100 287 287 PHE PHE A . n A 1 101 ARG 101 288 288 ARG ARG A . n A 1 102 SER 102 289 289 SER SER A . n A 1 103 VAL 103 290 290 VAL VAL A . n A 1 104 GLU 104 291 291 GLU GLU A . n A 1 105 ALA 105 292 292 ALA ALA A . n A 1 106 VAL 106 293 293 VAL VAL A . n A 1 107 GLN 107 294 294 GLN GLN A . n A 1 108 GLU 108 295 295 GLU GLU A . n A 1 109 ILE 109 296 296 ILE ILE A . n A 1 110 THR 110 297 297 THR THR A . n A 1 111 GLU 111 298 298 GLU GLU A . n A 1 112 TYR 112 299 299 TYR TYR A . n A 1 113 ALA 113 300 300 ALA ALA A . n A 1 114 LYS 114 301 301 LYS LYS A . n A 1 115 SER 115 302 302 SER SER A . n A 1 116 ILE 116 303 303 ILE ILE A . n A 1 117 PRO 117 304 304 PRO PRO A . n A 1 118 GLY 118 305 305 GLY GLY A . n A 1 119 PHE 119 306 306 PHE PHE A . n A 1 120 VAL 120 307 307 VAL VAL A . n A 1 121 ASN 121 308 308 ASN ASN A . n A 1 122 LEU 122 309 309 LEU LEU A . n A 1 123 ASP 123 310 310 ASP ASP A . n A 1 124 LEU 124 311 311 LEU LEU A . n A 1 125 ASN 125 312 312 ASN ASN A . n A 1 126 ASP 126 313 313 ASP ASP A . n A 1 127 GLN 127 314 314 GLN GLN A . n A 1 128 VAL 128 315 315 VAL VAL A . n A 1 129 THR 129 316 316 THR THR A . n A 1 130 LEU 130 317 317 LEU LEU A . n A 1 131 LEU 131 318 318 LEU LEU A . n A 1 132 LYS 132 319 319 LYS LYS A . n A 1 133 TYR 133 320 320 TYR TYR A . n A 1 134 GLY 134 321 321 GLY GLY A . n A 1 135 VAL 135 322 322 VAL VAL A . n A 1 136 HIS 136 323 323 HIS HIS A . n A 1 137 GLU 137 324 324 GLU GLU A . n A 1 138 ILE 138 325 325 ILE ILE A . n A 1 139 ILE 139 326 326 ILE ILE A . n A 1 140 TYR 140 327 327 TYR TYR A . n A 1 141 THR 141 328 328 THR THR A . n A 1 142 MET 142 329 329 MET MET A . n A 1 143 LEU 143 330 330 LEU LEU A . n A 1 144 ALA 144 331 331 ALA ALA A . n A 1 145 SER 145 332 332 SER SER A . n A 1 146 LEU 146 333 333 LEU LEU A . n A 1 147 MET 147 334 334 MET MET A . n A 1 148 ASN 148 335 335 ASN ASN A . n A 1 149 LYS 149 336 336 LYS LYS A . n A 1 150 ASP 150 337 337 ASP ASP A . n A 1 151 GLY 151 338 338 GLY GLY A . n A 1 152 VAL 152 339 339 VAL VAL A . n A 1 153 LEU 153 340 340 LEU LEU A . n A 1 154 ILE 154 341 341 ILE ILE A . n A 1 155 SER 155 342 342 SER SER A . n A 1 156 GLU 156 343 343 GLU GLU A . n A 1 157 GLY 157 344 344 GLY GLY A . n A 1 158 GLN 158 345 345 GLN GLN A . n A 1 159 GLY 159 346 346 GLY GLY A . n A 1 160 PHE 160 347 347 PHE PHE A . n A 1 161 MET 161 348 348 MET MET A . n A 1 162 THR 162 349 349 THR THR A . n A 1 163 ARG 163 350 350 ARG ARG A . n A 1 164 GLU 164 351 351 GLU GLU A . n A 1 165 PHE 165 352 352 PHE PHE A . n A 1 166 LEU 166 353 353 LEU LEU A . n A 1 167 LYS 167 354 354 LYS LYS A . n A 1 168 SER 168 355 355 SER SER A . n A 1 169 LEU 169 356 356 LEU LEU A . n A 1 170 ARG 170 357 357 ARG ARG A . n A 1 171 LYS 171 358 358 LYS LYS A . n A 1 172 PRO 172 359 359 PRO PRO A . n A 1 173 PHE 173 360 360 PHE PHE A . n A 1 174 GLY 174 361 361 GLY GLY A . n A 1 175 ASP 175 362 362 ASP ASP A . n A 1 176 PHE 176 363 363 PHE PHE A . n A 1 177 MET 177 364 364 MET MET A . n A 1 178 GLU 178 365 365 GLU GLU A . n A 1 179 PRO 179 366 366 PRO PRO A . n A 1 180 LYS 180 367 367 LYS LYS A . n A 1 181 PHE 181 368 368 PHE PHE A . n A 1 182 GLU 182 369 369 GLU GLU A . n A 1 183 PHE 183 370 370 PHE PHE A . n A 1 184 ALA 184 371 371 ALA ALA A . n A 1 185 VAL 185 372 372 VAL VAL A . n A 1 186 LYS 186 373 373 LYS LYS A . n A 1 187 PHE 187 374 374 PHE PHE A . n A 1 188 ASN 188 375 375 ASN ASN A . n A 1 189 ALA 189 376 376 ALA ALA A . n A 1 190 LEU 190 377 377 LEU LEU A . n A 1 191 GLU 191 378 378 GLU GLU A . n A 1 192 LEU 192 379 379 LEU LEU A . n A 1 193 ASP 193 380 380 ASP ASP A . n A 1 194 ASP 194 381 381 ASP ASP A . n A 1 195 SER 195 382 382 SER SER A . n A 1 196 ASP 196 383 383 ASP ASP A . n A 1 197 LEU 197 384 384 LEU LEU A . n A 1 198 ALA 198 385 385 ALA ALA A . n A 1 199 ILE 199 386 386 ILE ILE A . n A 1 200 PHE 200 387 387 PHE PHE A . n A 1 201 ILE 201 388 388 ILE ILE A . n A 1 202 ALA 202 389 389 ALA ALA A . n A 1 203 VAL 203 390 390 VAL VAL A . n A 1 204 ILE 204 391 391 ILE ILE A . n A 1 205 ILE 205 392 392 ILE ILE A . n A 1 206 LEU 206 393 393 LEU LEU A . n A 1 207 SER 207 394 394 SER SER A . n A 1 208 GLY 208 395 395 GLY GLY A . n A 1 209 ASP 209 396 396 ASP ASP A . n A 1 210 ARG 210 397 397 ARG ARG A . n A 1 211 PRO 211 398 398 PRO PRO A . n A 1 212 GLY 212 399 399 GLY GLY A . n A 1 213 LEU 213 400 400 LEU LEU A . n A 1 214 LEU 214 401 401 LEU LEU A . n A 1 215 ASN 215 402 402 ASN ASN A . n A 1 216 VAL 216 403 403 VAL VAL A . n A 1 217 LYS 217 404 404 LYS LYS A . n A 1 218 PRO 218 405 405 PRO PRO A . n A 1 219 ILE 219 406 406 ILE ILE A . n A 1 220 GLU 220 407 407 GLU GLU A . n A 1 221 ASP 221 408 408 ASP ASP A . n A 1 222 ILE 222 409 409 ILE ILE A . n A 1 223 GLN 223 410 410 GLN GLN A . n A 1 224 ASP 224 411 411 ASP ASP A . n A 1 225 ASN 225 412 412 ASN ASN A . n A 1 226 LEU 226 413 413 LEU LEU A . n A 1 227 LEU 227 414 414 LEU LEU A . n A 1 228 GLN 228 415 415 GLN GLN A . n A 1 229 ALA 229 416 416 ALA ALA A . n A 1 230 LEU 230 417 417 LEU LEU A . n A 1 231 GLU 231 418 418 GLU GLU A . n A 1 232 LEU 232 419 419 LEU LEU A . n A 1 233 GLN 233 420 420 GLN GLN A . n A 1 234 LEU 234 421 421 LEU LEU A . n A 1 235 LYS 235 422 422 LYS LYS A . n A 1 236 LEU 236 423 423 LEU LEU A . n A 1 237 ASN 237 424 424 ASN ASN A . n A 1 238 HIS 238 425 425 HIS HIS A . n A 1 239 PRO 239 426 426 PRO PRO A . n A 1 240 GLU 240 427 427 GLU GLU A . n A 1 241 SER 241 428 428 SER SER A . n A 1 242 SER 242 429 429 SER SER A . n A 1 243 GLN 243 430 430 GLN GLN A . n A 1 244 LEU 244 431 431 LEU LEU A . n A 1 245 PHE 245 432 432 PHE PHE A . n A 1 246 ALA 246 433 433 ALA ALA A . n A 1 247 LYS 247 434 434 LYS LYS A . n A 1 248 LEU 248 435 435 LEU LEU A . n A 1 249 LEU 249 436 436 LEU LEU A . n A 1 250 GLN 250 437 437 GLN GLN A . n A 1 251 LYS 251 438 438 LYS LYS A . n A 1 252 MET 252 439 439 MET MET A . n A 1 253 THR 253 440 440 THR THR A . n A 1 254 ASP 254 441 441 ASP ASP A . n A 1 255 LEU 255 442 442 LEU LEU A . n A 1 256 ARG 256 443 443 ARG ARG A . n A 1 257 GLN 257 444 444 GLN GLN A . n A 1 258 ILE 258 445 445 ILE ILE A . n A 1 259 VAL 259 446 446 VAL VAL A . n A 1 260 THR 260 447 447 THR THR A . n A 1 261 GLU 261 448 448 GLU GLU A . n A 1 262 HIS 262 449 449 HIS HIS A . n A 1 263 VAL 263 450 450 VAL VAL A . n A 1 264 GLN 264 451 451 GLN GLN A . n A 1 265 LEU 265 452 452 LEU LEU A . n A 1 266 LEU 266 453 453 LEU LEU A . n A 1 267 GLN 267 454 454 GLN GLN A . n A 1 268 VAL 268 455 455 VAL VAL A . n A 1 269 ILE 269 456 456 ILE ILE A . n A 1 270 LYS 270 457 ? ? ? A . n A 1 271 LYS 271 458 ? ? ? A . n A 1 272 THR 272 459 ? ? ? A . n A 1 273 GLU 273 460 ? ? ? A . n A 1 274 THR 274 461 ? ? ? A . n A 1 275 ASP 275 462 ? ? ? A . n A 1 276 MET 276 463 ? ? ? A . n A 1 277 SER 277 464 ? ? ? A . n A 1 278 LEU 278 465 465 LEU LEU A . n A 1 279 HIS 279 466 466 HIS HIS A . n A 1 280 PRO 280 467 467 PRO PRO A . n A 1 281 LEU 281 468 468 LEU LEU A . n A 1 282 LEU 282 469 469 LEU LEU A . n A 1 283 GLN 283 470 470 GLN GLN A . n A 1 284 GLU 284 471 471 GLU GLU A . n A 1 285 ILE 285 472 472 ILE ILE A . n A 1 286 TYR 286 473 473 TYR TYR A . n A 1 287 LYS 287 474 474 LYS LYS A . n A 1 288 ASP 288 475 475 ASP ASP A . n A 1 289 LEU 289 476 476 LEU LEU A . n A 1 290 TYR 290 477 477 TYR TYR A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 8PF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 8PF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 8PF 1 501 501 8PF LIG A . C 2 8PF 1 502 701 8PF LIG A . D 2 8PF 1 503 801 8PF LIG A . E 3 D1D 1 504 901 D1D D1D A . F 2 8PF 1 505 1 8PF LIG A . G 4 HOH 1 601 33 HOH HOH A . G 4 HOH 2 602 66 HOH HOH A . G 4 HOH 3 603 35 HOH HOH A . G 4 HOH 4 604 34 HOH HOH A . G 4 HOH 5 605 94 HOH HOH A . G 4 HOH 6 606 106 HOH HOH A . G 4 HOH 7 607 28 HOH HOH A . G 4 HOH 8 608 15 HOH HOH A . G 4 HOH 9 609 18 HOH HOH A . G 4 HOH 10 610 40 HOH HOH A . G 4 HOH 11 611 113 HOH HOH A . G 4 HOH 12 612 97 HOH HOH A . G 4 HOH 13 613 61 HOH HOH A . G 4 HOH 14 614 3 HOH HOH A . G 4 HOH 15 615 42 HOH HOH A . G 4 HOH 16 616 2 HOH HOH A . G 4 HOH 17 617 95 HOH HOH A . G 4 HOH 18 618 30 HOH HOH A . G 4 HOH 19 619 5 HOH HOH A . G 4 HOH 20 620 121 HOH HOH A . G 4 HOH 21 621 13 HOH HOH A . G 4 HOH 22 622 6 HOH HOH A . G 4 HOH 23 623 62 HOH HOH A . G 4 HOH 24 624 10 HOH HOH A . G 4 HOH 25 625 52 HOH HOH A . G 4 HOH 26 626 29 HOH HOH A . G 4 HOH 27 627 23 HOH HOH A . G 4 HOH 28 628 27 HOH HOH A . G 4 HOH 29 629 100 HOH HOH A . G 4 HOH 30 630 102 HOH HOH A . G 4 HOH 31 631 91 HOH HOH A . G 4 HOH 32 632 12 HOH HOH A . G 4 HOH 33 633 79 HOH HOH A . G 4 HOH 34 634 25 HOH HOH A . G 4 HOH 35 635 44 HOH HOH A . G 4 HOH 36 636 31 HOH HOH A . G 4 HOH 37 637 70 HOH HOH A . G 4 HOH 38 638 88 HOH HOH A . G 4 HOH 39 639 21 HOH HOH A . G 4 HOH 40 640 9 HOH HOH A . G 4 HOH 41 641 7 HOH HOH A . G 4 HOH 42 642 56 HOH HOH A . G 4 HOH 43 643 19 HOH HOH A . G 4 HOH 44 644 20 HOH HOH A . G 4 HOH 45 645 26 HOH HOH A . G 4 HOH 46 646 49 HOH HOH A . G 4 HOH 47 647 39 HOH HOH A . G 4 HOH 48 648 85 HOH HOH A . G 4 HOH 49 649 8 HOH HOH A . G 4 HOH 50 650 4 HOH HOH A . G 4 HOH 51 651 43 HOH HOH A . G 4 HOH 52 652 22 HOH HOH A . G 4 HOH 53 653 112 HOH HOH A . G 4 HOH 54 654 11 HOH HOH A . G 4 HOH 55 655 14 HOH HOH A . G 4 HOH 56 656 67 HOH HOH A . G 4 HOH 57 657 46 HOH HOH A . G 4 HOH 58 658 80 HOH HOH A . G 4 HOH 59 659 16 HOH HOH A . G 4 HOH 60 660 58 HOH HOH A . G 4 HOH 61 661 24 HOH HOH A . G 4 HOH 62 662 87 HOH HOH A . G 4 HOH 63 663 90 HOH HOH A . G 4 HOH 64 664 45 HOH HOH A . G 4 HOH 65 665 65 HOH HOH A . G 4 HOH 66 666 114 HOH HOH A . G 4 HOH 67 667 99 HOH HOH A . G 4 HOH 68 668 55 HOH HOH A . G 4 HOH 69 669 36 HOH HOH A . G 4 HOH 70 670 78 HOH HOH A . G 4 HOH 71 671 51 HOH HOH A . G 4 HOH 72 672 108 HOH HOH A . G 4 HOH 73 673 53 HOH HOH A . G 4 HOH 74 674 47 HOH HOH A . G 4 HOH 75 675 48 HOH HOH A . G 4 HOH 76 676 93 HOH HOH A . G 4 HOH 77 677 72 HOH HOH A . G 4 HOH 78 678 69 HOH HOH A . G 4 HOH 79 679 57 HOH HOH A . G 4 HOH 80 680 32 HOH HOH A . G 4 HOH 81 681 110 HOH HOH A . G 4 HOH 82 682 59 HOH HOH A . G 4 HOH 83 683 71 HOH HOH A . G 4 HOH 84 684 75 HOH HOH A . G 4 HOH 85 685 96 HOH HOH A . G 4 HOH 86 686 104 HOH HOH A . G 4 HOH 87 687 117 HOH HOH A . G 4 HOH 88 688 60 HOH HOH A . G 4 HOH 89 689 63 HOH HOH A . G 4 HOH 90 690 41 HOH HOH A . G 4 HOH 91 691 115 HOH HOH A . G 4 HOH 92 692 37 HOH HOH A . G 4 HOH 93 693 92 HOH HOH A . G 4 HOH 94 694 82 HOH HOH A . G 4 HOH 95 695 125 HOH HOH A . G 4 HOH 96 696 1 HOH HOH A . G 4 HOH 97 697 50 HOH HOH A . G 4 HOH 98 698 103 HOH HOH A . G 4 HOH 99 699 109 HOH HOH A . G 4 HOH 100 700 74 HOH HOH A . G 4 HOH 101 701 101 HOH HOH A . G 4 HOH 102 702 77 HOH HOH A . G 4 HOH 103 703 123 HOH HOH A . G 4 HOH 104 704 124 HOH HOH A . G 4 HOH 105 705 17 HOH HOH A . G 4 HOH 106 706 120 HOH HOH A . G 4 HOH 107 707 118 HOH HOH A . G 4 HOH 108 708 122 HOH HOH A . G 4 HOH 109 709 89 HOH HOH A . G 4 HOH 110 710 76 HOH HOH A . G 4 HOH 111 711 68 HOH HOH A . G 4 HOH 112 712 54 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 224 ? CG ? A LYS 37 CG 2 1 Y 1 A LYS 224 ? CD ? A LYS 37 CD 3 1 Y 1 A LYS 224 ? CE ? A LYS 37 CE 4 1 Y 1 A LYS 224 ? NZ ? A LYS 37 NZ 5 1 Y 1 A LYS 232 ? CG ? A LYS 45 CG 6 1 Y 1 A LYS 232 ? CD ? A LYS 45 CD 7 1 Y 1 A LYS 232 ? CE ? A LYS 45 CE 8 1 Y 1 A LYS 232 ? NZ ? A LYS 45 NZ 9 1 Y 1 A LYS 240 ? CG ? A LYS 53 CG 10 1 Y 1 A LYS 240 ? CD ? A LYS 53 CD 11 1 Y 1 A LYS 240 ? CE ? A LYS 53 CE 12 1 Y 1 A LYS 240 ? NZ ? A LYS 53 NZ 13 1 Y 1 A LYS 261 ? CG ? A LYS 74 CG 14 1 Y 1 A LYS 261 ? CD ? A LYS 74 CD 15 1 Y 1 A LYS 261 ? CE ? A LYS 74 CE 16 1 Y 1 A LYS 261 ? NZ ? A LYS 74 NZ 17 1 Y 1 A ILE 262 ? CG1 ? A ILE 75 CG1 18 1 Y 1 A ILE 262 ? CG2 ? A ILE 75 CG2 19 1 Y 1 A ILE 262 ? CD1 ? A ILE 75 CD1 20 1 Y 1 A ILE 279 ? CG1 ? A ILE 92 CG1 21 1 Y 1 A ILE 279 ? CG2 ? A ILE 92 CG2 22 1 Y 1 A ILE 279 ? CD1 ? A ILE 92 CD1 23 1 Y 1 A GLN 283 ? CG ? A GLN 96 CG 24 1 Y 1 A GLN 283 ? CD ? A GLN 96 CD 25 1 Y 1 A GLN 283 ? OE1 ? A GLN 96 OE1 26 1 Y 1 A GLN 283 ? NE2 ? A GLN 96 NE2 27 1 Y 1 A LYS 358 ? CG ? A LYS 171 CG 28 1 Y 1 A LYS 358 ? CD ? A LYS 171 CD 29 1 Y 1 A LYS 358 ? CE ? A LYS 171 CE 30 1 Y 1 A LYS 358 ? NZ ? A LYS 171 NZ 31 1 Y 1 A LYS 373 ? CG ? A LYS 186 CG 32 1 Y 1 A LYS 373 ? CD ? A LYS 186 CD 33 1 Y 1 A LYS 373 ? CE ? A LYS 186 CE 34 1 Y 1 A LYS 373 ? NZ ? A LYS 186 NZ 35 1 Y 1 A LEU 401 ? CG ? A LEU 214 CG 36 1 Y 1 A LEU 401 ? CD1 ? A LEU 214 CD1 37 1 Y 1 A LEU 401 ? CD2 ? A LEU 214 CD2 38 1 Y 1 A LYS 404 ? CG ? A LYS 217 CG 39 1 Y 1 A LYS 404 ? CD ? A LYS 217 CD 40 1 Y 1 A LYS 404 ? CE ? A LYS 217 CE 41 1 Y 1 A LYS 404 ? NZ ? A LYS 217 NZ 42 1 Y 1 A SER 429 ? OG ? A SER 242 OG 43 1 Y 1 A GLN 444 ? CG ? A GLN 257 CG 44 1 Y 1 A GLN 444 ? CD ? A GLN 257 CD 45 1 Y 1 A GLN 444 ? OE1 ? A GLN 257 OE1 46 1 Y 1 A GLN 444 ? NE2 ? A GLN 257 NE2 47 1 Y 1 A LEU 452 ? CG ? A LEU 265 CG 48 1 Y 1 A LEU 452 ? CD1 ? A LEU 265 CD1 49 1 Y 1 A LEU 452 ? CD2 ? A LEU 265 CD2 50 1 Y 1 A GLN 454 ? CG ? A GLN 267 CG 51 1 Y 1 A GLN 454 ? CD ? A GLN 267 CD 52 1 Y 1 A GLN 454 ? OE1 ? A GLN 267 OE1 53 1 Y 1 A GLN 454 ? NE2 ? A GLN 267 NE2 54 1 Y 1 A VAL 455 ? CG1 ? A VAL 268 CG1 55 1 Y 1 A VAL 455 ? CG2 ? A VAL 268 CG2 56 1 Y 1 A ILE 456 ? CG1 ? A ILE 269 CG1 57 1 Y 1 A ILE 456 ? CG2 ? A ILE 269 CG2 58 1 Y 1 A ILE 456 ? CD1 ? A ILE 269 CD1 59 1 Y 1 A LEU 465 ? CG ? A LEU 278 CG 60 1 Y 1 A LEU 465 ? CD1 ? A LEU 278 CD1 61 1 Y 1 A LEU 465 ? CD2 ? A LEU 278 CD2 62 1 Y 1 A GLN 470 ? CG ? A GLN 283 CG 63 1 Y 1 A GLN 470 ? CD ? A GLN 283 CD 64 1 Y 1 A GLN 470 ? OE1 ? A GLN 283 OE1 65 1 Y 1 A GLN 470 ? NE2 ? A GLN 283 NE2 66 1 Y 1 A LYS 474 ? CG ? A LYS 287 CG 67 1 Y 1 A LYS 474 ? CD ? A LYS 287 CD 68 1 Y 1 A LYS 474 ? CE ? A LYS 287 CE 69 1 Y 1 A LYS 474 ? NZ ? A LYS 287 NZ 70 1 Y 1 A TYR 477 ? CG ? A TYR 290 CG 71 1 Y 1 A TYR 477 ? CD1 ? A TYR 290 CD1 72 1 Y 1 A TYR 477 ? CD2 ? A TYR 290 CD2 73 1 Y 1 A TYR 477 ? CE1 ? A TYR 290 CE1 74 1 Y 1 A TYR 477 ? CE2 ? A TYR 290 CE2 75 1 Y 1 A TYR 477 ? CZ ? A TYR 290 CZ 76 1 Y 1 A TYR 477 ? OH ? A TYR 290 OH # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 8U57 _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.171 _cell.length_a_esd ? _cell.length_b 66.171 _cell.length_b_esd ? _cell.length_c 156.936 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 8U57 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8U57 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.6 - 1.2 M sodium citrate tribasic dihydrate, 0.1 M Tris 8.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 8U57 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 39.23 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24476 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.06 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.193 _reflns.pdbx_Rpim_I_all 0.038 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 624245 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.189 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 47487 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1774 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 26.8 _reflns_shell.pdbx_chi_squared 1.03 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 2.0 _reflns_shell.pdbx_Rrim_I_all 2.682 _reflns_shell.pdbx_Rpim_I_all 0.516 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.788 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.631 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 8U57 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 33.09 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24354 _refine.ls_number_reflns_R_free 1231 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.80 _refine.ls_percent_reflns_R_free 5.05 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2224 _refine.ls_R_factor_R_free 0.2538 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2208 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.76 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.22 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 33.09 _refine_hist.number_atoms_solvent 112 _refine_hist.number_atoms_total 2117 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1897 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 108 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 2039 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.595 ? 2810 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 19.894 ? 290 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.036 ? 310 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 342 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.08 . . 129 2502 100.00 . . . . 0.2731 . . . . . . . . . . . 0.3228 'X-RAY DIFFRACTION' 2.08 2.17 . . 131 2515 100.00 . . . . 0.2548 . . . . . . . . . . . 0.3046 'X-RAY DIFFRACTION' 2.17 2.29 . . 133 2498 99.00 . . . . 0.2541 . . . . . . . . . . . 0.3080 'X-RAY DIFFRACTION' 2.29 2.43 . . 139 2531 100.00 . . . . 0.2182 . . . . . . . . . . . 0.2935 'X-RAY DIFFRACTION' 2.43 2.62 . . 139 2540 100.00 . . . . 0.2347 . . . . . . . . . . . 0.2982 'X-RAY DIFFRACTION' 2.62 2.88 . . 148 2563 100.00 . . . . 0.2368 . . . . . . . . . . . 0.2731 'X-RAY DIFFRACTION' 2.89 3.30 . . 146 2551 100.00 . . . . 0.2396 . . . . . . . . . . . 0.2778 'X-RAY DIFFRACTION' 3.30 4.16 . . 128 2637 100.00 . . . . 0.1935 . . . . . . . . . . . 0.2195 'X-RAY DIFFRACTION' 4.16 33.09 . . 138 2786 100.00 . . . . 0.2121 . . . . . . . . . . . 0.2183 # _struct.entry_id 8U57 _struct.title 'PPARg LBD in complex with perfluorooctanoic acid (PFOA)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8U57 _struct_keywords.text 'Nuclear receptor ligand-binding domain, NUCLEAR PROTEIN' _struct_keywords.pdbx_keywords 'NUCLEAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 2 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPARG_HUMAN _struct_ref.pdbx_db_accession P37231 _struct_ref.pdbx_db_isoform P37231-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIF QGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDL RQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY ; _struct_ref.pdbx_align_begin 203 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8U57 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 16 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 290 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37231 _struct_ref_seq.db_align_beg 203 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 477 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 203 _struct_ref_seq.pdbx_auth_seq_align_end 477 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 8U57 MET A 1 ? UNP P37231 ? ? 'initiating methionine' 188 1 1 8U57 ALA A 2 ? UNP P37231 ? ? 'expression tag' 189 2 1 8U57 HIS A 3 ? UNP P37231 ? ? 'expression tag' 190 3 1 8U57 HIS A 4 ? UNP P37231 ? ? 'expression tag' 191 4 1 8U57 HIS A 5 ? UNP P37231 ? ? 'expression tag' 192 5 1 8U57 HIS A 6 ? UNP P37231 ? ? 'expression tag' 193 6 1 8U57 HIS A 7 ? UNP P37231 ? ? 'expression tag' 194 7 1 8U57 HIS A 8 ? UNP P37231 ? ? 'expression tag' 195 8 1 8U57 VAL A 9 ? UNP P37231 ? ? 'expression tag' 196 9 1 8U57 ASP A 10 ? UNP P37231 ? ? 'expression tag' 197 10 1 8U57 ASP A 11 ? UNP P37231 ? ? 'expression tag' 198 11 1 8U57 ASP A 12 ? UNP P37231 ? ? 'expression tag' 199 12 1 8U57 ASP A 13 ? UNP P37231 ? ? 'expression tag' 200 13 1 8U57 LYS A 14 ? UNP P37231 ? ? 'expression tag' 201 14 1 8U57 MET A 15 ? UNP P37231 ? ? 'expression tag' 202 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 20 ? PHE A 39 ? GLU A 207 PHE A 226 1 ? 20 HELX_P HELX_P2 AA2 THR A 42 ? GLY A 52 ? THR A 229 GLY A 239 1 ? 11 HELX_P HELX_P3 AA3 ASP A 64 ? ILE A 75 ? ASP A 251 ILE A 262 1 ? 12 HELX_P HELX_P4 AA4 VAL A 90 ? LYS A 114 ? VAL A 277 LYS A 301 1 ? 25 HELX_P HELX_P5 AA5 ASP A 123 ? SER A 145 ? ASP A 310 SER A 332 1 ? 23 HELX_P HELX_P6 AA6 ARG A 163 ? LEU A 169 ? ARG A 350 LEU A 356 1 ? 7 HELX_P HELX_P7 AA7 PRO A 172 ? PHE A 176 ? PRO A 359 PHE A 363 5 ? 5 HELX_P HELX_P8 AA8 MET A 177 ? ALA A 189 ? MET A 364 ALA A 376 1 ? 13 HELX_P HELX_P9 AA9 ASP A 193 ? LEU A 206 ? ASP A 380 LEU A 393 1 ? 14 HELX_P HELX_P10 AB1 ASN A 215 ? HIS A 238 ? ASN A 402 HIS A 425 1 ? 24 HELX_P HELX_P11 AB2 GLN A 243 ? ILE A 269 ? GLN A 430 ILE A 456 1 ? 27 HELX_P HELX_P12 AB3 HIS A 279 ? LYS A 287 ? HIS A 466 LYS A 474 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 97 C ? ? ? 1_555 A CSO 98 N A ? A GLY 284 A CSO 285 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A GLY 97 C ? ? ? 1_555 A CSO 98 N B ? A GLY 284 A CSO 285 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A CSO 98 C A ? ? 1_555 A GLN 99 N ? ? A CSO 285 A GLN 286 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A CSO 98 C B ? ? 1_555 A GLN 99 N ? ? A CSO 285 A GLN 286 1_555 ? ? ? ? ? ? ? 1.331 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CSO A 98 A . . . . CSO A 285 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' 2 CSO A 98 B . . . . CSO A 285 ? 1_555 . . . . . . . CYS 1 CSO Hydroxylation 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 171 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 358 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 172 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 359 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.29 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 60 ? ILE A 62 ? PHE A 247 ILE A 249 AA1 2 GLY A 159 ? THR A 162 ? GLY A 346 THR A 349 AA1 3 GLY A 151 ? ILE A 154 ? GLY A 338 ILE A 341 AA1 4 MET A 147 ? ASN A 148 ? MET A 334 ASN A 335 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 62 ? N ILE A 249 O PHE A 160 ? O PHE A 347 AA1 2 3 O GLY A 159 ? O GLY A 346 N ILE A 154 ? N ILE A 341 AA1 3 4 O GLY A 151 ? O GLY A 338 N ASN A 148 ? N ASN A 335 # _pdbx_entry_details.entry_id 8U57 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSO _pdbx_struct_mod_residue.label_seq_id 98 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSO _pdbx_struct_mod_residue.auth_seq_id 285 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id 8PF _pdbx_struct_special_symmetry.auth_seq_id 501 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id 8PF _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 188 ? A MET 1 2 1 Y 1 A ALA 189 ? A ALA 2 3 1 Y 1 A HIS 190 ? A HIS 3 4 1 Y 1 A HIS 191 ? A HIS 4 5 1 Y 1 A HIS 192 ? A HIS 5 6 1 Y 1 A HIS 193 ? A HIS 6 7 1 Y 1 A HIS 194 ? A HIS 7 8 1 Y 1 A HIS 195 ? A HIS 8 9 1 Y 1 A VAL 196 ? A VAL 9 10 1 Y 1 A ASP 197 ? A ASP 10 11 1 Y 1 A ASP 198 ? A ASP 11 12 1 Y 1 A ASP 199 ? A ASP 12 13 1 Y 1 A ASP 200 ? A ASP 13 14 1 Y 1 A LYS 201 ? A LYS 14 15 1 Y 1 A MET 202 ? A MET 15 16 1 Y 1 A GLN 203 ? A GLN 16 17 1 Y 1 A LEU 204 ? A LEU 17 18 1 Y 1 A ASN 205 ? A ASN 18 19 1 Y 1 A PRO 206 ? A PRO 19 20 1 Y 1 A THR 241 ? A THR 54 21 1 Y 1 A THR 242 ? A THR 55 22 1 Y 1 A ASP 243 ? A ASP 56 23 1 Y 1 A LYS 244 ? A LYS 57 24 1 Y 1 A LYS 263 ? A LYS 76 25 1 Y 1 A PHE 264 ? A PHE 77 26 1 Y 1 A LYS 265 ? A LYS 78 27 1 Y 1 A HIS 266 ? A HIS 79 28 1 Y 1 A ILE 267 ? A ILE 80 29 1 Y 1 A THR 268 ? A THR 81 30 1 Y 1 A PRO 269 ? A PRO 82 31 1 Y 1 A LEU 270 ? A LEU 83 32 1 Y 1 A GLN 271 ? A GLN 84 33 1 Y 1 A GLU 272 ? A GLU 85 34 1 Y 1 A GLN 273 ? A GLN 86 35 1 Y 1 A SER 274 ? A SER 87 36 1 Y 1 A LYS 275 ? A LYS 88 37 1 Y 1 A LYS 457 ? A LYS 270 38 1 Y 1 A LYS 458 ? A LYS 271 39 1 Y 1 A THR 459 ? A THR 272 40 1 Y 1 A GLU 460 ? A GLU 273 41 1 Y 1 A THR 461 ? A THR 274 42 1 Y 1 A ASP 462 ? A ASP 275 43 1 Y 1 A MET 463 ? A MET 276 44 1 Y 1 A SER 464 ? A SER 277 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8PF C13 C N N 1 8PF C16 C N N 2 8PF C19 C N N 3 8PF C10 C N N 4 8PF C22 C N N 5 8PF F01 F N N 6 8PF C02 C N N 7 8PF F03 F N N 8 8PF C04 C N N 9 8PF F05 F N N 10 8PF F06 F N N 11 8PF C07 C N N 12 8PF O08 O N N 13 8PF O09 O N N 14 8PF F11 F N N 15 8PF F12 F N N 16 8PF F14 F N N 17 8PF F15 F N N 18 8PF F17 F N N 19 8PF F18 F N N 20 8PF F20 F N N 21 8PF F21 F N N 22 8PF F23 F N N 23 8PF F24 F N N 24 8PF F25 F N N 25 8PF H1 H N N 26 ALA N N N N 27 ALA CA C N S 28 ALA C C N N 29 ALA O O N N 30 ALA CB C N N 31 ALA OXT O N N 32 ALA H H N N 33 ALA H2 H N N 34 ALA HA H N N 35 ALA HB1 H N N 36 ALA HB2 H N N 37 ALA HB3 H N N 38 ALA HXT H N N 39 ARG N N N N 40 ARG CA C N S 41 ARG C C N N 42 ARG O O N N 43 ARG CB C N N 44 ARG CG C N N 45 ARG CD C N N 46 ARG NE N N N 47 ARG CZ C N N 48 ARG NH1 N N N 49 ARG NH2 N N N 50 ARG OXT O N N 51 ARG H H N N 52 ARG H2 H N N 53 ARG HA H N N 54 ARG HB2 H N N 55 ARG HB3 H N N 56 ARG HG2 H N N 57 ARG HG3 H N N 58 ARG HD2 H N N 59 ARG HD3 H N N 60 ARG HE H N N 61 ARG HH11 H N N 62 ARG HH12 H N N 63 ARG HH21 H N N 64 ARG HH22 H N N 65 ARG HXT H N N 66 ASN N N N N 67 ASN CA C N S 68 ASN C C N N 69 ASN O O N N 70 ASN CB C N N 71 ASN CG C N N 72 ASN OD1 O N N 73 ASN ND2 N N N 74 ASN OXT O N N 75 ASN H H N N 76 ASN H2 H N N 77 ASN HA H N N 78 ASN HB2 H N N 79 ASN HB3 H N N 80 ASN HD21 H N N 81 ASN HD22 H N N 82 ASN HXT H N N 83 ASP N N N N 84 ASP CA C N S 85 ASP C C N N 86 ASP O O N N 87 ASP CB C N N 88 ASP CG C N N 89 ASP OD1 O N N 90 ASP OD2 O N N 91 ASP OXT O N N 92 ASP H H N N 93 ASP H2 H N N 94 ASP HA H N N 95 ASP HB2 H N N 96 ASP HB3 H N N 97 ASP HD2 H N N 98 ASP HXT H N N 99 CSO N N N N 100 CSO CA C N R 101 CSO CB C N N 102 CSO SG S N N 103 CSO C C N N 104 CSO O O N N 105 CSO OXT O N N 106 CSO OD O N N 107 CSO H H N N 108 CSO H2 H N N 109 CSO HA H N N 110 CSO HB2 H N N 111 CSO HB3 H N N 112 CSO HXT H N N 113 CSO HD H N N 114 D1D S1 S N N 115 D1D C1 C N N 116 D1D C2 C N S 117 D1D O2 O N N 118 D1D C3 C N S 119 D1D O3 O N N 120 D1D C4 C N N 121 D1D S4 S N N 122 D1D H1C1 H N N 123 D1D H1C2 H N N 124 D1D H2 H N N 125 D1D HA H N N 126 D1D H3 H N N 127 D1D HB H N N 128 D1D H4C1 H N N 129 D1D H4C2 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TYR N N N N 364 TYR CA C N S 365 TYR C C N N 366 TYR O O N N 367 TYR CB C N N 368 TYR CG C Y N 369 TYR CD1 C Y N 370 TYR CD2 C Y N 371 TYR CE1 C Y N 372 TYR CE2 C Y N 373 TYR CZ C Y N 374 TYR OH O N N 375 TYR OXT O N N 376 TYR H H N N 377 TYR H2 H N N 378 TYR HA H N N 379 TYR HB2 H N N 380 TYR HB3 H N N 381 TYR HD1 H N N 382 TYR HD2 H N N 383 TYR HE1 H N N 384 TYR HE2 H N N 385 TYR HH H N N 386 TYR HXT H N N 387 VAL N N N N 388 VAL CA C N S 389 VAL C C N N 390 VAL O O N N 391 VAL CB C N N 392 VAL CG1 C N N 393 VAL CG2 C N N 394 VAL OXT O N N 395 VAL H H N N 396 VAL H2 H N N 397 VAL HA H N N 398 VAL HB H N N 399 VAL HG11 H N N 400 VAL HG12 H N N 401 VAL HG13 H N N 402 VAL HG21 H N N 403 VAL HG22 H N N 404 VAL HG23 H N N 405 VAL HXT H N N 406 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8PF O09 C07 doub N N 1 8PF O08 C07 sing N N 2 8PF C07 C04 sing N N 3 8PF F06 C04 sing N N 4 8PF C04 F05 sing N N 5 8PF C04 C02 sing N N 6 8PF F01 C02 sing N N 7 8PF C02 F03 sing N N 8 8PF C02 C10 sing N N 9 8PF F11 C10 sing N N 10 8PF C10 F12 sing N N 11 8PF C10 C13 sing N N 12 8PF F14 C13 sing N N 13 8PF C13 F15 sing N N 14 8PF C13 C16 sing N N 15 8PF F17 C16 sing N N 16 8PF C16 F18 sing N N 17 8PF C16 C19 sing N N 18 8PF F24 C22 sing N N 19 8PF C19 C22 sing N N 20 8PF C19 F21 sing N N 21 8PF C19 F20 sing N N 22 8PF C22 F25 sing N N 23 8PF C22 F23 sing N N 24 8PF O08 H1 sing N N 25 ALA N CA sing N N 26 ALA N H sing N N 27 ALA N H2 sing N N 28 ALA CA C sing N N 29 ALA CA CB sing N N 30 ALA CA HA sing N N 31 ALA C O doub N N 32 ALA C OXT sing N N 33 ALA CB HB1 sing N N 34 ALA CB HB2 sing N N 35 ALA CB HB3 sing N N 36 ALA OXT HXT sing N N 37 ARG N CA sing N N 38 ARG N H sing N N 39 ARG N H2 sing N N 40 ARG CA C sing N N 41 ARG CA CB sing N N 42 ARG CA HA sing N N 43 ARG C O doub N N 44 ARG C OXT sing N N 45 ARG CB CG sing N N 46 ARG CB HB2 sing N N 47 ARG CB HB3 sing N N 48 ARG CG CD sing N N 49 ARG CG HG2 sing N N 50 ARG CG HG3 sing N N 51 ARG CD NE sing N N 52 ARG CD HD2 sing N N 53 ARG CD HD3 sing N N 54 ARG NE CZ sing N N 55 ARG NE HE sing N N 56 ARG CZ NH1 sing N N 57 ARG CZ NH2 doub N N 58 ARG NH1 HH11 sing N N 59 ARG NH1 HH12 sing N N 60 ARG NH2 HH21 sing N N 61 ARG NH2 HH22 sing N N 62 ARG OXT HXT sing N N 63 ASN N CA sing N N 64 ASN N H sing N N 65 ASN N H2 sing N N 66 ASN CA C sing N N 67 ASN CA CB sing N N 68 ASN CA HA sing N N 69 ASN C O doub N N 70 ASN C OXT sing N N 71 ASN CB CG sing N N 72 ASN CB HB2 sing N N 73 ASN CB HB3 sing N N 74 ASN CG OD1 doub N N 75 ASN CG ND2 sing N N 76 ASN ND2 HD21 sing N N 77 ASN ND2 HD22 sing N N 78 ASN OXT HXT sing N N 79 ASP N CA sing N N 80 ASP N H sing N N 81 ASP N H2 sing N N 82 ASP CA C sing N N 83 ASP CA CB sing N N 84 ASP CA HA sing N N 85 ASP C O doub N N 86 ASP C OXT sing N N 87 ASP CB CG sing N N 88 ASP CB HB2 sing N N 89 ASP CB HB3 sing N N 90 ASP CG OD1 doub N N 91 ASP CG OD2 sing N N 92 ASP OD2 HD2 sing N N 93 ASP OXT HXT sing N N 94 CSO N CA sing N N 95 CSO N H sing N N 96 CSO N H2 sing N N 97 CSO CA CB sing N N 98 CSO CA C sing N N 99 CSO CA HA sing N N 100 CSO CB SG sing N N 101 CSO CB HB2 sing N N 102 CSO CB HB3 sing N N 103 CSO SG OD sing N N 104 CSO C O doub N N 105 CSO C OXT sing N N 106 CSO OXT HXT sing N N 107 CSO OD HD sing N N 108 D1D S1 C1 sing N N 109 D1D S1 S4 sing N N 110 D1D C1 C2 sing N N 111 D1D C1 H1C1 sing N N 112 D1D C1 H1C2 sing N N 113 D1D C2 O2 sing N N 114 D1D C2 C3 sing N N 115 D1D C2 H2 sing N N 116 D1D O2 HA sing N N 117 D1D C3 O3 sing N N 118 D1D C3 C4 sing N N 119 D1D C3 H3 sing N N 120 D1D O3 HB sing N N 121 D1D C4 S4 sing N N 122 D1D C4 H4C1 sing N N 123 D1D C4 H4C2 sing N N 124 GLN N CA sing N N 125 GLN N H sing N N 126 GLN N H2 sing N N 127 GLN CA C sing N N 128 GLN CA CB sing N N 129 GLN CA HA sing N N 130 GLN C O doub N N 131 GLN C OXT sing N N 132 GLN CB CG sing N N 133 GLN CB HB2 sing N N 134 GLN CB HB3 sing N N 135 GLN CG CD sing N N 136 GLN CG HG2 sing N N 137 GLN CG HG3 sing N N 138 GLN CD OE1 doub N N 139 GLN CD NE2 sing N N 140 GLN NE2 HE21 sing N N 141 GLN NE2 HE22 sing N N 142 GLN OXT HXT sing N N 143 GLU N CA sing N N 144 GLU N H sing N N 145 GLU N H2 sing N N 146 GLU CA C sing N N 147 GLU CA CB sing N N 148 GLU CA HA sing N N 149 GLU C O doub N N 150 GLU C OXT sing N N 151 GLU CB CG sing N N 152 GLU CB HB2 sing N N 153 GLU CB HB3 sing N N 154 GLU CG CD sing N N 155 GLU CG HG2 sing N N 156 GLU CG HG3 sing N N 157 GLU CD OE1 doub N N 158 GLU CD OE2 sing N N 159 GLU OE2 HE2 sing N N 160 GLU OXT HXT sing N N 161 GLY N CA sing N N 162 GLY N H sing N N 163 GLY N H2 sing N N 164 GLY CA C sing N N 165 GLY CA HA2 sing N N 166 GLY CA HA3 sing N N 167 GLY C O doub N N 168 GLY C OXT sing N N 169 GLY OXT HXT sing N N 170 HIS N CA sing N N 171 HIS N H sing N N 172 HIS N H2 sing N N 173 HIS CA C sing N N 174 HIS CA CB sing N N 175 HIS CA HA sing N N 176 HIS C O doub N N 177 HIS C OXT sing N N 178 HIS CB CG sing N N 179 HIS CB HB2 sing N N 180 HIS CB HB3 sing N N 181 HIS CG ND1 sing Y N 182 HIS CG CD2 doub Y N 183 HIS ND1 CE1 doub Y N 184 HIS ND1 HD1 sing N N 185 HIS CD2 NE2 sing Y N 186 HIS CD2 HD2 sing N N 187 HIS CE1 NE2 sing Y N 188 HIS CE1 HE1 sing N N 189 HIS NE2 HE2 sing N N 190 HIS OXT HXT sing N N 191 HOH O H1 sing N N 192 HOH O H2 sing N N 193 ILE N CA sing N N 194 ILE N H sing N N 195 ILE N H2 sing N N 196 ILE CA C sing N N 197 ILE CA CB sing N N 198 ILE CA HA sing N N 199 ILE C O doub N N 200 ILE C OXT sing N N 201 ILE CB CG1 sing N N 202 ILE CB CG2 sing N N 203 ILE CB HB sing N N 204 ILE CG1 CD1 sing N N 205 ILE CG1 HG12 sing N N 206 ILE CG1 HG13 sing N N 207 ILE CG2 HG21 sing N N 208 ILE CG2 HG22 sing N N 209 ILE CG2 HG23 sing N N 210 ILE CD1 HD11 sing N N 211 ILE CD1 HD12 sing N N 212 ILE CD1 HD13 sing N N 213 ILE OXT HXT sing N N 214 LEU N CA sing N N 215 LEU N H sing N N 216 LEU N H2 sing N N 217 LEU CA C sing N N 218 LEU CA CB sing N N 219 LEU CA HA sing N N 220 LEU C O doub N N 221 LEU C OXT sing N N 222 LEU CB CG sing N N 223 LEU CB HB2 sing N N 224 LEU CB HB3 sing N N 225 LEU CG CD1 sing N N 226 LEU CG CD2 sing N N 227 LEU CG HG sing N N 228 LEU CD1 HD11 sing N N 229 LEU CD1 HD12 sing N N 230 LEU CD1 HD13 sing N N 231 LEU CD2 HD21 sing N N 232 LEU CD2 HD22 sing N N 233 LEU CD2 HD23 sing N N 234 LEU OXT HXT sing N N 235 LYS N CA sing N N 236 LYS N H sing N N 237 LYS N H2 sing N N 238 LYS CA C sing N N 239 LYS CA CB sing N N 240 LYS CA HA sing N N 241 LYS C O doub N N 242 LYS C OXT sing N N 243 LYS CB CG sing N N 244 LYS CB HB2 sing N N 245 LYS CB HB3 sing N N 246 LYS CG CD sing N N 247 LYS CG HG2 sing N N 248 LYS CG HG3 sing N N 249 LYS CD CE sing N N 250 LYS CD HD2 sing N N 251 LYS CD HD3 sing N N 252 LYS CE NZ sing N N 253 LYS CE HE2 sing N N 254 LYS CE HE3 sing N N 255 LYS NZ HZ1 sing N N 256 LYS NZ HZ2 sing N N 257 LYS NZ HZ3 sing N N 258 LYS OXT HXT sing N N 259 MET N CA sing N N 260 MET N H sing N N 261 MET N H2 sing N N 262 MET CA C sing N N 263 MET CA CB sing N N 264 MET CA HA sing N N 265 MET C O doub N N 266 MET C OXT sing N N 267 MET CB CG sing N N 268 MET CB HB2 sing N N 269 MET CB HB3 sing N N 270 MET CG SD sing N N 271 MET CG HG2 sing N N 272 MET CG HG3 sing N N 273 MET SD CE sing N N 274 MET CE HE1 sing N N 275 MET CE HE2 sing N N 276 MET CE HE3 sing N N 277 MET OXT HXT sing N N 278 PHE N CA sing N N 279 PHE N H sing N N 280 PHE N H2 sing N N 281 PHE CA C sing N N 282 PHE CA CB sing N N 283 PHE CA HA sing N N 284 PHE C O doub N N 285 PHE C OXT sing N N 286 PHE CB CG sing N N 287 PHE CB HB2 sing N N 288 PHE CB HB3 sing N N 289 PHE CG CD1 doub Y N 290 PHE CG CD2 sing Y N 291 PHE CD1 CE1 sing Y N 292 PHE CD1 HD1 sing N N 293 PHE CD2 CE2 doub Y N 294 PHE CD2 HD2 sing N N 295 PHE CE1 CZ doub Y N 296 PHE CE1 HE1 sing N N 297 PHE CE2 CZ sing Y N 298 PHE CE2 HE2 sing N N 299 PHE CZ HZ sing N N 300 PHE OXT HXT sing N N 301 PRO N CA sing N N 302 PRO N CD sing N N 303 PRO N H sing N N 304 PRO CA C sing N N 305 PRO CA CB sing N N 306 PRO CA HA sing N N 307 PRO C O doub N N 308 PRO C OXT sing N N 309 PRO CB CG sing N N 310 PRO CB HB2 sing N N 311 PRO CB HB3 sing N N 312 PRO CG CD sing N N 313 PRO CG HG2 sing N N 314 PRO CG HG3 sing N N 315 PRO CD HD2 sing N N 316 PRO CD HD3 sing N N 317 PRO OXT HXT sing N N 318 SER N CA sing N N 319 SER N H sing N N 320 SER N H2 sing N N 321 SER CA C sing N N 322 SER CA CB sing N N 323 SER CA HA sing N N 324 SER C O doub N N 325 SER C OXT sing N N 326 SER CB OG sing N N 327 SER CB HB2 sing N N 328 SER CB HB3 sing N N 329 SER OG HG sing N N 330 SER OXT HXT sing N N 331 THR N CA sing N N 332 THR N H sing N N 333 THR N H2 sing N N 334 THR CA C sing N N 335 THR CA CB sing N N 336 THR CA HA sing N N 337 THR C O doub N N 338 THR C OXT sing N N 339 THR CB OG1 sing N N 340 THR CB CG2 sing N N 341 THR CB HB sing N N 342 THR OG1 HG1 sing N N 343 THR CG2 HG21 sing N N 344 THR CG2 HG22 sing N N 345 THR CG2 HG23 sing N N 346 THR OXT HXT sing N N 347 TYR N CA sing N N 348 TYR N H sing N N 349 TYR N H2 sing N N 350 TYR CA C sing N N 351 TYR CA CB sing N N 352 TYR CA HA sing N N 353 TYR C O doub N N 354 TYR C OXT sing N N 355 TYR CB CG sing N N 356 TYR CB HB2 sing N N 357 TYR CB HB3 sing N N 358 TYR CG CD1 doub Y N 359 TYR CG CD2 sing Y N 360 TYR CD1 CE1 sing Y N 361 TYR CD1 HD1 sing N N 362 TYR CD2 CE2 doub Y N 363 TYR CD2 HD2 sing N N 364 TYR CE1 CZ doub Y N 365 TYR CE1 HE1 sing N N 366 TYR CE2 CZ sing Y N 367 TYR CE2 HE2 sing N N 368 TYR CZ OH sing N N 369 TYR OH HH sing N N 370 TYR OXT HXT sing N N 371 VAL N CA sing N N 372 VAL N H sing N N 373 VAL N H2 sing N N 374 VAL CA C sing N N 375 VAL CA CB sing N N 376 VAL CA HA sing N N 377 VAL C O doub N N 378 VAL C OXT sing N N 379 VAL CB CG1 sing N N 380 VAL CB CG2 sing N N 381 VAL CB HB sing N N 382 VAL CG1 HG11 sing N N 383 VAL CG1 HG12 sing N N 384 VAL CG1 HG13 sing N N 385 VAL CG2 HG21 sing N N 386 VAL CG2 HG22 sing N N 387 VAL CG2 HG23 sing N N 388 VAL OXT HXT sing N N 389 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code 6E5A _pdbx_initial_refinement_model.details 'Chain A of 6E5A' _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.type 'experimental model' # _atom_sites.entry_id 8U57 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015112 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015112 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006372 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_