data_8UBH # _entry.id 8UBH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 8UBH pdb_00008ubh 10.2210/pdb8ubh/pdb WWPDB D_1000277756 ? ? BMRB 31107 ? 10.13018/BMR31107 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-10-25 2 'Structure model' 1 1 2023-11-08 3 'Structure model' 2 0 2023-11-29 4 'Structure model' 2 1 2023-12-20 5 'Structure model' 2 2 2024-02-07 6 'Structure model' 2 3 2024-05-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' author 'Coordinate replacement' 'Model orientation/position' 'Replaced model to fixed Cis-peptides' # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Database references' 8 5 'Structure model' 'Database references' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author 3 2 'Structure model' struct_keywords 4 3 'Structure model' atom_site 5 3 'Structure model' pdbx_contact_author 6 3 'Structure model' pdbx_nmr_ensemble 7 3 'Structure model' pdbx_struct_sheet_hbond 8 3 'Structure model' pdbx_validate_torsion 9 3 'Structure model' struct_conf 10 3 'Structure model' struct_mon_prot_cis 11 3 'Structure model' struct_sheet_range 12 4 'Structure model' citation 13 4 'Structure model' citation_author 14 5 'Structure model' citation 15 5 'Structure model' citation_author 16 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_struct_keywords.pdbx_keywords' 3 2 'Structure model' '_struct_keywords.text' 4 3 'Structure model' '_atom_site.Cartn_x' 5 3 'Structure model' '_atom_site.Cartn_y' 6 3 'Structure model' '_atom_site.Cartn_z' 7 3 'Structure model' '_pdbx_nmr_ensemble.conformers_calculated_total_number' 8 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_comp_id' 9 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_comp_id' 11 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 12 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_comp_id' 15 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 16 3 'Structure model' '_struct_conf.end_auth_comp_id' 17 3 'Structure model' '_struct_conf.end_auth_seq_id' 18 3 'Structure model' '_struct_conf.end_label_comp_id' 19 3 'Structure model' '_struct_conf.end_label_seq_id' 20 3 'Structure model' '_struct_conf.pdbx_PDB_helix_length' 21 3 'Structure model' '_struct_mon_prot_cis.auth_comp_id' 22 3 'Structure model' '_struct_mon_prot_cis.auth_seq_id' 23 3 'Structure model' '_struct_mon_prot_cis.label_comp_id' 24 3 'Structure model' '_struct_mon_prot_cis.label_seq_id' 25 3 'Structure model' '_struct_mon_prot_cis.pdbx_auth_comp_id_2' 26 3 'Structure model' '_struct_mon_prot_cis.pdbx_auth_seq_id_2' 27 3 'Structure model' '_struct_mon_prot_cis.pdbx_label_comp_id_2' 28 3 'Structure model' '_struct_mon_prot_cis.pdbx_label_seq_id_2' 29 3 'Structure model' '_struct_mon_prot_cis.pdbx_omega_angle' 30 3 'Structure model' '_struct_sheet_range.beg_auth_comp_id' 31 3 'Structure model' '_struct_sheet_range.beg_auth_seq_id' 32 3 'Structure model' '_struct_sheet_range.beg_label_comp_id' 33 3 'Structure model' '_struct_sheet_range.beg_label_seq_id' 34 3 'Structure model' '_struct_sheet_range.end_auth_comp_id' 35 3 'Structure model' '_struct_sheet_range.end_auth_seq_id' 36 3 'Structure model' '_struct_sheet_range.end_label_comp_id' 37 3 'Structure model' '_struct_sheet_range.end_label_seq_id' 38 4 'Structure model' '_citation.country' 39 4 'Structure model' '_citation.journal_abbrev' 40 4 'Structure model' '_citation.journal_id_ASTM' 41 4 'Structure model' '_citation.journal_id_CSD' 42 4 'Structure model' '_citation.journal_id_ISSN' 43 4 'Structure model' '_citation.pdbx_database_id_DOI' 44 4 'Structure model' '_citation.pdbx_database_id_PubMed' 45 4 'Structure model' '_citation.title' 46 4 'Structure model' '_citation.year' 47 4 'Structure model' '_citation_author.identifier_ORCID' 48 5 'Structure model' '_citation.journal_volume' 49 5 'Structure model' '_citation.page_first' 50 5 'Structure model' '_citation.page_last' 51 5 'Structure model' '_citation.year' 52 5 'Structure model' '_citation_author.identifier_ORCID' 53 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 8UBH _pdbx_database_status.recvd_initial_deposition_date 2023-09-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of KaiB variant from Thermosynechococcus elongatus vestitus (KaiBTV-4)' _pdbx_database_related.db_id 31107 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email dkern@brandeis.edu _pdbx_contact_author.name_first Dorothee _pdbx_contact_author.name_last Kern _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7631-8328 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ojoawo, A.' 1 0000-0003-3961-8935 'Wayment-Steele, H.K.' 2 0000-0003-4949-2010 'Kern, D.' 3 0000-0002-7631-8328 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 625 _citation.language ? _citation.page_first 832 _citation.page_last 839 _citation.title 'Predicting multiple conformations via sequence clustering and AlphaFold2.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-023-06832-9 _citation.pdbx_database_id_PubMed 37956700 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wayment-Steele, H.K.' 1 ? primary 'Ojoawo, A.' 2 ? primary 'Otten, R.' 3 ? primary 'Apitz, J.M.' 4 ? primary 'Pitsawong, W.' 5 ? primary 'Homberger, M.' 6 ? primary 'Ovchinnikov, S.' 7 ? primary 'Colwell, L.' 8 ? primary 'Kern, D.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Circadian oscillation regulator' _entity.formula_weight 9920.542 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MYVFRLYVRGETHAAEVALKNLHDLLSSALKVPYTLKVVDVTKQPDLAEKDQVQATPTLVRVYPQPVRRLVGQLDHRYRL QHLLSP ; _entity_poly.pdbx_seq_one_letter_code_can ;MYVFRLYVRGETHAAEVALKNLHDLLSSALKVPYTLKVVDVTKQPDLAEKDQVQATPTLVRVYPQPVRRLVGQLDHRYRL QHLLSP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TYR n 1 3 VAL n 1 4 PHE n 1 5 ARG n 1 6 LEU n 1 7 TYR n 1 8 VAL n 1 9 ARG n 1 10 GLY n 1 11 GLU n 1 12 THR n 1 13 HIS n 1 14 ALA n 1 15 ALA n 1 16 GLU n 1 17 VAL n 1 18 ALA n 1 19 LEU n 1 20 LYS n 1 21 ASN n 1 22 LEU n 1 23 HIS n 1 24 ASP n 1 25 LEU n 1 26 LEU n 1 27 SER n 1 28 SER n 1 29 ALA n 1 30 LEU n 1 31 LYS n 1 32 VAL n 1 33 PRO n 1 34 TYR n 1 35 THR n 1 36 LEU n 1 37 LYS n 1 38 VAL n 1 39 VAL n 1 40 ASP n 1 41 VAL n 1 42 THR n 1 43 LYS n 1 44 GLN n 1 45 PRO n 1 46 ASP n 1 47 LEU n 1 48 ALA n 1 49 GLU n 1 50 LYS n 1 51 ASP n 1 52 GLN n 1 53 VAL n 1 54 GLN n 1 55 ALA n 1 56 THR n 1 57 PRO n 1 58 THR n 1 59 LEU n 1 60 VAL n 1 61 ARG n 1 62 VAL n 1 63 TYR n 1 64 PRO n 1 65 GLN n 1 66 PRO n 1 67 VAL n 1 68 ARG n 1 69 ARG n 1 70 LEU n 1 71 VAL n 1 72 GLY n 1 73 GLN n 1 74 LEU n 1 75 ASP n 1 76 HIS n 1 77 ARG n 1 78 TYR n 1 79 ARG n 1 80 LEU n 1 81 GLN n 1 82 HIS n 1 83 LEU n 1 84 LEU n 1 85 SER n 1 86 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 86 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tll0553 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NIES-2133 / IAM M-273 / BP-1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermosynechococcus vestitus BP-1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 197221 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 PRO 86 86 86 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 8UBH _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 8UBH _struct.title 'Solution NMR structure of KaiB variant from Thermosynechococcus elongatus vestitus (KaiBTV-4)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 8UBH _struct_keywords.text 'Protein folding, metamorphic protein, Fold-switching, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8DLE2_THEVB _struct_ref.pdbx_db_accession Q8DLE2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YVFRLYVRGETHAAEVALKNLHDLLSSALKVPYTLKVVDVTKQPDLAEKDQVQATPTLVRVYPQPVRRLVGQLDHRYRLQ HLLSP ; _struct_ref.pdbx_align_begin 183 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 8UBH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8DLE2 _struct_ref_seq.db_align_beg 183 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 267 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 86 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 8UBH _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8DLE2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 12 ? LEU A 30 ? THR A 12 LEU A 30 1 ? 19 HELX_P HELX_P2 AA2 GLN A 44 ? GLN A 52 ? GLN A 44 GLN A 52 1 ? 9 HELX_P HELX_P3 AA3 HIS A 76 ? SER A 85 ? HIS A 76 SER A 85 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 1 -5.70 2 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 1 0.95 3 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 1 -0.36 4 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 2 -5.33 5 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 2 1.80 6 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 2 0.15 7 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 3 -3.82 8 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 3 -3.23 9 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 3 1.35 10 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 4 -4.25 11 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 4 0.95 12 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 4 0.13 13 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 5 -4.61 14 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 5 1.17 15 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 5 0.20 16 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 6 -5.19 17 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 6 0.54 18 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 6 0.13 19 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 7 -4.86 20 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 7 -3.55 21 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 7 -0.40 22 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 8 -4.24 23 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 8 0.98 24 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 8 0.57 25 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 9 -5.19 26 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 9 1.30 27 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 9 0.89 28 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 10 -6.52 29 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 10 1.93 30 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 10 1.58 31 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 11 -5.95 32 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 11 -4.81 33 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 11 -0.57 34 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 12 -4.89 35 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 12 -4.93 36 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 12 0.67 37 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 13 -2.39 38 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 13 1.40 39 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 13 0.00 40 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 14 -3.36 41 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 14 1.54 42 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 14 -0.05 43 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 15 -2.58 44 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 15 -3.45 45 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 15 0.09 46 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 16 -5.39 47 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 16 1.23 48 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 16 0.75 49 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 17 -4.79 50 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 17 1.86 51 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 17 -0.55 52 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 18 -5.76 53 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 18 1.16 54 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 18 0.83 55 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 19 -2.89 56 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 19 1.55 57 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 19 0.84 58 THR 56 A . ? THR 56 A PRO 57 A ? PRO 57 A 20 -5.05 59 TYR 63 A . ? TYR 63 A PRO 64 A ? PRO 64 A 20 2.11 60 GLN 65 A . ? GLN 65 A PRO 66 A ? PRO 66 A 20 0.22 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 35 ? ASP A 40 ? THR A 35 ASP A 40 AA1 2 VAL A 3 ? VAL A 8 ? VAL A 3 VAL A 8 AA1 3 THR A 58 ? VAL A 62 ? THR A 58 VAL A 62 AA1 4 ARG A 68 ? VAL A 71 ? ARG A 68 VAL A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 35 ? O THR A 35 N PHE A 4 ? N PHE A 4 AA1 2 3 N ARG A 5 ? N ARG A 5 O VAL A 60 ? O VAL A 60 AA1 3 4 N LEU A 59 ? N LEU A 59 O LEU A 70 ? O LEU A 70 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 65 ? ? -49.26 156.80 2 1 GLN A 73 ? ? -67.70 86.20 3 2 GLN A 73 ? ? -69.41 85.89 4 3 GLN A 54 ? ? -126.36 -62.84 5 4 TYR A 63 ? ? -48.75 165.75 6 5 GLU A 11 ? ? -161.80 55.08 7 5 TYR A 63 ? ? -40.11 155.18 8 5 GLN A 73 ? ? -68.82 85.19 9 6 GLU A 11 ? ? 84.17 -31.50 10 6 GLN A 73 ? ? -66.10 91.51 11 7 LYS A 31 ? ? -93.10 41.52 12 7 GLN A 73 ? ? -66.98 96.24 13 9 GLN A 73 ? ? -67.25 89.83 14 10 GLU A 11 ? ? -100.54 -78.50 15 10 THR A 12 ? ? 53.71 135.29 16 10 GLN A 54 ? ? -131.05 -40.75 17 10 LEU A 74 ? ? -103.21 63.31 18 11 GLN A 73 ? ? -69.93 86.38 19 12 GLU A 11 ? ? 37.57 40.44 20 12 GLN A 73 ? ? -68.89 86.86 21 14 TYR A 63 ? ? -47.24 157.10 22 15 GLU A 11 ? ? 63.77 -78.21 23 15 THR A 12 ? ? 49.69 156.95 24 15 LEU A 74 ? ? -74.08 41.95 25 16 TYR A 63 ? ? -41.78 164.25 26 16 GLN A 73 ? ? -69.27 86.43 27 17 GLN A 73 ? ? -64.71 91.09 28 17 LEU A 74 ? ? -83.66 48.46 29 18 GLN A 73 ? ? -65.43 92.88 30 18 LEU A 74 ? ? -80.30 49.82 31 20 TYR A 63 ? ? -48.87 160.28 32 20 GLN A 73 ? ? -60.85 95.39 # _pdbx_nmr_ensemble.entry_id 8UBH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 8UBH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '100 mM MOPS, 50 mM sodium chloride, 2 mM TCEP, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N, 13C' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 MOPS 100 ? mM 'natural abundance' 1 'sodium chloride' 50 ? mM 'natural abundance' 1 TCEP 2 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 2 1 1 '2D 1H-13C HSQC aromatic' 4 isotropic 3 1 1 '3D CBCA(CO)NH' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '2D 1H-15N HSQC' 1 isotropic 10 1 1 '3D 1H-13C NOESY aliphatic' 4 isotropic 9 1 1 '3D 1H-13C NOESY aromatic' 4 isotropic 8 1 1 '3D C(CO)NH' 3 isotropic 7 1 1 '3D HBHA(CO)NH' 4 isotropic 11 1 1 '3D H(CCO)NH' 3 isotropic 12 1 1 '3D HCCH-TOCSY' 4 isotropic 13 1 1 '3D 1H-15N NOESY' 4 isotropic 14 1 1 '2D (HB)CB(CGCDCE)HDH AROMATIC' 4 isotropic 15 1 1 '2D (HB)CB(CGCD)HD AROMATIC' 4 isotropic # _pdbx_nmr_refine.entry_id 8UBH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 9 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' Poky ? ;Manthey, I. et al. POKY software tools encapsulating assignment strategies for solution and solid-state protein NMR data. J Struct Biol X 6, 100073 (2022). https://doi.org:10.1016/j.yjsbx.2022.100073 ; 5 'chemical shift assignment' 'PINE Server' ? ;Lee, W. et al. I-PINE web server: an integrative probabilistic NMR assignment system for proteins. J Biomol NMR 73, 213-222 (2019). https://doi.org:10.1007/s10858-019-00255-3 ; 6 collection TopSpin ? 'Bruker Biospin' 7 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'structure calculation' PONDEROSA-C/S ? ;Lee, W., Stark, J. L. & Markley, J. L. PONDEROSA-C/S: client-server based software package for automated protein 3D structure determination. J Biomol NMR 60, 73-75 (2014). https://doi.org:10.1007/s10858-014-9855-x ; 8 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 9 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 10 'structure calculation' AUDANA ? ;Lee, W., Petit, C. M., Cornilescu, G., Stark, J. L. & Markley, J. L. The AUDANA algorithm for automated protein 3D structure determination from NMR NOE data. J Biomol NMR 65, 51-57 (2016). https://doi.org:10.1007/s10858-016-0036-y ; 11 'structure calculation' TALOS-N ? ;Shen, Y. & Bax, A. Protein structural information derived from NMR chemical shift with the neural network program TALOS-N. Methods Mol Biol 1260, 17-32 (2015). https://doi.org:10.1007/978-1-4939-2239-0_2 ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 LEU N N N N 144 LEU CA C N S 145 LEU C C N N 146 LEU O O N N 147 LEU CB C N N 148 LEU CG C N N 149 LEU CD1 C N N 150 LEU CD2 C N N 151 LEU OXT O N N 152 LEU H H N N 153 LEU H2 H N N 154 LEU HA H N N 155 LEU HB2 H N N 156 LEU HB3 H N N 157 LEU HG H N N 158 LEU HD11 H N N 159 LEU HD12 H N N 160 LEU HD13 H N N 161 LEU HD21 H N N 162 LEU HD22 H N N 163 LEU HD23 H N N 164 LEU HXT H N N 165 LYS N N N N 166 LYS CA C N S 167 LYS C C N N 168 LYS O O N N 169 LYS CB C N N 170 LYS CG C N N 171 LYS CD C N N 172 LYS CE C N N 173 LYS NZ N N N 174 LYS OXT O N N 175 LYS H H N N 176 LYS H2 H N N 177 LYS HA H N N 178 LYS HB2 H N N 179 LYS HB3 H N N 180 LYS HG2 H N N 181 LYS HG3 H N N 182 LYS HD2 H N N 183 LYS HD3 H N N 184 LYS HE2 H N N 185 LYS HE3 H N N 186 LYS HZ1 H N N 187 LYS HZ2 H N N 188 LYS HZ3 H N N 189 LYS HXT H N N 190 MET N N N N 191 MET CA C N S 192 MET C C N N 193 MET O O N N 194 MET CB C N N 195 MET CG C N N 196 MET SD S N N 197 MET CE C N N 198 MET OXT O N N 199 MET H H N N 200 MET H2 H N N 201 MET HA H N N 202 MET HB2 H N N 203 MET HB3 H N N 204 MET HG2 H N N 205 MET HG3 H N N 206 MET HE1 H N N 207 MET HE2 H N N 208 MET HE3 H N N 209 MET HXT H N N 210 PHE N N N N 211 PHE CA C N S 212 PHE C C N N 213 PHE O O N N 214 PHE CB C N N 215 PHE CG C Y N 216 PHE CD1 C Y N 217 PHE CD2 C Y N 218 PHE CE1 C Y N 219 PHE CE2 C Y N 220 PHE CZ C Y N 221 PHE OXT O N N 222 PHE H H N N 223 PHE H2 H N N 224 PHE HA H N N 225 PHE HB2 H N N 226 PHE HB3 H N N 227 PHE HD1 H N N 228 PHE HD2 H N N 229 PHE HE1 H N N 230 PHE HE2 H N N 231 PHE HZ H N N 232 PHE HXT H N N 233 PRO N N N N 234 PRO CA C N S 235 PRO C C N N 236 PRO O O N N 237 PRO CB C N N 238 PRO CG C N N 239 PRO CD C N N 240 PRO OXT O N N 241 PRO H H N N 242 PRO HA H N N 243 PRO HB2 H N N 244 PRO HB3 H N N 245 PRO HG2 H N N 246 PRO HG3 H N N 247 PRO HD2 H N N 248 PRO HD3 H N N 249 PRO HXT H N N 250 SER N N N N 251 SER CA C N S 252 SER C C N N 253 SER O O N N 254 SER CB C N N 255 SER OG O N N 256 SER OXT O N N 257 SER H H N N 258 SER H2 H N N 259 SER HA H N N 260 SER HB2 H N N 261 SER HB3 H N N 262 SER HG H N N 263 SER HXT H N N 264 THR N N N N 265 THR CA C N S 266 THR C C N N 267 THR O O N N 268 THR CB C N R 269 THR OG1 O N N 270 THR CG2 C N N 271 THR OXT O N N 272 THR H H N N 273 THR H2 H N N 274 THR HA H N N 275 THR HB H N N 276 THR HG1 H N N 277 THR HG21 H N N 278 THR HG22 H N N 279 THR HG23 H N N 280 THR HXT H N N 281 TYR N N N N 282 TYR CA C N S 283 TYR C C N N 284 TYR O O N N 285 TYR CB C N N 286 TYR CG C Y N 287 TYR CD1 C Y N 288 TYR CD2 C Y N 289 TYR CE1 C Y N 290 TYR CE2 C Y N 291 TYR CZ C Y N 292 TYR OH O N N 293 TYR OXT O N N 294 TYR H H N N 295 TYR H2 H N N 296 TYR HA H N N 297 TYR HB2 H N N 298 TYR HB3 H N N 299 TYR HD1 H N N 300 TYR HD2 H N N 301 TYR HE1 H N N 302 TYR HE2 H N N 303 TYR HH H N N 304 TYR HXT H N N 305 VAL N N N N 306 VAL CA C N S 307 VAL C C N N 308 VAL O O N N 309 VAL CB C N N 310 VAL CG1 C N N 311 VAL CG2 C N N 312 VAL OXT O N N 313 VAL H H N N 314 VAL H2 H N N 315 VAL HA H N N 316 VAL HB H N N 317 VAL HG11 H N N 318 VAL HG12 H N N 319 VAL HG13 H N N 320 VAL HG21 H N N 321 VAL HG22 H N N 322 VAL HG23 H N N 323 VAL HXT H N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 VAL N CA sing N N 294 VAL N H sing N N 295 VAL N H2 sing N N 296 VAL CA C sing N N 297 VAL CA CB sing N N 298 VAL CA HA sing N N 299 VAL C O doub N N 300 VAL C OXT sing N N 301 VAL CB CG1 sing N N 302 VAL CB CG2 sing N N 303 VAL CB HB sing N N 304 VAL CG1 HG11 sing N N 305 VAL CG1 HG12 sing N N 306 VAL CG1 HG13 sing N N 307 VAL CG2 HG21 sing N N 308 VAL CG2 HG22 sing N N 309 VAL CG2 HG23 sing N N 310 VAL OXT HXT sing N N 311 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III HD' ? Bruker 750 ? 2 'AVANCE NEO' ? Bruker 800 ? 3 'AVANCE III HD' ? Bruker 600 ? 4 'Uniform NMR System' ? Varian 800 ? # _atom_sites.entry_id 8UBH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_